SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P55072 Cluster: Transitional endoplasmic reticulum ATPa...   161   3e-38
UniRef50_UPI0000E4A84B Cluster: PREDICTED: similar to valosin; n...   116   1e-24
UniRef50_A4ICJ9 Cluster: Transitional endoplasmic reticulum ATPa...   110   4e-23
UniRef50_Q4Y788 Cluster: Cell division cycle protein 48 homologu...    95   2e-18
UniRef50_Q7QWL6 Cluster: GLP_762_31096_33708; n=1; Giardia lambl...    69   2e-10
UniRef50_A0EEE7 Cluster: Chromosome undetermined scaffold_91, wh...    60   1e-07
UniRef50_A5KAB5 Cluster: Cell division cycle ATPase, putative; n...    45   0.002
UniRef50_Q4MZM6 Cluster: Cell division cycle protein 48, putativ...    44   0.007
UniRef50_A7AVE1 Cluster: Cell division cycle protein ATPase, put...    42   0.016
UniRef50_Q4YQQ6 Cluster: Cell division cycle ATPase, putative; n...    41   0.037
UniRef50_A2FTG5 Cluster: ATPase, AAA family protein; n=1; Tricho...    40   0.11 
UniRef50_Q1GSQ3 Cluster: AAA family ATPase, CDC48 subfamily; n=1...    39   0.15 
UniRef50_Q58556 Cluster: Cell division cycle protein 48 homolog ...    38   0.45 
UniRef50_Q4UBT9 Cluster: Cell divison cycle CDC48 homologue, put...    36   1.4  
UniRef50_Q6CL50 Cluster: Similarities with sp|Q9Y909 Aeropyrum p...    36   1.4  
UniRef50_Q8TY20 Cluster: ATPase of the AAA+ class; n=1; Methanop...    36   1.8  
UniRef50_Q59WG1 Cluster: Putative uncharacterized protein; n=1; ...    35   2.4  
UniRef50_Q74M89 Cluster: NEQ475; n=1; Nanoarchaeum equitans|Rep:...    35   3.2  
UniRef50_Q1JSD1 Cluster: Transitional endoplasmic reticulum ATPa...    34   5.6  
UniRef50_Q0W6B6 Cluster: Putative cell division cycle protein 48...    34   5.6  
UniRef50_A1HPK1 Cluster: AAA family ATPase, CDC48 subfamily; n=1...    33   9.7  

>UniRef50_P55072 Cluster: Transitional endoplasmic reticulum ATPase
           (TER ATPase) (15S Mg(2+)- ATPase p97 subunit); n=169;
           Eukaryota|Rep: Transitional endoplasmic reticulum ATPase
           (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) - Homo
           sapiens (Human)
          Length = 806

 Score =  161 bits (390), Expect = 3e-38
 Identities = 99/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +     +   +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--I 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  138 bits (333), Expect = 2e-31
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 3e-20
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>UniRef50_UPI0000E4A84B Cluster: PREDICTED: similar to valosin; n=3;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           valosin - Strongylocentrotus purpuratus
          Length = 596

 Score =  116 bits (278), Expect = 1e-24
 Identities = 57/87 (65%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +3

Query: 507 QVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQ 686
           Q+RGGMRAVEFKVVETDP P+CIV+PDTVIH +G+ IKRE+EEE LN +GYDDIGGCRKQ
Sbjct: 123 QIRGGMRAVEFKVVETDPGPYCIVSPDTVIHFEGDAIKREDEEENLNEIGYDDIGGCRKQ 182

Query: 687 LGAN*GDGGVATAVILH--CFKAIGVK 761
           L +      +    + H   FKAIGVK
Sbjct: 183 LAS---IKEMVELPLRHPALFKAIGVK 206



 Score =  102 bits (245), Expect = 1e-20
 Identities = 48/66 (72%), Positives = 62/66 (93%)
 Frame = +2

Query: 59  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           MA+N S DD++TAILR K +PNRL+VEEA++DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MAEN-SGDDIATAILRTKAKPNRLVVEEAINDDNSVVSLSQAKMDELQLFRGDTVMLKGK 59

Query: 239 RRKETV 256
           +R++TV
Sbjct: 60  KRRDTV 65



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query: 436 NLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWLLIP*YTVTVNR 615
           NLF+VYL+PYF EAYRP+ + D F+  G       K  +     +   ++ P   +    
Sbjct: 99  NLFDVYLRPYFQEAYRPVRKGDIFQIRGGMRAVEFKVVETDPGPYC--IVSPDTVIHFEG 156

Query: 616 LNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLR 726
             ++++ +   L+ +    +       A IKEMVELPLR
Sbjct: 157 DAIKREDEEENLNEIGYDDIGGCRKQLASIKEMVELPLR 195


>UniRef50_A4ICJ9 Cluster: Transitional endoplasmic reticulum ATPase,
           putative; n=2; Leishmania|Rep: Transitional endoplasmic
           reticulum ATPase, putative - Leishmania infantum
          Length = 690

 Score =  110 bits (265), Expect = 4e-23
 Identities = 48/100 (48%), Positives = 63/100 (63%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CI + DD CP EKI+M             D + I PC  V YG RVH+L
Sbjct: 49  LVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIVPCKDVPYGNRVHLL 108

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGA 522
           PIDD+VE LTG+LFE +LKPYF+E+YRP+ + D+F   GA
Sbjct: 109 PIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGA 148



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 36/52 (69%), Positives = 44/52 (84%)
 Frame = +3

Query: 513 RGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDI 668
           RG MR+VEFKVVE DP  +CIV+PDT+IH +G+PI R E+EEAL+ VGYDDI
Sbjct: 146 RGAMRSVEFKVVEVDPGDYCIVSPDTIIHSEGDPIHR-EDEEALDGVGYDDI 196



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/49 (59%), Positives = 40/49 (81%)
 Frame = +2

Query: 110 KDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETV 256
           K + N+LIVEE  +DDNSVV+L+  +ME+L +FRGDTVL+KGK+ + TV
Sbjct: 11  KVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTV 59


>UniRef50_Q4Y788 Cluster: Cell division cycle protein 48 homologue,
           putative; n=4; Plasmodium|Rep: Cell division cycle
           protein 48 homologue, putative - Plasmodium chabaudi
          Length = 250

 Score = 95.5 bits (227), Expect = 2e-18
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 3/189 (1%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+      CI+L+D++  + KIR+             D+V +  CP + YGK++ +L
Sbjct: 59  LIKGKKRHSTICIILNDNDLDEGKIRINKVARKNLRVCLGDIVYVKACPEIPYGKKIQVL 118

Query: 403 PIDDSVEGLT-GNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASW 579
           PIDD++EGL    LFE++LKPYF E+YRP+ + D F   G      S   K +      +
Sbjct: 119 PIDDTIEGLAKDTLFEIFLKPYFNESYRPVKKGDLFLVRGG---FMSVEFKVVEVDPDDF 175

Query: 580 LLIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLL 753
            ++   TV     +  K+     L  +    +       AQI+EM+ELPLR    + + L
Sbjct: 176 CIVSPDTVIYYEGDPIKRDDEEKLDEIGYDDIGGCKKQLAQIREMIELPLRHP-GLFKTL 234

Query: 754 E*KLPRGIL 780
             K PRG+L
Sbjct: 235 GVKPPRGVL 243



 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 41/60 (68%), Positives = 52/60 (86%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGG  +VEFKVVE DP  FCIV+PDTVI+ +G+PIKR++EE+ L+ +GYDDIGGC+KQL
Sbjct: 156 VRGGFMSVEFKVVEVDPDDFCIVSPDTVIYYEGDPIKRDDEEK-LDEIGYDDIGGCKKQL 214



 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 34/64 (53%), Positives = 45/64 (70%)
 Frame = +2

Query: 65  DNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRR 244
           D K+  D +   L +K    RLIVEEA +DDNSVVAL+  +ME+L  FRGDT+L+KGK+R
Sbjct: 6   DTKTLGDDNNGKLPKKKNLCRLIVEEATNDDNSVVALNTKRMEELNFFRGDTILIKGKKR 65

Query: 245 KETV 256
             T+
Sbjct: 66  HSTI 69


>UniRef50_Q7QWL6 Cluster: GLP_762_31096_33708; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_762_31096_33708 - Giardia lamblia
           ATCC 50803
          Length = 870

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 48/115 (41%), Positives = 59/115 (51%), Gaps = 1/115 (0%)
 Frame = +3

Query: 525 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLGAN*G 704
           R +EFKVV TDPSP CIV     I  +GEPI R+E E     VGY D+GG  K+LG    
Sbjct: 174 REIEFKVVLTDPSPACIVMDGGEIFYEGEPIDRDEHERENTKVGYSDLGGLGKELGMI-R 232

Query: 705 DGGVATAVILHCFKAIGVKASTRHSPCMGPPXNRKKHSLARAVAN-GNRGFFLFN 866
           +           FK +GVK   R     GPP    K ++ +A+AN     FFL N
Sbjct: 233 EQIELPLRHPELFKYLGVK-PPRGILLTGPP-GCGKTTIGKAIANEAGAYFFLLN 285



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 50/209 (23%), Positives = 89/209 (42%), Gaps = 27/209 (12%)
 Frame = +1

Query: 343 DVVSIAPCPSVKYGKRVHILPIDDSVEGL-----------------------TGNLFEVY 453
           D+V + P  ++ Y KR+ ++P +  +EGL                       T +LF++ 
Sbjct: 86  DIVILYPAQNLPYHKRIKVIPFEQDLEGLNIAGYTVKQGEDGKPAPAPFPGPTYDLFDIC 145

Query: 454 LKPYFMEAYRPIHRDDTFRSAGACAPSSSK--WSKQIHHHFASWLLIP*YTVTVNRLNVR 627
           + PYF +  RP+   +TF+      P + +  +   +     + +++    +      + 
Sbjct: 146 IAPYFKDKCRPVTEGNTFKVMTTSLPVNREIEFKVVLTDPSPACIVMDGGEIFYEGEPID 205

Query: 628 KKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLV 801
           +       + +  S +  +      I+E +ELPLR    + + L  K PRGIL + G   
Sbjct: 206 RDEHERENTKVGYSDLGGLGKELGMIREQIELPLRHP-ELFKYLGVKPPRGIL-LTGPPG 263

Query: 802 TGKNTHWLVLLLMETGASSFLINGPGIMS 888
            GK T    +   E GA  FL+NG  IMS
Sbjct: 264 CGKTTIGKAIA-NEAGAYFFLLNGAEIMS 291



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +2

Query: 122 NRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVA 259
           NR IV +    D+S + LS  K+  L LF+GD V LKG+  K T A
Sbjct: 12  NRFIVNDNPGGDDSQIILSSEKVNVLDLFQGDYVRLKGRFGKTTHA 57


>UniRef50_A0EEE7 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 772

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 28/46 (60%), Positives = 37/46 (80%)
 Frame = +2

Query: 122 NRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVA 259
           NRL+V E+ +DDNSVV L Q K+ +L+LF+GD VLL+GK  K+TVA
Sbjct: 17  NRLMVCESTADDNSVVQLCQDKLNELKLFKGDMVLLEGKNNKKTVA 62



 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 59/225 (26%), Positives = 98/225 (43%), Gaps = 3/225 (1%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +    I +S+     E + M             D ++I P  S+    +VHIL
Sbjct: 51  LLEGKNNKKTVAIAISNRQ-DKESVHMNSVIRKNLGIQIGDFITIQPTASLPQLTKVHIL 109

Query: 403 PIDDSVEGLTG-NLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASW 579
           P  DS+ G    NL + YL PYF++AYRP+ + D F    A        + +        
Sbjct: 110 PFQDSISGTNEKNLTQNYLIPYFLDAYRPVSKGDCFVVKMAKEIEFKIIATEPEDMGVVG 169

Query: 580 LLIP*YTV--TVNRLNVRKKRKH*MLSAMMTSAVVANNWAQIKEMVELPLRSSFTVSRLL 753
            +   YT   TV R  +  K +    +       +      IK +VEL LR+  ++ +  
Sbjct: 170 PITILYTEGGTVKR-EIENKEQFDNQNGYANIGGMNKQLTIIKTIVELQLRNP-SILKAS 227

Query: 754 E*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
             +   G+L + G   +GK T  +  L +ETGA+ + +NG  ++S
Sbjct: 228 GLQTINGLL-ISGASGSGK-TLIVKALAIETGANIYFLNGSELVS 270



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +3

Query: 525 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEE--EEALNAVGYDDIGGCRKQL 689
           + +EFK++ T+P    +V P T+++ +G  +KRE E  E+  N  GY +IGG  KQL
Sbjct: 151 KEIEFKIIATEPEDMGVVGPITILYTEGGTVKREIENKEQFDNQNGYANIGGMNKQL 207


>UniRef50_A5KAB5 Cluster: Cell division cycle ATPase, putative; n=1;
           Plasmodium vivax|Rep: Cell division cycle ATPase,
           putative - Plasmodium vivax
          Length = 1089

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = +2

Query: 119 PNRLIVEEAVSD-DNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVA 259
           P+  +VE      DN  + LS+AKME+L L  G TVLLKGK++KE +A
Sbjct: 270 PSYCLVENVDEQIDNCEIYLSKAKMEELNLSEGFTVLLKGKKKKEMLA 317



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 576 VAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           V  + +I  D E + RE+ EE  + + Y+D+GG +KQL
Sbjct: 448 VGDNAIITLDEEYLNREDYEEHTDDITYEDLGGMKKQL 485


>UniRef50_Q4MZM6 Cluster: Cell division cycle protein 48, putative;
           n=1; Theileria parva|Rep: Cell division cycle protein
           48, putative - Theileria parva
          Length = 954

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 2/91 (2%)
 Frame = +3

Query: 573 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLGAN*GDGGVATAVILH--CFK 746
           ++  ++VI   G  + RE  +++   VGYDDIGG  KQL        +    +LH   FK
Sbjct: 336 LIVGESVIDSSGNYLTRENHDDSYGEVGYDDIGGMNKQLSK---IRELIELPLLHPELFK 392

Query: 747 AIGVKASTRHSPCMGPPXNRKKHSLARAVAN 839
            +G+    +     GPP + K   +ARA+AN
Sbjct: 393 TVGIN-PPKGVILHGPPGSGKT-LVARAIAN 421


>UniRef50_A7AVE1 Cluster: Cell division cycle protein ATPase,
           putative; n=1; Babesia bovis|Rep: Cell division cycle
           protein ATPase, putative - Babesia bovis
          Length = 922

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +3

Query: 573 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLGAN*GDGGVATAVILH--CFK 746
           +++ ++V+ C G  + RE+ + +   +GYD+IGG  KQL        +    +LH   +K
Sbjct: 332 LISGESVLDCSGPSLTREQHDASYGELGYDEIGGMDKQLSK---IRELIELPLLHPEVYK 388

Query: 747 AIGVKASTRHSPCMGPPXNRKKHSLARAVAN 839
           A+G+ +  +     GPP   K   +ARA+A+
Sbjct: 389 AVGI-SPPKGVILHGPPGTGKT-LIARAIAS 417



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 25/66 (37%), Positives = 38/66 (57%)
 Frame = +1

Query: 691 AQIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLIN 870
           ++I+E++ELPL     V + +    P+G++ + G   TGK T     +  ETGA   +IN
Sbjct: 371 SKIRELIELPLLHP-EVYKAVGISPPKGVI-LHGPPGTGK-TLIARAIASETGAHCVVIN 427

Query: 871 GPGIMS 888
           GP IMS
Sbjct: 428 GPEIMS 433


>UniRef50_Q4YQQ6 Cluster: Cell division cycle ATPase, putative; n=3;
           Plasmodium (Vinckeia)|Rep: Cell division cycle ATPase,
           putative - Plasmodium berghei
          Length = 932

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = +2

Query: 119 PNRLIVEEAVSD-DNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVA 259
           PN  +VE    + DN  + +S+ KM++L +  G TVLLKGK++KE VA
Sbjct: 101 PNYCLVENIDENADNFDIYMSKEKMKELNINDGFTVLLKGKKKKEMVA 148


>UniRef50_A2FTG5 Cluster: ATPase, AAA family protein; n=1;
           Trichomonas vaginalis G3|Rep: ATPase, AAA family protein
           - Trichomonas vaginalis G3
          Length = 1041

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/55 (40%), Positives = 27/55 (49%)
 Frame = +3

Query: 525 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           R +EFKVV   P    I+    VI    +PI RE      + V YD IGG  KQ+
Sbjct: 140 RVIEFKVVNCSPEEEVIIQDKEVILYRNQPIHRENIN--FSTVSYDSIGGLHKQI 192


>UniRef50_Q1GSQ3 Cluster: AAA family ATPase, CDC48 subfamily; n=15;
           cellular organisms|Rep: AAA family ATPase, CDC48
           subfamily - Sphingopyxis alaskensis (Sphingomonas
           alaskensis)
          Length = 773

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 30/64 (46%), Positives = 37/64 (57%)
 Frame = +1

Query: 694 QIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLING 873
           Q++EMVELPLR    + R L    PRG+L + G   TGK T     +  E+ A  FLING
Sbjct: 218 QLREMVELPLRYP-ELFRRLGVDPPRGVL-LHGPPGTGK-TRLARAVANESEAQFFLING 274

Query: 874 PGIM 885
           P IM
Sbjct: 275 PEIM 278


>UniRef50_Q58556 Cluster: Cell division cycle protein 48 homolog
           MJ1156; n=64; cellular organisms|Rep: Cell division
           cycle protein 48 homolog MJ1156 - Methanococcus
           jannaschii
          Length = 903

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 26/65 (40%), Positives = 39/65 (60%)
 Frame = +1

Query: 694 QIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLING 873
           +++EM+ELP+R      +L   + P+G+L V G   TGK T     +  E GA+ ++ING
Sbjct: 190 KVREMIELPMRHPELFEKL-GIEPPKGVLLV-GPPGTGK-TLLAKAVANEAGANFYVING 246

Query: 874 PGIMS 888
           P IMS
Sbjct: 247 PEIMS 251


>UniRef50_Q4UBT9 Cluster: Cell divison cycle CDC48 homologue,
           putative or transitional endoplasmic reticulum ATPase,
           putative; n=1; Theileria annulata|Rep: Cell divison
           cycle CDC48 homologue, putative or transitional
           endoplasmic reticulum ATPase, putative - Theileria
           annulata
          Length = 905

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +3

Query: 573 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           ++  ++VI   G  + RE+++ +   VGYDDIGG  KQL
Sbjct: 312 LIVGESVIDSGGNYLSREDDD-SFGEVGYDDIGGMNKQL 349


>UniRef50_Q6CL50 Cluster: Similarities with sp|Q9Y909 Aeropyrum
           pernix Putative uncharacterized protein APE2475; n=1;
           Kluyveromyces lactis|Rep: Similarities with sp|Q9Y909
           Aeropyrum pernix Putative uncharacterized protein
           APE2475 - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 85

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = -2

Query: 887 DMIPGPLIKKEEAPVSISNSTSQ*VFFPVTRRPHTWRMPRGSFHSNSLETVKDDRSGNST 708
           DM  GPLIKK+ APVS++ + +  V  PV   P+  ++P G     +L +     +GNST
Sbjct: 25  DMTSGPLIKKKNAPVSLATALAIRV-LPVPGGPYI-KIPFGGLIPMALNSC-GCLNGNST 81

Query: 707 ISLI 696
            SLI
Sbjct: 82  NSLI 85


>UniRef50_Q8TY20 Cluster: ATPase of the AAA+ class; n=1;
           Methanopyrus kandleri|Rep: ATPase of the AAA+ class -
           Methanopyrus kandleri
          Length = 1249

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 27/64 (42%), Positives = 36/64 (56%)
 Frame = +1

Query: 697 IKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGP 876
           I+E VELPL+    +  L   K P+G+L ++G   TGK T     +  E GA  + INGP
Sbjct: 227 IREYVELPLKRPELLKEL-GIKPPKGVL-LYGPPGTGK-TLLAKAVANECGAKFYSINGP 283

Query: 877 GIMS 888
            IMS
Sbjct: 284 EIMS 287


>UniRef50_Q59WG1 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 100

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = -2

Query: 887 DMIPGPLIKKEEAPVSISNSTSQ*VFFPVTRRPHTWRMPRGSFHSNSLETVKDDRSGNST 708
           D+I GP IKK++APVS++ + +  +  PV   P+  ++P G      L        GNST
Sbjct: 28  DIISGPFIKKKKAPVSLATALAI-MVLPVPGGPYI-KIPFGGLIPIDLNNC-GCLKGNST 84

Query: 707 ISLICAQLF 681
            SLI A  F
Sbjct: 85  NSLIWAICF 93


>UniRef50_Q74M89 Cluster: NEQ475; n=1; Nanoarchaeum equitans|Rep:
           NEQ475 - Nanoarchaeum equitans
          Length = 826

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 26/65 (40%), Positives = 38/65 (58%)
 Frame = +1

Query: 694 QIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLING 873
           +++E+VELPLR      R L  + P+G+L ++G   TGK T     +  E+GA    ING
Sbjct: 202 KVRELVELPLRHPEIFER-LGIEPPKGVL-LYGPPGTGK-TLLAKAVANESGAYFISING 258

Query: 874 PGIMS 888
           P I+S
Sbjct: 259 PEIVS 263


>UniRef50_Q1JSD1 Cluster: Transitional endoplasmic reticulum ATPase;
           n=1; Toxoplasma gondii|Rep: Transitional endoplasmic
           reticulum ATPase - Toxoplasma gondii
          Length = 792

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +2

Query: 188 MEQLQLFRGDTVLLKGKRRKETVA 259
           M  LQ+ RGD VLL G+R++ETVA
Sbjct: 1   MAALQVQRGDVVLLSGRRKRETVA 24



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 24/64 (37%), Positives = 36/64 (56%)
 Frame = +1

Query: 697 IKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGP 876
           I+E+VELPLR    + + +  + PRG+L + G    GK T     +  E GA+   +NGP
Sbjct: 212 IRELVELPLRFP-EIFKQVGVQTPRGVL-LHGSSGCGK-TLLAKAIANECGANFLTVNGP 268

Query: 877 GIMS 888
            +MS
Sbjct: 269 EVMS 272


>UniRef50_Q0W6B6 Cluster: Putative cell division cycle protein 48;
           n=1; uncultured methanogenic archaeon RC-I|Rep: Putative
           cell division cycle protein 48 - Uncultured methanogenic
           archaeon RC-I
          Length = 942

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +3

Query: 537 FKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLG 692
           F V  T P+   I    T +    +P++ E+ E+  + + Y+DIGG R+++G
Sbjct: 142 FVVTNTRPAGTVIADMSTEVTISEKPVEAEKAEKTPH-ISYEDIGGLRREIG 192


>UniRef50_A1HPK1 Cluster: AAA family ATPase, CDC48 subfamily; n=1;
           Thermosinus carboxydivorans Nor1|Rep: AAA family ATPase,
           CDC48 subfamily - Thermosinus carboxydivorans Nor1
          Length = 720

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 42/142 (29%), Positives = 61/142 (42%)
 Frame = +3

Query: 435 QSIRSILEAVLHGGLPSDPS*RHLQVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEP 614
           Q IR  LE +L+G LP     +      G RA  F V+ T P    ++   T I      
Sbjct: 113 QDIRH-LERLLNG-LPVIIGDKIKVTLAGARAQYFTVIGTSPQGPVVINAATKITVT--- 167

Query: 615 IKREEEEEALNAVGYDDIGGCRKQLGAN*GDGGVATAVILHCFKAIGVKASTRHSPCMGP 794
            K + +E+      Y+D+GG  K+L     +           F+ +GV A  +     GP
Sbjct: 168 -KPDVQEDMSYCASYEDVGGLDKEL-QRIREMIELPLKYPEVFRQLGVDA-PKGVLLYGP 224

Query: 795 PXNRKKHSLARAVANGNRGFFL 860
           P   K   +ARAVA+ +R  FL
Sbjct: 225 PGTGKT-LMARAVASESRATFL 245


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 927,409,591
Number of Sequences: 1657284
Number of extensions: 19091093
Number of successful extensions: 50050
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 47905
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50028
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79932179145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -