SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2F5X7 Cluster: Nuclear Y/CCAAT-box binding factor C su...   154   3e-36
UniRef50_UPI00005199C0 Cluster: PREDICTED: similar to Nuclear tr...   125   2e-27
UniRef50_UPI00015B60C2 Cluster: PREDICTED: similar to Intraflage...   124   2e-27
UniRef50_Q13952 Cluster: Nuclear transcription factor Y subunit ...   118   3e-25
UniRef50_Q9ZVL3 Cluster: Nuclear transcription factor Y subunit ...   103   8e-21
UniRef50_Q7QFE5 Cluster: ENSANGP00000020024; n=1; Anopheles gamb...   101   2e-20
UniRef50_A7NWG9 Cluster: Chromosome chr5 scaffold_2, whole genom...   101   2e-20
UniRef50_A5B819 Cluster: Putative uncharacterized protein; n=1; ...   101   3e-20
UniRef50_Q9FMV5 Cluster: Nuclear transcription factor Y subunit ...   101   3e-20
UniRef50_Q9W3V9 Cluster: CG3075-PA; n=2; Sophophora|Rep: CG3075-...    98   3e-19
UniRef50_Q5BW83 Cluster: SJCHGC07914 protein; n=1; Schistosoma j...    96   1e-18
UniRef50_Q6BS91 Cluster: Similarities with CA0749|CaHAP5 Candida...    95   2e-18
UniRef50_Q6CFV6 Cluster: Yarrowia lipolytica chromosome B of str...    92   2e-17
UniRef50_Q557I1 Cluster: Putative histone-like transcription fac...    91   3e-17
UniRef50_Q0J7B2 Cluster: Os08g0206500 protein; n=6; Oryza sativa...    91   5e-17
UniRef50_A6R9B9 Cluster: CCAAT-binding factor complex subunit Ha...    90   8e-17
UniRef50_Q02516 Cluster: Transcriptional activator HAP5; n=3; Sa...    89   1e-16
UniRef50_Q55QE0 Cluster: Putative uncharacterized protein; n=2; ...    88   3e-16
UniRef50_P79007 Cluster: Transcriptional activator hap5; n=1; Sc...    86   1e-15
UniRef50_Q24E56 Cluster: Histone-like transcription factor (CBF/...    84   5e-15
UniRef50_Q7RRA6 Cluster: Putative uncharacterized protein PY0082...    83   9e-15
UniRef50_A5K415 Cluster: Histone, putative; n=1; Plasmodium viva...    81   4e-14
UniRef50_Q9FGP7 Cluster: Nuclear transcription factor Y subunit ...    81   4e-14
UniRef50_Q4PSE2 Cluster: Nuclear transcription factor Y subunit ...    81   5e-14
UniRef50_Q8IL74 Cluster: Putative uncharacterized protein; n=1; ...    80   7e-14
UniRef50_A7QTE3 Cluster: Chromosome undetermined scaffold_167, w...    77   6e-13
UniRef50_Q55GE1 Cluster: Putative uncharacterized protein; n=1; ...    75   2e-12
UniRef50_Q4PDA5 Cluster: Putative uncharacterized protein; n=1; ...    73   1e-11
UniRef50_Q9FGP8 Cluster: Nuclear transcription factor Y subunit ...    72   2e-11
UniRef50_Q8SRY9 Cluster: CCAAT BOX BINDING FACTOR; n=1; Encephal...    70   9e-11
UniRef50_Q58CM8 Cluster: Nuclear transcription factor Y subunit ...    68   4e-10
UniRef50_O17072 Cluster: NFYC-1 protein; n=1; Caenorhabditis ele...    66   9e-10
UniRef50_Q4UHC3 Cluster: HAP-family transcription factor, putati...    63   8e-09
UniRef50_A7AW10 Cluster: Histone-like transcription factor (CBF/...    60   1e-07
UniRef50_Q259Q7 Cluster: H0306F12.4 protein; n=4; Magnoliophyta|...    57   5e-07
UniRef50_Q61QI8 Cluster: Putative uncharacterized protein CBG070...    57   5e-07
UniRef50_A2WPM3 Cluster: Putative uncharacterized protein; n=1; ...    54   7e-06
UniRef50_Q0DJB5 Cluster: Os05g0304800 protein; n=4; Oryza sativa...    52   2e-05
UniRef50_Q9W256 Cluster: CG11301-PA; n=3; Sophophora|Rep: CG1130...    52   2e-05
UniRef50_Q0JMZ9 Cluster: Os01g0346900 protein; n=7; Oryza sativa...    51   3e-05
UniRef50_UPI0000DB70B6 Cluster: PREDICTED: similar to Mes4 CG113...    50   8e-05
UniRef50_Q9NAC5 Cluster: Putative uncharacterized protein; n=2; ...    50   8e-05
UniRef50_Q16TX9 Cluster: DNA polymerase epsilon subunit, putativ...    49   2e-04
UniRef50_UPI00015B5C77 Cluster: PREDICTED: similar to GA10901-PA...    48   3e-04
UniRef50_A7S4W7 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    48   3e-04
UniRef50_Q7Q7X8 Cluster: ENSANGP00000011425; n=1; Anopheles gamb...    48   4e-04
UniRef50_Q558T1 Cluster: Putative histone-like transcription fac...    48   4e-04
UniRef50_Q14919 Cluster: Dr1-associated corepressor; n=20; Eutel...    47   6e-04
UniRef50_UPI0000583E0D Cluster: PREDICTED: similar to Dr1 associ...    47   7e-04
UniRef50_UPI0000499C7F Cluster: histone-like transcription facto...    46   0.001
UniRef50_A0NGB6 Cluster: ENSANGP00000029798; n=1; Anopheles gamb...    46   0.001
UniRef50_A7QMG3 Cluster: Chromosome undetermined scaffold_125, w...    46   0.002
UniRef50_Q9LHG0 Cluster: Arabidopsis thaliana genomic DNA, chrom...    45   0.002
UniRef50_Q5CQK9 Cluster: CCAAT-binding factor chain HAP5 like hi...    45   0.003
UniRef50_Q8W0W7 Cluster: Repressor protein; n=5; Poaceae|Rep: Re...    44   0.004
UniRef50_Q8SQT6 Cluster: CLASS 2 TRANSCRIPTIONAL REPRESSOR simil...    44   0.005
UniRef50_Q7RW27 Cluster: Putative uncharacterized protein NCU064...    44   0.005
UniRef50_UPI00004987F6 Cluster: histone-like transcription facto...    43   0.009
UniRef50_Q9NRG0 Cluster: Chromatin accessibility complex protein...    43   0.009
UniRef50_UPI0000D573E2 Cluster: PREDICTED: similar to CG11301-PA...    43   0.012
UniRef50_Q10315 Cluster: DNA polymerase epsilon subunit C; n=1; ...    42   0.016
UniRef50_UPI00015B431F Cluster: PREDICTED: similar to NC2alpha; ...    42   0.021
UniRef50_UPI000023F56A Cluster: hypothetical protein FG05498.1; ...    42   0.021
UniRef50_Q012F7 Cluster: Drap1 protein; n=2; Ostreococcus|Rep: D...    42   0.021
UniRef50_Q00W27 Cluster: DNA polymerase epsilon, subunit C; n=3;...    42   0.021
UniRef50_Q1E9R3 Cluster: Putative uncharacterized protein; n=1; ...    42   0.021
UniRef50_UPI0000D5778C Cluster: PREDICTED: similar to CG10318-PA...    41   0.037
UniRef50_Q503Q5 Cluster: Zgc:110337; n=3; Danio rerio|Rep: Zgc:1...    41   0.037
UniRef50_Q9FHS0 Cluster: Arabidopsis thaliana genomic DNA, chrom...    41   0.037
UniRef50_Q2H8U2 Cluster: Putative uncharacterized protein; n=1; ...    41   0.049
UniRef50_A5E3I3 Cluster: DNA polymerase epsilon subunit C; n=6; ...    41   0.049
UniRef50_Q4P042 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_A7TQM7 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_A2QBU3 Cluster: Function: negative co-factor 2; n=2; Eu...    40   0.065
UniRef50_Q5KDK2 Cluster: DNA polymerase epsilon p12 subunit (Dna...    40   0.086
UniRef50_Q9NR33 Cluster: DNA polymerase epsilon subunit 4; n=24;...    40   0.086
UniRef50_UPI0000DB73CD Cluster: PREDICTED: similar to Chrac-16 C...    40   0.11 
UniRef50_Q07G02 Cluster: Chromatin accessibility complex 1; n=3;...    40   0.11 
UniRef50_Q9GSP1 Cluster: NC2alpha; n=4; Sophophora|Rep: NC2alpha...    40   0.11 
UniRef50_A7RQA2 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.11 
UniRef50_A4R921 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_UPI0000D56C5F Cluster: PREDICTED: similar to CG15736-PA...    39   0.15 
UniRef50_Q7QXC2 Cluster: GLP_741_38544_38200; n=1; Giardia lambl...    39   0.15 
UniRef50_UPI000150A242 Cluster: hypothetical protein TTHERM_0044...    39   0.20 
UniRef50_A7QP68 Cluster: Chromosome chr1 scaffold_136, whole gen...    38   0.35 
UniRef50_Q6C6M5 Cluster: DNA polymerase epsilon subunit C; n=2; ...    38   0.46 
UniRef50_UPI0000E21CC6 Cluster: PREDICTED: similar to CHRAC15; n...    37   0.61 
UniRef50_A3LRE3 Cluster: DNA-directed DNA polymerase epsilon, su...    37   0.61 
UniRef50_A7ETC1 Cluster: Predicted protein; n=2; Sclerotiniaceae...    36   1.1  
UniRef50_UPI000023D814 Cluster: hypothetical protein FG05304.1; ...    36   1.4  
UniRef50_A7S160 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.4  
UniRef50_Q6CTK6 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    36   1.4  
UniRef50_Q6BX14 Cluster: DNA polymerase epsilon subunit C; n=1; ...    36   1.4  
UniRef50_Q171Z8 Cluster: Histone-fold protein CHRAC subunit, put...    36   1.9  
UniRef50_P40096 Cluster: Negative cofactor 2 complex subunit alp...    36   1.9  
UniRef50_UPI0000498E96 Cluster: hypothetical protein 129.t00029;...    35   2.4  
UniRef50_Q7S9P3 Cluster: Putative uncharacterized protein NCU066...    35   3.2  
UniRef50_UPI000150A306 Cluster: hypothetical protein TTHERM_0047...    33   7.5  
UniRef50_Q9V452 Cluster: CG15736-PA; n=2; Sophophora|Rep: CG1573...    33   7.5  
UniRef50_A6SQ32 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_A5UVR3 Cluster: tRNA/rRNA methyltransferase; n=2; Rosei...    33   9.9  
UniRef50_Q4PG57 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  
UniRef50_A5DBV9 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  

>UniRef50_Q2F5X7 Cluster: Nuclear Y/CCAAT-box binding factor C
           subunit NF/YC; n=1; Bombyx mori|Rep: Nuclear Y/CCAAT-box
           binding factor C subunit NF/YC - Bombyx mori (Silk moth)
          Length = 293

 Score =  154 bits (374), Expect = 3e-36
 Identities = 75/76 (98%), Positives = 75/76 (98%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF
Sbjct: 37  QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 96

Query: 469 IHELTLRAWSHTEEIK 516
           IHELTLRAWSHTEE K
Sbjct: 97  IHELTLRAWSHTEENK 112



 Score = 90.6 bits (215), Expect = 5e-17
 Identities = 44/62 (70%), Positives = 45/62 (72%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTDQYYXXXXXXXXXXXXXXXXPQIV 727
           +ILKSDQFDFLIDIVPRHEVKPTKPRYDAA KAPSTDQYY                PQIV
Sbjct: 124 AILKSDQFDFLIDIVPRHEVKPTKPRYDAARKAPSTDQYYLQLAQQHQAALQNSSQPQIV 183

Query: 728 IQ 733
           IQ
Sbjct: 184 IQ 185



 Score = 39.9 bits (89), Expect = 0.086
 Identities = 18/25 (72%), Positives = 19/25 (76%)
 Frame = +3

Query: 183 MSMCFFVPAEQXXXXXXSEEVDADL 257
           MSMCFFVPAEQ      SEEVDAD+
Sbjct: 1   MSMCFFVPAEQTTTVTTSEEVDADV 25


>UniRef50_UPI00005199C0 Cluster: PREDICTED: similar to Nuclear
           transcription factor Y subunit gamma (Nuclear
           transcription factor Y subunit C) (NF-YC) (CAAT-box
           DNA-binding protein subunit C) (CCAAT-binding
           transcription factor subunit C) (CBF-C); n=2;
           Endopterygota|Rep: PREDICTED: similar to Nuclear
           transcription factor Y subunit gamma (Nuclear
           transcription factor Y subunit C) (NF-YC) (CAAT-box
           DNA-binding protein subunit C) (CCAAT-binding
           transcription factor subunit C) (CBF-C) - Apis mellifera
          Length = 346

 Score =  125 bits (301), Expect = 2e-27
 Identities = 58/76 (76%), Positives = 68/76 (89%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           QTL QFW KV E+I+K+ + D KTQ+LPLARIKKIMKLD++VKMISAEAP+LF+KAAEIF
Sbjct: 34  QTLAQFWPKVTEEIKKITTMDLKTQSLPLARIKKIMKLDDDVKMISAEAPMLFSKAAEIF 93

Query: 469 IHELTLRAWSHTEEIK 516
           IHELTLRAW HTE+ K
Sbjct: 94  IHELTLRAWVHTEDNK 109



 Score = 39.9 bits (89), Expect = 0.086
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXK-APSTDQYY 667
           +I K DQFDFLIDIVPR E+K +K + ++  + + ++DQ +
Sbjct: 121 AITKYDQFDFLIDIVPRDELKQSKAQTESTVRTSMNSDQVH 161


>UniRef50_UPI00015B60C2 Cluster: PREDICTED: similar to
           Intraflagellar transport 52 homolog (Chlamydomonas);
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           Intraflagellar transport 52 homolog (Chlamydomonas) -
           Nasonia vitripennis
          Length = 774

 Score =  124 bits (300), Expect = 2e-27
 Identities = 58/76 (76%), Positives = 67/76 (88%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q L QFW KV E+I+K+ + D KTQ+LPLARIKKIMKLDE+VKMISAEAP+LF+KAAEIF
Sbjct: 486 QALNQFWPKVTEEIKKITTMDLKTQSLPLARIKKIMKLDEDVKMISAEAPMLFSKAAEIF 545

Query: 469 IHELTLRAWSHTEEIK 516
           IHELTLRAW HTE+ K
Sbjct: 546 IHELTLRAWVHTEDNK 561



 Score = 40.3 bits (90), Expect = 0.065
 Identities = 20/41 (48%), Positives = 29/41 (70%), Gaps = 1/41 (2%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXK-APSTDQYY 667
           +I K DQFDFLIDIVPR E+K +K + D   + + ++DQ +
Sbjct: 573 AITKYDQFDFLIDIVPRDELKQSKAQSDNTVRTSMNSDQVH 613


>UniRef50_Q13952 Cluster: Nuclear transcription factor Y subunit
           gamma; n=61; Deuterostomia|Rep: Nuclear transcription
           factor Y subunit gamma - Homo sapiens (Human)
          Length = 458

 Score =  118 bits (283), Expect = 3e-25
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>UniRef50_Q9ZVL3 Cluster: Nuclear transcription factor Y subunit
           C-3; n=13; Magnoliophyta|Rep: Nuclear transcription
           factor Y subunit C-3 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 217

 Score =  103 bits (246), Expect = 8e-21
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 47  QQLQSFWETQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMF 104

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 105 ILELTLRSWNHTEENK 120


>UniRef50_Q7QFE5 Cluster: ENSANGP00000020024; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000020024 - Anopheles gambiae
           str. PEST
          Length = 263

 Score =  101 bits (243), Expect = 2e-20
 Identities = 48/76 (63%), Positives = 60/76 (78%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           + +Q+FW  V+ +IQ++   +   Q LPLARIKKIMKLDEEVKMIS++AP+LF+KA EIF
Sbjct: 16  RNIQRFWPGVMREIQQIEYVEPGNQLLPLARIKKIMKLDEEVKMISSDAPLLFSKAIEIF 75

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE  K
Sbjct: 76  IQELTLRAWLHTEHNK 91



 Score = 37.1 bits (82), Expect = 0.61
 Identities = 16/21 (76%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I K DQFDFLIDIVPR E+K
Sbjct: 103 AITKYDQFDFLIDIVPRDEIK 123


>UniRef50_A7NWG9 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 273

 Score =  101 bits (242), Expect = 2e-20
 Identities = 48/76 (63%), Positives = 60/76 (78%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW    ++I++    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 91  QQLQNFWQNQYQEIEQTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMF 148

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 149 ILELTLRSWNHTEENK 164


>UniRef50_A5B819 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 264

 Score =  101 bits (241), Expect = 3e-20
 Identities = 49/76 (64%), Positives = 60/76 (78%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW    ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 80  QQLQSFWANQHQEIEKAT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMF 137

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 138 ILELTLRSWNHTEENK 153


>UniRef50_Q9FMV5 Cluster: Nuclear transcription factor Y subunit
           C-4; n=17; Magnoliophyta|Rep: Nuclear transcription
           factor Y subunit C-4 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 250

 Score =  101 bits (241), Expect = 3e-20
 Identities = 49/76 (64%), Positives = 59/76 (77%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW    ++I++VN  DFK   LPLARIKKIMK DE+V+MISAEAP+LFAKA E+F
Sbjct: 55  QQLQMFWTYQRQEIEQVN--DFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELF 112

Query: 469 IHELTLRAWSHTEEIK 516
           I ELT+R+W H EE K
Sbjct: 113 ILELTIRSWLHAEENK 128



 Score = 33.9 bits (74), Expect = 5.7
 Identities = 13/21 (61%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D FDFL+DIVPR E+K
Sbjct: 140 AITRTDIFDFLVDIVPREEIK 160


>UniRef50_Q9W3V9 Cluster: CG3075-PA; n=2; Sophophora|Rep: CG3075-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 601

 Score = 97.9 bits (233), Expect = 3e-19
 Identities = 43/73 (58%), Positives = 52/73 (71%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           T+  FW  ++ ++  +   D K Q LPLARIKKIMKLDE  KMI+ EAP+LFAKA E FI
Sbjct: 129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFI 188

Query: 472 HELTLRAWSHTEE 510
            ELT+ AW HTEE
Sbjct: 189 QELTMHAWVHTEE 201



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +2

Query: 542 SDSILKSDQFDFLIDIVPRHEVKPT 616
           + +I   DQFDFLIDIVPR E+KP+
Sbjct: 213 AQAIANYDQFDFLIDIVPREEIKPS 237


>UniRef50_Q5BW83 Cluster: SJCHGC07914 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC07914 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 230

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 4/72 (5%)
 Frame = +1

Query: 304 FWDKVLEDIQ--KVNSEDFKTQALPLARIKKIMKLDEEVK--MISAEAPVLFAKAAEIFI 471
           FWD +  +I   K +   FKTQ LPLARIKKIMKLD+++K  MISAEAP+LFAKAAE+FI
Sbjct: 18  FWDLIRVEIDGLKCDHAAFKTQDLPLARIKKIMKLDDDIKCMMISAEAPILFAKAAELFI 77

Query: 472 HELTLRAWSHTE 507
            ELTLRAW HTE
Sbjct: 78  RELTLRAWIHTE 89



 Score = 33.1 bits (72), Expect = 9.9
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 503 RRK*KADSAAQRHSDSILKSDQFDFLIDIVPRHEVK 610
           RR  + +  A   SD    +DQFDFLIDIVPR E +
Sbjct: 93  RRTLQRNDIAMAVSDG--DTDQFDFLIDIVPREEAR 126


>UniRef50_Q6BS91 Cluster: Similarities with CA0749|CaHAP5 Candida
           albicans CaHAP5; n=8; Saccharomycetales|Rep:
           Similarities with CA0749|CaHAP5 Candida albicans CaHAP5
           - Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 393

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 42/74 (56%), Positives = 55/74 (74%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           + Q+W + +  I+  +  DFK   LPLARIKK+MK DE+V+MISAEAP+LFAK  ++FI 
Sbjct: 82  MMQYWQETINSIEH-DEHDFKNHQLPLARIKKVMKTDEDVRMISAEAPILFAKGCDVFIT 140

Query: 475 ELTLRAWSHTEEIK 516
           ELT+RAW H EE K
Sbjct: 141 ELTMRAWIHAEENK 154



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTK 619
           ++ KSD FDFLIDIVPR E KP K
Sbjct: 166 ALTKSDMFDFLIDIVPREEEKPKK 189


>UniRef50_Q6CFV6 Cluster: Yarrowia lipolytica chromosome B of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome B of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 239

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 41/71 (57%), Positives = 54/71 (76%)
 Frame = +1

Query: 304 FWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           +W +++  I+  +  +FK   LPLARIKK+MK DE+VKMISAEAP+LFAK  +IFI EL+
Sbjct: 72  YWQEIISSIEH-DEHEFKVHQLPLARIKKVMKADEDVKMISAEAPILFAKGCDIFITELS 130

Query: 484 LRAWSHTEEIK 516
           +RAW H EE K
Sbjct: 131 MRAWIHAEEHK 141


>UniRef50_Q557I1 Cluster: Putative histone-like transcription
           factor; n=2; Dictyostelium discoideum|Rep: Putative
           histone-like transcription factor - Dictyostelium
           discoideum AX4
          Length = 684

 Score = 91.5 bits (217), Expect = 3e-17
 Identities = 45/71 (63%), Positives = 52/71 (73%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           L  FW   L DI K  +EDFKT  LPLARIKKIMK D++V  IS+EAP+LFAKA EI I 
Sbjct: 249 LSSFWSSQLRDIHK--TEDFKTHELPLARIKKIMKSDKDVNKISSEAPILFAKACEILIL 306

Query: 475 ELTLRAWSHTE 507
           E+T R+W HTE
Sbjct: 307 EMTHRSWVHTE 317



 Score = 37.5 bits (83), Expect = 0.46
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +2

Query: 545 DSILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKA 646
           +S+ + + FDFLID++PR E+KP++   D   KA
Sbjct: 331 NSLSRCETFDFLIDMLPRDEIKPSRKYLDELSKA 364


>UniRef50_Q0J7B2 Cluster: Os08g0206500 protein; n=6; Oryza
           sativa|Rep: Os08g0206500 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 333

 Score = 90.6 bits (215), Expect = 5e-17
 Identities = 42/74 (56%), Positives = 56/74 (75%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           + LQ FW   + +++++   +FK   LPLARIKKIMK DE+VKMI+ EAP LFAKA E+F
Sbjct: 161 EQLQAFWADQMAEVEQMT--EFKLPNLPLARIKKIMKADEDVKMIAGEAPALFAKACEMF 218

Query: 469 IHELTLRAWSHTEE 510
           I ++TLR+W HTEE
Sbjct: 219 ILDMTLRSWQHTEE 232


>UniRef50_A6R9B9 Cluster: CCAAT-binding factor complex subunit HapE;
           n=20; Pezizomycotina|Rep: CCAAT-binding factor complex
           subunit HapE - Ajellomyces capsulatus NAm1
          Length = 286

 Score = 89.8 bits (213), Expect = 8e-17
 Identities = 42/74 (56%), Positives = 52/74 (70%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           L  +W   +  ++  N  D+K   LPLARIKK+MK D EVKMISAEAP+LFAK  +IFI 
Sbjct: 48  LTTYWQHTINHLESDN-HDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDIFIT 106

Query: 475 ELTLRAWSHTEEIK 516
           ELT+RAW H E+ K
Sbjct: 107 ELTMRAWIHAEDNK 120



 Score = 37.1 bits (82), Expect = 0.61
 Identities = 19/35 (54%), Positives = 23/35 (65%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPS 652
           ++ KSD FDFLIDIVPR E  P   R  +A  AP+
Sbjct: 132 ALSKSDMFDFLIDIVPREEATPHAKR--SAQTAPT 164


>UniRef50_Q02516 Cluster: Transcriptional activator HAP5; n=3;
           Saccharomycetales|Rep: Transcriptional activator HAP5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 242

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 41/78 (52%), Positives = 57/78 (73%), Gaps = 6/78 (7%)
 Frame = +1

Query: 301 QFWDKVLEDIQKVNS------EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAE 462
           ++W +++ +I+  N       +DFK+ +LP ARI+K+MK DE+VKMISAEAP++FAKA E
Sbjct: 132 RYWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACE 191

Query: 463 IFIHELTLRAWSHTEEIK 516
           IFI ELT+RAW   E  K
Sbjct: 192 IFITELTMRAWCVAERNK 209


>UniRef50_Q55QE0 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 611

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 42/74 (56%), Positives = 55/74 (74%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           L+ FW + ++ ++   + D+K+  LPLARIKK+MK DEEVKMISAEAP++F+KA EIFI 
Sbjct: 439 LESFWTRQMDTVEG-ETPDWKSYNLPLARIKKVMKSDEEVKMISAEAPIMFSKACEIFIS 497

Query: 475 ELTLRAWSHTEEIK 516
           ELT RAW   E  K
Sbjct: 498 ELTCRAWLVAESHK 511


>UniRef50_P79007 Cluster: Transcriptional activator hap5; n=1;
           Schizosaccharomyces pombe|Rep: Transcriptional activator
           hap5 - Schizosaccharomyces pombe (Fission yeast)
          Length = 415

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 42/77 (54%), Positives = 57/77 (74%), Gaps = 2/77 (2%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK--MISAEAPVLFAKAA 459
           AQ L ++W K ++ ++  + +  KT  LPLARIKK+MK D++VK  MISAEAP LFAK +
Sbjct: 83  AQALAEYWQKTIDTLEH-DDQAVKTLHLPLARIKKVMKTDDDVKNKMISAEAPFLFAKGS 141

Query: 460 EIFIHELTLRAWSHTEE 510
           EIFI ELT+RAW H ++
Sbjct: 142 EIFIAELTMRAWLHAKK 158


>UniRef50_Q24E56 Cluster: Histone-like transcription factor
           (CBF/NF-Y) and archaeal histone; n=2;
           Oligohymenophorea|Rep: Histone-like transcription factor
           (CBF/NF-Y) and archaeal histone - Tetrahymena
           thermophila SB210
          Length = 322

 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 42/57 (73%), Positives = 47/57 (82%)
 Frame = +1

Query: 346 EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           E F++  LPLAR+KKIMK DE+V+MISAEAPVLFAKA EIFI ELT RAW  TEE K
Sbjct: 104 EVFRSHQLPLARVKKIMKSDEDVRMISAEAPVLFAKACEIFIIELTHRAWLFTEEGK 160


>UniRef50_Q7RRA6 Cluster: Putative uncharacterized protein PY00826;
           n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY00826 - Plasmodium yoelii yoelii
          Length = 965

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 40/77 (51%), Positives = 52/77 (67%), Gaps = 3/77 (3%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK---MISAEAPVLFAKAAEI 465
           +  FW   L+DI  +  E+ KT  LP++RIKKIMK D+++K   MISA+ PVL AKA E+
Sbjct: 11  MNTFWKNQLDDITNITPEELKTHQLPISRIKKIMKEDDKIKNSQMISADTPVLLAKACEL 70

Query: 466 FIHELTLRAWSHTEEIK 516
           FI E T  AW +TEE K
Sbjct: 71  FIMEFTKYAWKYTEENK 87


>UniRef50_A5K415 Cluster: Histone, putative; n=1; Plasmodium
           vivax|Rep: Histone, putative - Plasmodium vivax
          Length = 1233

 Score = 81.0 bits (191), Expect = 4e-14
 Identities = 40/74 (54%), Positives = 51/74 (68%), Gaps = 3/74 (4%)
 Frame = +1

Query: 304 FWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK---MISAEAPVLFAKAAEIFIH 474
           FW   L +I  ++ ED +T  LP++RIKKIMK D+E+K   M+SA+ PVL AKA E+FI 
Sbjct: 14  FWKNQLAEISNMSVEDLRTHNLPISRIKKIMKEDDEIKSNQMVSADTPVLLAKACELFIM 73

Query: 475 ELTLRAWSHTEEIK 516
           ELT  AW  TEE K
Sbjct: 74  ELTNYAWKFTEESK 87


>UniRef50_Q9FGP7 Cluster: Nuclear transcription factor Y subunit
           C-6; n=1; Arabidopsis thaliana|Rep: Nuclear
           transcription factor Y subunit C-6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 202

 Score = 81.0 bits (191), Expect = 4e-14
 Identities = 39/74 (52%), Positives = 53/74 (71%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           L+ +W + +E +      DFK + LPLARIKKIMK D +V M+SAEAP++FAKA E+FI 
Sbjct: 36  LRNYWIEQMETVS-----DFKNRQLPLARIKKIMKADPDVHMVSAEAPIIFAKACEMFIV 90

Query: 475 ELTLRAWSHTEEIK 516
           +LT+R+W   EE K
Sbjct: 91  DLTMRSWLKAEENK 104


>UniRef50_Q4PSE2 Cluster: Nuclear transcription factor Y subunit
           C-8; n=2; Arabidopsis thaliana|Rep: Nuclear
           transcription factor Y subunit C-8 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 187

 Score = 80.6 bits (190), Expect = 5e-14
 Identities = 38/78 (48%), Positives = 53/78 (67%)
 Frame = +1

Query: 283 GAQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAE 462
           G + L+ FW K +E      + DFK   LP+ RIKKIMK D +V MI++EAP+L +KA E
Sbjct: 14  GNEQLKSFWSKEME-----GNLDFKNHDLPITRIKKIMKYDPDVTMIASEAPILLSKACE 68

Query: 463 IFIHELTLRAWSHTEEIK 516
           +FI +LT+R+W H +E K
Sbjct: 69  MFIMDLTMRSWLHAQESK 86


>UniRef50_Q8IL74 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 1076

 Score = 80.2 bits (189), Expect = 7e-14
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +1

Query: 304 FWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK---MISAEAPVLFAKAAEIFIH 474
           FW + L +I  ++ ED K   LP++RIKKIMK D+E+K   M+SA+ PVL AKA E+FI 
Sbjct: 14  FWKEQLFEICNMSPEDLKIHNLPISRIKKIMKEDDEIKSNQMVSADTPVLLAKACELFIM 73

Query: 475 ELTLRAWSHTEEIK 516
           ELT  AW +TEE K
Sbjct: 74  ELTSNAWKYTEEGK 87


>UniRef50_A7QTE3 Cluster: Chromosome undetermined scaffold_167,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_167, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 134

 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 39/57 (68%), Positives = 46/57 (80%), Gaps = 1/57 (1%)
 Frame = +1

Query: 349 DFKTQ-ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           DFK Q ALPLARIK+IMK +  VKMISA++ +LFAKA+E+FI ELTLRAW H E  K
Sbjct: 25  DFKGQHALPLARIKRIMKANRNVKMISADSQILFAKASELFILELTLRAWFHAEANK 81


>UniRef50_Q55GE1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1064

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/74 (51%), Positives = 50/74 (67%), Gaps = 1/74 (1%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSE-DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           +++   W K+ +D+++ +      T  LPLARIKKIMK D  VKMIS EAP+LFAKA E 
Sbjct: 575 KSMGDVWLKINKDVEEGSPTLPSATSTLPLARIKKIMKSDPGVKMISWEAPILFAKACEF 634

Query: 466 FIHELTLRAWSHTE 507
           FI EL  R+W HT+
Sbjct: 635 FILELAARSWIHTD 648


>UniRef50_Q4PDA5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 374

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 5/64 (7%)
 Frame = +1

Query: 340 NSEDFK----TQA-LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           N  DFK    TQ  LPLARIKK+MK D++VKMISAEAP+LFA+A EIFI +LT RA+   
Sbjct: 76  NIVDFKSGLPTQGQLPLARIKKVMKSDDQVKMISAEAPILFARACEIFISDLTCRAFLIA 135

Query: 505 EEIK 516
           EE K
Sbjct: 136 EEHK 139



 Score = 36.3 bits (80), Expect = 1.1
 Identities = 16/23 (69%), Positives = 19/23 (82%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPT 616
           +I +SD FDFLIDIVPRHE  P+
Sbjct: 151 AIGRSDLFDFLIDIVPRHESVPS 173


>UniRef50_Q9FGP8 Cluster: Nuclear transcription factor Y subunit
           C-7; n=1; Arabidopsis thaliana|Rep: Nuclear
           transcription factor Y subunit C-7 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 212

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/60 (56%), Positives = 43/60 (71%)
 Frame = +1

Query: 331 QKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           Q  N+ D K  A PL RIKKIMK + EV M++AEAPVL +KA E+ I +LT+R+W HT E
Sbjct: 52  QMGNATDVKHHAFPLTRIKKIMKSNPEVNMVTAEAPVLISKACEMLILDLTMRSWLHTVE 111


>UniRef50_Q8SRY9 Cluster: CCAAT BOX BINDING FACTOR; n=1;
           Encephalitozoon cuniculi|Rep: CCAAT BOX BINDING FACTOR -
           Encephalitozoon cuniculi
          Length = 219

 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 34/76 (44%), Positives = 50/76 (65%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           + + +FW +  +   +      K   LPLARIK++MK++E V+M+++E PVLF+   E F
Sbjct: 14  ERISRFWHQTFKAAMEERIL-LKDLNLPLARIKRLMKIEEGVRMVASEVPVLFSMITEKF 72

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW +TEE K
Sbjct: 73  IEELTLRAWINTEENK 88


>UniRef50_Q58CM8 Cluster: Nuclear transcription factor Y subunit
           C-10; n=2; Arabidopsis thaliana|Rep: Nuclear
           transcription factor Y subunit C-10 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 195

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 1/66 (1%)
 Frame = +1

Query: 313 KVLEDIQKVNSEDFKTQA-LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLR 489
           KV  + Q+    +F  Q  LPL+R++KI+K D EVK IS + P LF+KA E FI E+TLR
Sbjct: 49  KVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKISCDVPALFSKACEYFILEVTLR 108

Query: 490 AWSHTE 507
           AW HT+
Sbjct: 109 AWMHTQ 114


>UniRef50_O17072 Cluster: NFYC-1 protein; n=1; Caenorhabditis
           elegans|Rep: NFYC-1 protein - Caenorhabditis elegans
          Length = 232

 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 29/82 (35%), Positives = 53/82 (64%), Gaps = 6/82 (7%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDF----KTQALPLARIKKIMKLDEEVK--MISAEAPVLFA 450
           Q  + FW +  + + +++ ED     K  ++P+AR+KKIM++D++V+  MI+++AP+  A
Sbjct: 80  QMTEDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMA 139

Query: 451 KAAEIFIHELTLRAWSHTEEIK 516
           +AAE FI E+T   W +  E +
Sbjct: 140 QAAEFFIEEMTAMGWQYVSEAR 161


>UniRef50_Q4UHC3 Cluster: HAP-family transcription factor, putative;
           n=2; Theileria|Rep: HAP-family transcription factor,
           putative - Theileria annulata
          Length = 251

 Score = 63.3 bits (147), Expect = 8e-09
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +1

Query: 340 NSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           NS+  K   LP+AR+KKIMK  E   MIS++APV+ AKA E+ I +LTL++W+ T+  K
Sbjct: 25  NSDPVKGSHLPVARVKKIMKETEHQGMISSDAPVILAKACEMLIRDLTLQSWNCTQMTK 83


>UniRef50_A7AW10 Cluster: Histone-like transcription factor
           (CBF/NF-Y) and archaeal histone domain containing
           protein; n=1; Babesia bovis|Rep: Histone-like
           transcription factor (CBF/NF-Y) and archaeal histone
           domain containing protein - Babesia bovis
          Length = 295

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 29/50 (58%), Positives = 37/50 (74%)
 Frame = +1

Query: 355 KTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           K+  LP+ARIKKIMK  E   MI+A+APVL AKA E+ I +LTL++W  T
Sbjct: 40  KSNNLPIARIKKIMKEGEHPGMIAADAPVLLAKACEMLIKDLTLQSWDCT 89


>UniRef50_Q259Q7 Cluster: H0306F12.4 protein; n=4;
           Magnoliophyta|Rep: H0306F12.4 protein - Oryza sativa
           (Rice)
          Length = 122

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 10/61 (16%)
 Frame = +1

Query: 364 ALPLARIKKIMKL---DEEV-------KMISAEAPVLFAKAAEIFIHELTLRAWSHTEEI 513
           ALPLARIKKIMK    D  V       +MIS EAPV+F+KA E+FI ELT RAW+ T E 
Sbjct: 23  ALPLARIKKIMKRSAGDSSVVDGGGGARMISGEAPVVFSKACELFIAELTRRAWAATLEG 82

Query: 514 K 516
           K
Sbjct: 83  K 83


>UniRef50_Q61QI8 Cluster: Putative uncharacterized protein CBG07003;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07003 - Caenorhabditis
           briggsae
          Length = 313

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = +1

Query: 298 QQFWDKVLEDIQKVNSEDFKTQA----LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           + FW +    +  +  E+  T++    +P+AR+KKIMK+DE+   I+++AP+  A+AAE 
Sbjct: 112 EDFWRERKRKMWDIPEEEMATKSKNMSVPMARVKKIMKIDED--NIASDAPIFMAQAAEF 169

Query: 466 FIHELTLRAWSHTEEIK 516
           FI E+T   W +  E +
Sbjct: 170 FIEEMTAMGWQYVSEAR 186


>UniRef50_A2WPM3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 352

 Score = 53.6 bits (123), Expect = 7e-06
 Identities = 23/70 (32%), Positives = 41/70 (58%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q + +FW    ++I+  N  DF    +P+AR+KKI+   +   M++ + P   +K  E+F
Sbjct: 4   QQMDEFWRDRQKEIEMTN--DFSEHMIPMARLKKIVSSQKGNMMMTFDMPAFLSKMCELF 61

Query: 469 IHELTLRAWS 498
           + EL +RAW+
Sbjct: 62  VQELAVRAWA 71


>UniRef50_Q0DJB5 Cluster: Os05g0304800 protein; n=4; Oryza
           sativa|Rep: Os05g0304800 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 327

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 8/134 (5%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           +++FW +  E I+   S       LP+  +K +++   +  M+SA+ P    K  E+F+ 
Sbjct: 31  MEEFWRRSQEQIEA--SAGNHEHILPIDCVKNVIRPKNDAMMLSADTPTFVTKLCELFVQ 88

Query: 475 ELTLRAW----SHTEEIKGGLCSA---TT*RQYIEIGSVRFPDRHSAAA*SQAD-ETALR 630
           ELTLRAW    SH  +I  G   A   TT   Y  +G+V     H A   +  D +T+ R
Sbjct: 89  ELTLRAWVCANSHNRDIILGTDIAEAITTTESYHFLGNVL--RSHKALGSTAPDIDTSAR 146

Query: 631 RRXESPQHGSVLPP 672
           +  +  Q  S+  P
Sbjct: 147 KHIKLDQMTSLYHP 160


>UniRef50_Q9W256 Cluster: CG11301-PA; n=3; Sophophora|Rep:
           CG11301-PA - Drosophila melanogaster (Fruit fly)
          Length = 155

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSE-DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           T +Q  +K + +  K  ++ + K   LPLARI+ IMKLD ++ M + EA  + AKA E+F
Sbjct: 52  TTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELF 111

Query: 469 IHELTLRAWSHTEEIK 516
           I  L+  ++++T + K
Sbjct: 112 IASLSRESYTYTAQSK 127


>UniRef50_Q0JMZ9 Cluster: Os01g0346900 protein; n=7; Oryza
           sativa|Rep: Os01g0346900 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 444

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q + +FW    ++I+   ++DF    +P+AR+KKI+   +   M++ + P   +K  E+F
Sbjct: 20  QQMDEFWRDRQKEIEM--TKDFSEHMIPMARLKKIVSSQKGNMMMTFDMPAFLSKMCELF 77

Query: 469 IHELTLRAWS 498
           + EL  RAW+
Sbjct: 78  VQELAARAWA 87


>UniRef50_UPI0000DB70B6 Cluster: PREDICTED: similar to Mes4
           CG11301-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to Mes4 CG11301-PA - Apis mellifera
          Length = 102

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 28/69 (40%), Positives = 40/69 (57%)
 Frame = +1

Query: 310 DKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLR 489
           DK L + QK      K   LPL RIK I+K+D EV M++ EA  L  K+ E+FI  L   
Sbjct: 12  DKELNEKQKE-----KLVKLPLGRIKTIIKMDPEVHMVNQEAVFLITKSTELFIDSLAKE 66

Query: 490 AWSHTEEIK 516
           ++ +T ++K
Sbjct: 67  SYKYTAQMK 75


>UniRef50_Q9NAC5 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 179

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 23/56 (41%), Positives = 40/56 (71%), Gaps = 2/56 (3%)
 Frame = +1

Query: 322 EDIQKVNS--EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           ED++++    E+     LPL R+KK+++++ +V+M++ EA  L AKAAE+FI EL+
Sbjct: 19  EDVREIEEHVEELVRSQLPLGRVKKVVRMNPDVEMLNNEALQLMAKAAELFIKELS 74


>UniRef50_Q16TX9 Cluster: DNA polymerase epsilon subunit, putative;
           n=1; Aedes aegypti|Rep: DNA polymerase epsilon subunit,
           putative - Aedes aegypti (Yellowfever mosquito)
          Length = 196

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +1

Query: 331 QKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           +K +SE   TQ LPL++IK IMK D +V +++AEA  L  +AAE+F+  +   A  HT  
Sbjct: 108 RKESSEQRLTQ-LPLSKIKSIMKADPDVHIVAAEAIFLMTRAAELFVQNMAKEA--HTYA 164

Query: 511 IKG 519
           + G
Sbjct: 165 VAG 167


>UniRef50_UPI00015B5C77 Cluster: PREDICTED: similar to GA10901-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA10901-PA - Nasonia vitripennis
          Length = 134

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 355 KTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           K   LP+ R+KKI K D ++ +I+ EA  L  KA E+FI  L+  ++ +T + K
Sbjct: 55  KLTQLPIGRVKKIAKSDSDINLINQEAIFLITKATELFIDSLSKESYKYTHQAK 108


>UniRef50_A7S4W7 Cluster: Predicted protein; n=2; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 93

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/46 (47%), Positives = 33/46 (71%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           P ARIKKIM+ DE+V  ++A  PV+ +KA EIF+  L  +A ++T+
Sbjct: 13  PPARIKKIMQTDEDVGKVAAAVPVIISKALEIFMQTLVEKACNYTQ 58


>UniRef50_Q7Q7X8 Cluster: ENSANGP00000011425; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000011425 - Anopheles gambiae
           str. PEST
          Length = 152

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P ARIK++MKLD EV ++SAEA  L  KAAE+F+  L      HT
Sbjct: 76  PFARIKQMMKLDPEVGIVSAEAIFLVTKAAELFLQTLAKDTSFHT 120


>UniRef50_Q558T1 Cluster: Putative histone-like transcription
           factor; n=2; Dictyostelium discoideum|Rep: Putative
           histone-like transcription factor - Dictyostelium
           discoideum AX4
          Length = 158

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 37/50 (74%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LP+ARIK+IM+ D++VK+IS++A +L AK+ E+F+  L   A+  + + K
Sbjct: 79  LPVARIKRIMRCDKDVKIISSDAVMLVAKSTEMFLDYLVKEAYKSSGKKK 128


>UniRef50_Q14919 Cluster: Dr1-associated corepressor; n=20;
           Euteleostomi|Rep: Dr1-associated corepressor - Homo
           sapiens (Human)
          Length = 205

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 23/64 (35%), Positives = 38/64 (59%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIKKIM+ DEE+  ++A  PV+ ++A E+F+  L  +A   T+       + +  +Q
Sbjct: 13  PPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQ 72

Query: 550 YIEI 561
            IE+
Sbjct: 73  CIEL 76


>UniRef50_UPI0000583E0D Cluster: PREDICTED: similar to Dr1
           associated protein 1 (negative cofactor 2 alpha); n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Dr1 associated protein 1 (negative cofactor 2 alpha) -
           Strongylocentrotus purpuratus
          Length = 252

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/45 (51%), Positives = 30/45 (66%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P ARIKKIM+ DE+V  ++A  PVL +KA EIF+  L  +A   T
Sbjct: 13  PPARIKKIMQKDEDVGKVAAPVPVLISKALEIFVEGLITKASQET 57


>UniRef50_UPI0000499C7F Cluster: histone-like transcription factor;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: histone-like
           transcription factor - Entamoeba histolytica HM-1:IMSS
          Length = 212

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/63 (34%), Positives = 38/63 (60%)
 Frame = +1

Query: 304 FWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           FW+K+  + +  N   FK +  P ARI+K+ K++ + K +  E   + ++A E+FI +LT
Sbjct: 116 FWEKMSVESENYN---FKEKPFPPARIRKLTKINIDNKQLKTETVEILSRACELFIKDLT 172

Query: 484 LRA 492
            RA
Sbjct: 173 TRA 175


>UniRef50_A0NGB6 Cluster: ENSANGP00000029798; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000029798 - Anopheles gambiae
           str. PEST
          Length = 163

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/38 (60%), Positives = 26/38 (68%)
 Frame = +1

Query: 394 MKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           MK+DEEV  I+     L AKA+EIFI ELTL AW  TE
Sbjct: 1   MKIDEEVPNIAYNVSSLLAKASEIFIQELTLCAWLQTE 38


>UniRef50_A7QMG3 Cluster: Chromosome undetermined scaffold_125,
           whole genome shotgun sequence; n=3; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_125, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 326

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/45 (48%), Positives = 30/45 (66%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P ARIKKIM+ DE+V  I+   PVL +KA E+F+ +L  R +  T
Sbjct: 10  PAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYDIT 54


>UniRef50_Q9LHG0 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 3, P1 clone: MQC3; n=6; Magnoliophyta|Rep:
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MQC3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 293

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           P ARIKKIM+ DE+V  I+   PVL +K+ E+F+ +L  R +  T E
Sbjct: 10  PAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLE 56


>UniRef50_Q5CQK9 Cluster: CCAAT-binding factor chain HAP5 like
           histone; n=2; Cryptosporidium|Rep: CCAAT-binding factor
           chain HAP5 like histone - Cryptosporidium parvum Iowa II
          Length = 342

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 3/67 (4%)
 Frame = +1

Query: 325 DIQKVNSEDFKT--QALPLARIKKIMKLDEEVK-MISAEAPVLFAKAAEIFIHELTLRAW 495
           +I   + ++ KT  + LP  +IKKI+K    V  MI +E P L A A E+F+ +LT  +W
Sbjct: 137 NIPVFSKDELKTLSRCLPHTKIKKIIKCSGAVNHMIGSEVPALLAIACELFVRDLTSFSW 196

Query: 496 SHTEEIK 516
           + T   K
Sbjct: 197 NFTRRAK 203


>UniRef50_Q8W0W7 Cluster: Repressor protein; n=5; Poaceae|Rep:
           Repressor protein - Oryza sativa (Rice)
          Length = 258

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 21/45 (46%), Positives = 30/45 (66%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P ARIKKIM+ DE+V  I+   PVL ++A E+F+ +L  R +  T
Sbjct: 10  PAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDRTYEIT 54


>UniRef50_Q8SQT6 Cluster: CLASS 2 TRANSCRIPTIONAL REPRESSOR similar
           NCB1_yeast; n=1; Encephalitozoon cuniculi|Rep: CLASS 2
           TRANSCRIPTIONAL REPRESSOR similar NCB1_yeast -
           Encephalitozoon cuniculi
          Length = 95

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 19/49 (38%), Positives = 33/49 (67%)
 Frame = +1

Query: 334 KVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           K  S+  K    P++R+K+IM+L+E++  I A  PV+ +KA E+F+ E+
Sbjct: 3   KQESQKKKLTRFPISRLKRIMQLNEDIGKIGASVPVVASKAIEMFLTEI 51


>UniRef50_Q7RW27 Cluster: Putative uncharacterized protein
           NCU06405.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU06405.1 - Neurospora crassa
          Length = 332

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIK+IM+ DEEV  ++ + P+   KA E+F+ +L  ++     E      SA   +Q
Sbjct: 204 PTARIKRIMQADEEVGKVAQQTPIAVGKALELFMVQLVTKSADIARERNSKRVSAQMLKQ 263

Query: 550 YIE 558
            +E
Sbjct: 264 VVE 266


>UniRef50_UPI00004987F6 Cluster: histone-like transcription factor;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: histone-like
           transcription factor - Entamoeba histolytica HM-1:IMSS
          Length = 119

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 20/50 (40%), Positives = 33/50 (66%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LP AR+K+IM+ DE+V  +S   P++ A+A E+F+ +L  +  +  EE K
Sbjct: 9   LPAARVKRIMQEDEDVGKMSGNVPMVIARATELFLVDLIKKTNTVAEEKK 58


>UniRef50_Q9NRG0 Cluster: Chromatin accessibility complex protein 1;
           n=10; Euteleostomi|Rep: Chromatin accessibility complex
           protein 1 - Homo sapiens (Human)
          Length = 131

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           +LPL+RI+ IMK   EV  I+ EA VL AKA E+F+  L   ++ H
Sbjct: 18  SLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRH 63


>UniRef50_UPI0000D573E2 Cluster: PREDICTED: similar to CG11301-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11301-PA - Tribolium castaneum
          Length = 117

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 319 LEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           L ++   + E  K   LPLARIK IMK+D +  ++S +A  L  K+ E+F+  L
Sbjct: 25  LVELTTTSPEKPKLVKLPLARIKHIMKMDPDCNLVSQDALFLVTKSTEMFLEHL 78


>UniRef50_Q10315 Cluster: DNA polymerase epsilon subunit C; n=1;
           Schizosaccharomyces pombe|Rep: DNA polymerase epsilon
           subunit C - Schizosaccharomyces pombe (Fission yeast)
          Length = 199

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +1

Query: 334 KVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           K N   +     P+ARIKKIM+ D++V  ++   PV+ +KA E+F+  +   +   T
Sbjct: 13  KPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQT 69


>UniRef50_UPI00015B431F Cluster: PREDICTED: similar to NC2alpha;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           NC2alpha - Nasonia vitripennis
          Length = 226

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504
           P  RIKKIM+ DEEV  ++   P++ ++  E+F+H L  +    T
Sbjct: 13  PPGRIKKIMQTDEEVGKVAQAVPIIISRTLELFVHSLLTKTMQIT 57


>UniRef50_UPI000023F56A Cluster: hypothetical protein FG05498.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05498.1 - Gibberella zeae PH-1
          Length = 330

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 20/63 (31%), Positives = 37/63 (58%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIK+IM+ DEEV  ++ + P+   KA E+F+ +L  ++    ++      +A+  +Q
Sbjct: 216 PTARIKRIMQADEEVGKVAQQTPIAVGKALELFMIQLVTKSADVAKDKGSKRVTASMLKQ 275

Query: 550 YIE 558
            +E
Sbjct: 276 VVE 278


>UniRef50_Q012F7 Cluster: Drap1 protein; n=2; Ostreococcus|Rep:
           Drap1 protein - Ostreococcus tauri
          Length = 273

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 17/36 (47%), Positives = 28/36 (77%)
 Frame = +1

Query: 376 ARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           +RIK++M+ D+EV  I+  AP++ AKA E+F+ +LT
Sbjct: 10  SRIKRLMQKDDEVGKIAGAAPIVLAKALELFVKQLT 45


>UniRef50_Q00W27 Cluster: DNA polymerase epsilon, subunit C; n=3;
           Ostreococcus|Rep: DNA polymerase epsilon, subunit C -
           Ostreococcus tauri
          Length = 569

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           LP+AR+++I+KLD++VK  SAEA     KA E+F+  L
Sbjct: 412 LPVARVRRIIKLDKDVKQASAEAIKCVTKAVELFMEGL 449


>UniRef50_Q1E9R3 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 225

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 21/45 (46%), Positives = 29/45 (64%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWS 498
           ALPL RIKKI+ LDE++   S  A  L A A E+FI  L  ++++
Sbjct: 19  ALPLTRIKKIIHLDEDIAQCSNNAAFLIAVATEMFIRYLAEQSYN 63


>UniRef50_UPI0000D5778C Cluster: PREDICTED: similar to CG10318-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG10318-PA, isoform A - Tribolium castaneum
          Length = 241

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           P  RIKKIM+ DEEV  ++   PV+ ++  E+F+  L  ++   T+
Sbjct: 13  PAGRIKKIMQTDEEVGKVAQAVPVIISRTLELFVESLLTKSMQITQ 58


>UniRef50_Q503Q5 Cluster: Zgc:110337; n=3; Danio rerio|Rep:
           Zgc:110337 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 179

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 19/58 (32%), Positives = 34/58 (58%)
 Frame = +1

Query: 343 SEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           ++  +   LPL+RIK +MK D +V + S E+  + AKA E+F+  +   A  + ++ K
Sbjct: 43  AQQHRLARLPLSRIKTLMKADPDVTLASQESVFIIAKATELFVEMIAKDALVYAQQGK 100


>UniRef50_Q9FHS0 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MNL12; n=1; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MNL12 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 130

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           P+ R+KKIMKLD+++  I++EA  +   + E+F+H L  ++   T E K
Sbjct: 13  PIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKK 61


>UniRef50_Q2H8U2 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 185

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/52 (36%), Positives = 32/52 (61%)
 Frame = +1

Query: 337 VNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           + +   KT+  P ARIK+IM+ DEEV  ++ + P+   KA E+F+  L  ++
Sbjct: 55  IEAATVKTK-FPTARIKRIMQADEEVGKVAQQTPIAVGKALELFMMALVTKS 105


>UniRef50_A5E3I3 Cluster: DNA polymerase epsilon subunit C; n=6;
           Saccharomycetales|Rep: DNA polymerase epsilon subunit C
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 251

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +1

Query: 346 EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           E  KT   P ARIKKIM+ DEE+  ++   PV+  +A EIF+  L
Sbjct: 162 ERIKTH-FPAARIKKIMQSDEEIGKVAQATPVVVGRALEIFMANL 205


>UniRef50_Q4P042 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 250

 Score = 40.3 bits (90), Expect = 0.065
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 358 TQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTE 507
           T   P AR+ +I+K D +V + S EA  L + A EIF+  LT  A+++ +
Sbjct: 28  TSIFPTARVARIIKADRDVDICSKEATFLISVATEIFLKRLTDEAYTNAK 77


>UniRef50_A7TQM7 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 240

 Score = 40.3 bits (90), Expect = 0.065
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +1

Query: 310 DKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           +K +ED++       K+  LPL+++KKI K D E  + S  A V  + A EIFI  LT
Sbjct: 14  EKSIEDLKVQEEIKLKSPHLPLSKVKKIAKCDPEHVITSNAAFVATSFATEIFIKNLT 71


>UniRef50_A2QBU3 Cluster: Function: negative co-factor 2; n=2;
           Eurotiomycetidae|Rep: Function: negative co-factor 2 -
           Aspergillus niger
          Length = 295

 Score = 40.3 bits (90), Expect = 0.065
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +1

Query: 349 DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           + KT+  P+ARIK+IM+ DE+V  ++   P+  +KA E+F+  L  +A
Sbjct: 177 EVKTK-FPVARIKRIMQADEDVGKVAQVTPIAVSKALELFMISLVTKA 223


>UniRef50_Q5KDK2 Cluster: DNA polymerase epsilon p12 subunit (Dna
           polymerase epsilon subunit 4), putative; n=2;
           Filobasidiella neoformans|Rep: DNA polymerase epsilon
           p12 subunit (Dna polymerase epsilon subunit 4), putative
           - Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 317

 Score = 39.9 bits (89), Expect = 0.086
 Identities = 18/53 (33%), Positives = 33/53 (62%)
 Frame = +1

Query: 313 KVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           ++++  Q +  +   T   P AR+KKI+K D ++ ++S+EA  + + AAE FI
Sbjct: 88  RIIKQRQSLAEKQPGTTMFPAARVKKIVKADRDIDIMSSEAVFMVSVAAEYFI 140


>UniRef50_Q9NR33 Cluster: DNA polymerase epsilon subunit 4; n=24;
           Euteleostomi|Rep: DNA polymerase epsilon subunit 4 -
           Homo sapiens (Human)
          Length = 117

 Score = 39.9 bits (89), Expect = 0.086
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LPLAR+K ++K D +V +   EA  + A+AAE+F+  +   A+   ++ K
Sbjct: 41  LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGK 90


>UniRef50_UPI0000DB73CD Cluster: PREDICTED: similar to Chrac-16
           CG15736-PA; n=2; Apocrita|Rep: PREDICTED: similar to
           Chrac-16 CG15736-PA - Apis mellifera
          Length = 176

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 23/55 (41%), Positives = 29/55 (52%)
 Frame = +1

Query: 355 KTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKG 519
           K   LP++R+K IMK    V  I  +   L  KA E+FIH LT  A  H +  KG
Sbjct: 11  KELRLPISRVKTIMKSSPYVDTIGQDGLYLVTKATELFIHYLTEEA--HLQSNKG 63


>UniRef50_Q07G02 Cluster: Chromatin accessibility complex 1; n=3;
           Tetrapoda|Rep: Chromatin accessibility complex 1 -
           Xenopus tropicalis (Western clawed frog) (Silurana
           tropicalis)
          Length = 147

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/46 (39%), Positives = 30/46 (65%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           +LPL+RI+ IMK   +V  I+ +A ++ AKA E+F+  L   ++ H
Sbjct: 10  SLPLSRIRLIMKSSPDVSNINQDALMVTAKATELFVQFLATHSYKH 55


>UniRef50_Q9GSP1 Cluster: NC2alpha; n=4; Sophophora|Rep: NC2alpha -
           Drosophila melanogaster (Fruit fly)
          Length = 341

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P  RIKKIM+ DEE+  ++   PV+ ++  E+F+  L  +    T        S +  RQ
Sbjct: 13  PAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHMRQ 72

Query: 550 YIEIGSVRF 576
            I +   RF
Sbjct: 73  CI-VSEKRF 80


>UniRef50_A7RQA2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 253

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +1

Query: 346 EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           E  K   LPL++IK IMK   ++  IS E+  L A++ E+F++ L + A    E  K
Sbjct: 9   ESGKLTQLPLSKIKTIMKSSPDLANISQESLFLIARSTEVFVNYLAVAALKKEESKK 65


>UniRef50_A4R921 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 281

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIK+IM+ DEEV  ++ + P+   KA E+F+  L  ++    ++      +A   +Q
Sbjct: 164 PTARIKRIMQADEEVGKVAQQTPIAVGKALEMFMVALVSKSHDVAKDKGAKRVTAQHLKQ 223

Query: 550 YIE 558
            IE
Sbjct: 224 VIE 226


>UniRef50_UPI0000D56C5F Cluster: PREDICTED: similar to CG15736-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG15736-PA - Tribolium castaneum
          Length = 122

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 19/39 (48%), Positives = 25/39 (64%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           ALP+ RI  IMK   E + IS E+ ++  KAAE+FI  L
Sbjct: 8   ALPIVRINTIMKSSSEAENISRESSLMMTKAAELFIKML 46


>UniRef50_Q7QXC2 Cluster: GLP_741_38544_38200; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_741_38544_38200 - Giardia lamblia
           ATCC 50803
          Length = 114

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 15/43 (34%), Positives = 32/43 (74%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAW 495
           LP++R++ I +    + ++SAEAP+L ++ AE+FI ++T +++
Sbjct: 24  LPISRVRAICRTVPTITLLSAEAPLLISRLAELFIADVTNQSY 66


>UniRef50_UPI000150A242 Cluster: hypothetical protein
           TTHERM_00446570; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00446570 - Tetrahymena
           thermophila SB210
          Length = 255

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           A P++RIK I+K+DE+ K++S +  + F KA E+F
Sbjct: 97  AFPISRIKGILKVDEDNKLLSKDTLLYFEKATELF 131


>UniRef50_A7QP68 Cluster: Chromosome chr1 scaffold_136, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_136, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 140

 Score = 37.9 bits (84), Expect = 0.35
 Identities = 15/38 (39%), Positives = 27/38 (71%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           LPL R+KK++KLD ++  +++EA  L + + E+F+  L
Sbjct: 14  LPLGRVKKLVKLDRDINKVNSEALFLISCSTELFLRFL 51


>UniRef50_Q6C6M5 Cluster: DNA polymerase epsilon subunit C; n=2;
           Ascomycota|Rep: DNA polymerase epsilon subunit C -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 114

 Score = 37.5 bits (83), Expect = 0.46
 Identities = 17/44 (38%), Positives = 29/44 (65%)
 Frame = +1

Query: 349 DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           + KT+  P+ARIKK+M+ D+++  ++   P   AKA E+F+  L
Sbjct: 7   EIKTR-FPVARIKKLMQSDDDIGKVAQATPTAVAKALELFMISL 49


>UniRef50_UPI0000E21CC6 Cluster: PREDICTED: similar to CHRAC15; n=3;
           Homo/Pan/Gorilla group|Rep: PREDICTED: similar to
           CHRAC15 - Pan troglodytes
          Length = 352

 Score = 37.1 bits (82), Expect = 0.61
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 355 KTQALPLA-RIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           + Q+LP + RI+ IMK    V  I+ EA VL AKA E+F+  L   ++ H
Sbjct: 236 RDQSLPASIRIRVIMKSSPHVSSINQEALVLTAKATELFVQCLATYSYRH 285


>UniRef50_A3LRE3 Cluster: DNA-directed DNA polymerase epsilon,
           subunit C; n=1; Pichia stipitis|Rep: DNA-directed DNA
           polymerase epsilon, subunit C - Pichia stipitis (Yeast)
          Length = 284

 Score = 37.1 bits (82), Expect = 0.61
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +1

Query: 322 EDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           E+  ++ +ED +   LP+A+IK+I KLD +    S  A      A E+FI   T +A
Sbjct: 80  ENDLEIETEDEQLLTLPIAKIKRIFKLDPDYVSASQSAVYATGLATELFIQYFTEQA 136


>UniRef50_A7ETC1 Cluster: Predicted protein; n=2;
           Sclerotiniaceae|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 287

 Score = 36.3 bits (80), Expect = 1.1
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = +1

Query: 358 TQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           T  LPL+RIKKI+  D+++ M S  A  +   A E+FI
Sbjct: 25  TTQLPLSRIKKIIGTDQDINMCSNNAAFVITLATEMFI 62


>UniRef50_UPI000023D814 Cluster: hypothetical protein FG05304.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05304.1 - Gibberella zeae PH-1
          Length = 182

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHEL 480
           LPL+R+KKI+  D E+ + S  A  +   AAE+F+  L
Sbjct: 20  LPLSRVKKIIAQDPEIALCSNNAAFVITLAAEMFVQHL 57


>UniRef50_A7S160 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 111

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = +1

Query: 322 EDIQKVNSEDFKTQAL---PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           E++     E+ K   +   P  R++ +MKLD ++++ + EA  L  +AAE+F+      +
Sbjct: 17  EELHPATQEEEKPSRMTQFPQTRVRNMMKLDPDLQLANKEAVFLVTRAAELFVEYFAKAS 76

Query: 493 WSHT 504
           +  T
Sbjct: 77  YKKT 80


>UniRef50_Q6CTK6 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=2; Saccharomycetaceae|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome C of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 150

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           P A+IKKIM+ DE++  +S   PV+  ++ E FI
Sbjct: 71  PPAKIKKIMQTDEDIGKVSQATPVITGRSLEFFI 104


>UniRef50_Q6BX14 Cluster: DNA polymerase epsilon subunit C; n=1;
           Debaryomyces hansenii|Rep: DNA polymerase epsilon
           subunit C - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 277

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 310 DKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
           D   E+ ++   E+ ++ +LPL++IKKI K+D +    S  A      A E+FI   T
Sbjct: 73  DDEQEEEEEEEEEEEESLSLPLSKIKKIFKMDPDYLAASQSAVYATGLATELFIQYFT 130


>UniRef50_Q171Z8 Cluster: Histone-fold protein CHRAC subunit,
           putative; n=2; Culicidae|Rep: Histone-fold protein CHRAC
           subunit, putative - Aedes aegypti (Yellowfever mosquito)
          Length = 193

 Score = 35.5 bits (78), Expect = 1.9
 Identities = 16/47 (34%), Positives = 30/47 (63%)
 Frame = +1

Query: 355 KTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAW 495
           K++ LP++RI+ +MK    +  I+ +A  L  +AAE+FI  ++  A+
Sbjct: 5   KSKHLPMSRIRTVMKTSPSIGHINQDALFLVCRAAEMFIQFISKNAY 51


>UniRef50_P40096 Cluster: Negative cofactor 2 complex subunit alpha;
           n=4; Saccharomycetales|Rep: Negative cofactor 2 complex
           subunit alpha - Saccharomyces cerevisiae (Baker's yeast)
          Length = 142

 Score = 35.5 bits (78), Expect = 1.9
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           P A++KKIM+ DE++  +S   PV+  ++ E FI
Sbjct: 54  PPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFI 87


>UniRef50_UPI0000498E96 Cluster: hypothetical protein 129.t00029;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 129.t00029 - Entamoeba histolytica HM-1:IMSS
          Length = 450

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = -2

Query: 245 HFFGRGNRRCLFGRHKE-AHGHFVVFSTNFTRQTHRCFYSIITQN*YLNYVLVNYSKFRK 69
           H F + +   L    K  AH +F+  S    R+TH    +I + N Y+N VL+N SK  +
Sbjct: 253 HGFSQDDYNLLIEMRKNVAHINFISVSPPHCRKTHSQTAAIFSLNDYINDVLINNSKIDR 312

Query: 68  QY 63
            Y
Sbjct: 313 TY 314


>UniRef50_Q7S9P3 Cluster: Putative uncharacterized protein
           NCU06623.1; n=2; Sordariales|Rep: Putative
           uncharacterized protein NCU06623.1 - Neurospora crassa
          Length = 304

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           LPL R+KKI+ +D ++ + S  A  +   A E+FI  L   A
Sbjct: 20  LPLTRVKKIIAVDPDITVCSNNAAFVITLATEMFIQHLASEA 61


>UniRef50_UPI000150A306 Cluster: hypothetical protein
           TTHERM_00474790; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00474790 - Tetrahymena
           thermophila SB210
          Length = 163

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 18/101 (17%), Positives = 45/101 (44%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P+ARIKKI++ ++++  I    P + +++ E+F+ ++  +     ++           ++
Sbjct: 11  PIARIKKIVQENQDIGKICKTIPYILSRSLELFLEDILQQTVQVCKDYDLNKVQPPALKK 70

Query: 550 YIEIGSVRFPDRHSAAA*SQADETALRRRXESPQHGSVLPP 672
            IE+    F ++         +   L+R+    +    L P
Sbjct: 71  AIELSKYNFIEKSLEGVEDLENSKLLKRKKSQSKEQDPLEP 111


>UniRef50_Q9V452 Cluster: CG15736-PA; n=2; Sophophora|Rep:
           CG15736-PA - Drosophila melanogaster (Fruit fly)
          Length = 140

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           LPL+R++ IMK   +  +I+ E   L  K  E+F+  L   A  +TEE
Sbjct: 20  LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAA--YTEE 65


>UniRef50_A6SQ32 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 681

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +3

Query: 609 SRRNRVTTPPXKPPARISTTSSWRXAFRRPYRTVRS 716
           S++ RV T P K P    T+ SW   FRR  R  R+
Sbjct: 328 SKKQRVETEPAKQPVEAKTSQSWTSFFRRNKRLSRT 363


>UniRef50_A5UVR3 Cluster: tRNA/rRNA methyltransferase; n=2;
           Roseiflexus|Rep: tRNA/rRNA methyltransferase -
           Roseiflexus sp. RS-1
          Length = 432

 Score = 33.1 bits (72), Expect = 9.9
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +3

Query: 240 EVDADLPVRSPPLRRRTNPPAVLGQSLRGHTES*FRRLQDPSFAVG 377
           ++D D   R PPL R   PPA +G++L    +    RL+D   A G
Sbjct: 141 DIDDDTLFRGPPLARAALPPAPVGRTLSSAKDLIVARLRDLGNAAG 186


>UniRef50_Q4PG57 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 133

 Score = 33.1 bits (72), Expect = 9.9
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFA 450
           P+ARIKKIM+ DE+V  ++   PVL +
Sbjct: 11  PVARIKKIMQADEDVGKVAQATPVLIS 37


>UniRef50_A5DBV9 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 273

 Score = 33.1 bits (72), Expect = 9.9
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +1

Query: 313 KVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRA 492
           + +E+ +  +SE   T +LP+++IKKI K+D +    S+ A      A E+F+  L  +A
Sbjct: 109 EAMEEDEPEDSES--TLSLPISKIKKIFKMDPDYVSASSGALYATGLATELFVQYLVEQA 166


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 771,430,493
Number of Sequences: 1657284
Number of extensions: 14006989
Number of successful extensions: 37345
Number of sequences better than 10.0: 103
Number of HSP's better than 10.0 without gapping: 35753
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37312
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 81161904978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -