SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-...   167   4e-40
UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4; ...   154   2e-36
UniRef50_Q8IT93 Cluster: Y-box protein Ct-p50; n=4; Endopterygot...   122   1e-26
UniRef50_A0NEN6 Cluster: ENSANGP00000031633; n=12; cellular orga...   120   3e-26
UniRef50_P16989 Cluster: DNA-binding protein A; n=92; cellular o...   117   4e-25
UniRef50_Q90650 Cluster: Rous sarcoma virus transcription enhanc...   116   9e-25
UniRef50_Q9XSU1 Cluster: DNA binding protein; n=3; Amniota|Rep: ...   116   9e-25
UniRef50_Q4H2L8 Cluster: Y-box protein 1/2/3; n=2; Ciona intesti...   115   2e-24
UniRef50_O13015 Cluster: Y box protein 2; n=1; Carassius auratus...   114   2e-24
UniRef50_P67809 Cluster: Nuclease sensitive element-binding prot...   114   2e-24
UniRef50_Q90WH1 Cluster: Cold-shock domain protein; n=1; Oryzias...   113   4e-24
UniRef50_P41824 Cluster: Y-box factor homolog; n=2; cellular org...   113   4e-24
UniRef50_Q9Y2T7 Cluster: Y-box-binding protein 2; n=21; Tetrapod...   113   4e-24
UniRef50_O46173 Cluster: Y-box protein; n=5; cellular organisms|...   112   9e-24
UniRef50_UPI00005843EB Cluster: PREDICTED: similar to Y-Box fact...   110   5e-23
UniRef50_UPI00015B4254 Cluster: PREDICTED: similar to Y-box prot...   106   8e-22
UniRef50_O62213 Cluster: Putative uncharacterized protein cey-1;...    94   4e-18
UniRef50_UPI00006A28C0 Cluster: Y-box-binding protein 2 (Germ ce...    93   6e-18
UniRef50_UPI0000DC0B3F Cluster: UPI0000DC0B3F related cluster; n...    93   8e-18
UniRef50_UPI0000DC181B Cluster: UPI0000DC181B related cluster; n...    77   7e-13
UniRef50_Q23960 Cluster: Y-box protein; n=2; Dugesia|Rep: Y-box ...    71   4e-11
UniRef50_A4V6J7 Cluster: Y-Box factor protein; n=1; Dugesia japo...    69   1e-10
UniRef50_Q17JD9 Cluster: Putative uncharacterized protein; n=1; ...    67   6e-10
UniRef50_P91306 Cluster: Y-box protein 2; n=2; Caenorhabditis el...    65   2e-09
UniRef50_Q9XTJ6 Cluster: Putative uncharacterized protein cey-4;...    62   1e-08
UniRef50_A1L2L1 Cluster: LOC100036881 protein; n=1; Xenopus laev...    56   1e-06
UniRef50_UPI0000DC0B82 Cluster: UPI0000DC0B82 related cluster; n...    51   3e-05
UniRef50_Q5CVY2 Cluster: Cold shock RNA binding domain of the OB...    51   4e-05
UniRef50_Q1RLA8 Cluster: Zinc finger protein; n=1; Ciona intesti...    50   9e-05
UniRef50_A7RV03 Cluster: Predicted protein; n=1; Nematostella ve...    49   2e-04
UniRef50_UPI000155640A Cluster: PREDICTED: hypothetical protein;...    48   2e-04
UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triti...    48   2e-04
UniRef50_Q6ZN17 Cluster: Lin-28 homolog B; n=40; Coelomata|Rep: ...    48   2e-04
UniRef50_Q52KT6 Cluster: MGC115344 protein; n=2; Xenopus|Rep: MG...    48   4e-04
UniRef50_A3BPB0 Cluster: Putative uncharacterized protein; n=2; ...    46   9e-04
UniRef50_A4RZ32 Cluster: Predicted protein; n=1; Ostreococcus lu...    46   0.001
UniRef50_Q1QAP9 Cluster: Cold-shock DNA-binding domain protein; ...    43   0.008
UniRef50_Q2LZN5 Cluster: GA14466-PA; n=3; Endopterygota|Rep: GA1...    43   0.008
UniRef50_UPI0000589074 Cluster: PREDICTED: similar to ENSANGP000...    43   0.011
UniRef50_A5BWB0 Cluster: Putative uncharacterized protein; n=1; ...    43   0.011
UniRef50_O65639 Cluster: Glycine-rich protein; n=8; Magnoliophyt...    42   0.014
UniRef50_Q74BX3 Cluster: Cold shock domain family protein; n=13;...    41   0.033
UniRef50_Q4S6T5 Cluster: Chromosome 14 SCAF14723, whole genome s...    41   0.043
UniRef50_Q016S2 Cluster: Putative nucleic acid binding protein; ...    41   0.043
UniRef50_Q013V8 Cluster: Glycogen debranching enzyme; n=1; Ostre...    40   0.057
UniRef50_Q9VRN5 Cluster: Lin-28 homolog; n=1; Drosophila melanog...    40   0.076
UniRef50_Q9ZBH4 Cluster: Putative DNA-binding protein; n=2; Acti...    40   0.100
UniRef50_A4VMZ2 Cluster: Cold shock protein CspA; n=12; Bacteria...    40   0.100
UniRef50_Q38896 Cluster: Glycine-rich protein 2b; n=26; cellular...    39   0.17 
UniRef50_A5NZH6 Cluster: Putative cold-shock DNA-binding domain ...    38   0.23 
UniRef50_P0A981 Cluster: Cold shock-like protein cspG; n=154; Ba...    38   0.23 
UniRef50_Q9ZFK9 Cluster: CspA; n=25; Bacteria|Rep: CspA - Myxoco...    37   0.53 
UniRef50_Q9ZFK8 Cluster: CspB; n=4; cellular organisms|Rep: CspB...    37   0.70 
UniRef50_Q08VT0 Cluster: Conserved domain protein; n=2; Bacteria...    37   0.70 
UniRef50_A0YCJ0 Cluster: Cold-shock DNA-binding protein; n=1; ma...    37   0.70 
UniRef50_Q4UBG6 Cluster: Cold shock protein, putative; n=2; Thei...    37   0.70 
UniRef50_P72366 Cluster: Cold shock-like protein cspA; n=29; Bac...    37   0.70 
UniRef50_UPI00015BD510 Cluster: UPI00015BD510 related cluster; n...    36   1.2  
UniRef50_Q4JMV8 Cluster: Predicted cold shock family protein; n=...    36   1.2  
UniRef50_Q2BKV8 Cluster: Cold-shock domain family protein; n=3; ...    36   1.2  
UniRef50_Q5JKD6 Cluster: Cold shock domain protein 2-like protei...    36   1.2  
UniRef50_Q8G880 Cluster: Cold shock protein; n=3; Bifidobacteriu...    36   1.6  
UniRef50_P92186 Cluster: Protein lin-28; n=5; Caenorhabditis|Rep...    36   1.6  
UniRef50_Q83RI9 Cluster: Cold shock-like protein cspC; n=38; Gam...    36   1.6  
UniRef50_A1CFX7 Cluster: Cold shock NA binding domain protein; n...    35   2.2  
UniRef50_Q3Y013 Cluster: Cold-shock protein, DNA-binding; n=6; c...    35   2.8  
UniRef50_Q1N1Z0 Cluster: Cold shock protein; n=14; Bacteria|Rep:...    35   2.8  
UniRef50_A5ZS66 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_A3YF52 Cluster: Cold-shock protein, DNA-binding; n=2; M...    34   3.8  
UniRef50_Q38CH1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_P0A363 Cluster: Cold shock-like protein cspB; n=367; ro...    34   3.8  
UniRef50_Q9S1B7 Cluster: Cold shock-like protein cspA; n=10; Bac...    34   3.8  
UniRef50_Q60AQ4 Cluster: Cold shock protein; n=27; Bacteria|Rep:...    34   5.0  
UniRef50_Q2RQP4 Cluster: Cold-shock DNA-binding domain protein; ...    34   5.0  
UniRef50_P39158 Cluster: Cold shock protein cspC; n=41; Bacteria...    34   5.0  
UniRef50_P72188 Cluster: Cold shock protein capA; n=23; Proteoba...    34   5.0  
UniRef50_Q2J4H7 Cluster: Cold-shock DNA-binding domain protein; ...    33   6.6  
UniRef50_A5ZXC4 Cluster: Putative uncharacterized protein; n=2; ...    33   6.6  
UniRef50_A3Y9L0 Cluster: Cold-shock DNA-binding domain protein; ...    33   6.6  
UniRef50_Q53VE0 Cluster: Ser/Thr protein kinase; n=3; Papilionoi...    33   6.6  
UniRef50_Q6FAY9 Cluster: Cold shock-like protein; n=44; Bacteria...    33   8.7  
UniRef50_Q8GI47 Cluster: Cold shock protein homolog; n=5; Deinoc...    33   8.7  
UniRef50_Q7D268 Cluster: AGR_C_161p; n=7; Proteobacteria|Rep: AG...    33   8.7  
UniRef50_Q1ZKE8 Cluster: Cold shock protein; n=3; Gammaproteobac...    33   8.7  
UniRef50_Q0BPU3 Cluster: Cold shock protein; n=1; Granulibacter ...    33   8.7  
UniRef50_A6C5W3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.7  
UniRef50_A4BC11 Cluster: Cold shock protein; n=1; Reinekea sp. M...    33   8.7  

>UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-box
           protein - Bombyx mori (Silk moth)
          Length = 272

 Score =  167 bits (405), Expect = 4e-40
 Identities = 77/81 (95%), Positives = 79/81 (97%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV
Sbjct: 53  FINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 112

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           KGSPYAADKRRGYHRQYFPRQ
Sbjct: 113 KGSPYAADKRRGYHRQYFPRQ 133



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIAEKVSGTVKWFNVKSGYGFINR
Sbjct: 33  VIAEKVSGTVKWFNVKSGYGFINR 56


>UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4;
           cellular organisms|Rep: Putative uncharacterized protein
           - Lonomia obliqua (Moth)
          Length = 254

 Score =  154 bits (374), Expect = 2e-36
 Identities = 71/80 (88%), Positives = 75/80 (93%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI RNNPRKAVRSVGDGE VEFAVVAGEKG EAAGVTGPGGEPV
Sbjct: 44  FINRNDTKEDVFVHQTAIIRNNPRKAVRSVGDGEVVEFAVVAGEKGCEAAGVTGPGGEPV 103

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGSPYAADKRRGY+RQY+PR
Sbjct: 104 KGSPYAADKRRGYYRQYYPR 123



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIAEKVSGTVKWFNVKSGYGFINR
Sbjct: 24  VIAEKVSGTVKWFNVKSGYGFINR 47


>UniRef50_Q8IT93 Cluster: Y-box protein Ct-p50; n=4;
           Endopterygota|Rep: Y-box protein Ct-p50 - Chironomus
           tentans (Midge)
          Length = 317

 Score =  122 bits (294), Expect = 1e-26
 Identities = 56/72 (77%), Positives = 63/72 (87%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++D K+D+FVHQ+AI +NNP+KAVRSVGDGE VEF VVAGEKG EAA VTGP GEPV
Sbjct: 45  FINRNDNKQDIFVHQSAIIKNNPKKAVRSVGDGEVVEFDVVAGEKGSEAANVTGPEGEPV 104

Query: 421 KGSPYAADKRRG 456
           KGSPYAADKRRG
Sbjct: 105 KGSPYAADKRRG 116



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           +IA KV+GTVKWFNVKSGYGFINR
Sbjct: 25  IIATKVTGTVKWFNVKSGYGFINR 48


>UniRef50_A0NEN6 Cluster: ENSANGP00000031633; n=12; cellular
           organisms|Rep: ENSANGP00000031633 - Anopheles gambiae
           str. PEST
          Length = 166

 Score =  120 bits (290), Expect = 3e-26
 Identities = 58/80 (72%), Positives = 65/80 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  + DT+EDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV
Sbjct: 25  FINRGDTQEDVFVHQSAIARNNPKKAVRSVGDGEQVEFDVVIGEKGNEAANVTGPQGEPV 84

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YAA+KRRG+   +  R
Sbjct: 85  KGSQYAAEKRRGFRHWWQKR 104



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV+G VKWFNVKSGYGFINR
Sbjct: 5   VIATKVTGVVKWFNVKSGYGFINR 28


>UniRef50_P16989 Cluster: DNA-binding protein A; n=92; cellular
           organisms|Rep: DNA-binding protein A - Homo sapiens
           (Human)
          Length = 372

 Score =  117 bits (281), Expect = 4e-25
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>UniRef50_Q90650 Cluster: Rous sarcoma virus transcription enhancer
           factor II; n=1; Gallus gallus|Rep: Rous sarcoma virus
           transcription enhancer factor II - Gallus gallus
           (Chicken)
          Length = 298

 Score =  116 bits (278), Expect = 9e-25
 Identities = 57/81 (70%), Positives = 64/81 (79%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK + SVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 103 FINRNDTKEDVFVHQTAIKKNNPRKYLASVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 162

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R YF R+
Sbjct: 163 EGSRYAADRRR-YRRGYFGRR 182



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 83  VLATKVLGTVKWFNVRNGYGFINR 106


>UniRef50_Q9XSU1 Cluster: DNA binding protein; n=3; Amniota|Rep: DNA
           binding protein - Canis familiaris (Dog)
          Length = 96

 Score =  116 bits (278), Expect = 9e-25
 Identities = 56/81 (69%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE V+F VV GEKG EAA VTGP G PV
Sbjct: 8   FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVQFDVVEGEKGAEAANVTGPDGVPV 67

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 68  EGSRYAADRRR-YRRGYYGRR 87


>UniRef50_Q4H2L8 Cluster: Y-box protein 1/2/3; n=2; Ciona
           intestinalis|Rep: Y-box protein 1/2/3 - Ciona
           intestinalis (Transparent sea squirt)
          Length = 320

 Score =  115 bits (276), Expect = 2e-24
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF-EAAGVTGPGGEP 417
           F  +DD KEDVF+HQTAI +NNP+K +RSVGDGE VEF VV GEKG  EAA VTGP GEP
Sbjct: 41  FVNRDDNKEDVFIHQTAIIKNNPKKYLRSVGDGENVEFDVVEGEKGLPEAANVTGPNGEP 100

Query: 418 VKGSPYAADKRRGYHRQYFPR 480
           VKGS YAAD+RR Y  +Y PR
Sbjct: 101 VKGSKYAADRRR-YKPRYKPR 120



 Score = 42.7 bits (96), Expect = 0.011
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A   SG VKWFNV++GYGF+NR
Sbjct: 21  VLASHCSGVVKWFNVRNGYGFVNR 44


>UniRef50_O13015 Cluster: Y box protein 2; n=1; Carassius
           auratus|Rep: Y box protein 2 - Carassius auratus
           (Goldfish)
          Length = 297

 Score =  114 bits (275), Expect = 2e-24
 Identities = 55/80 (68%), Positives = 64/80 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV   KG EAA VTGPGG PV
Sbjct: 36  FINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVVEAAKGSEAANVTGPGGIPV 95

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA +KRR + R+++PR
Sbjct: 96  KGSRYAPNKRR-FRRRFYPR 114



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA  V GTVKWFNV++GYGFINR
Sbjct: 16  VIATGVEGTVKWFNVRNGYGFINR 39


>UniRef50_P67809 Cluster: Nuclease sensitive element-binding protein
           1; n=65; Coelomata|Rep: Nuclease sensitive
           element-binding protein 1 - Homo sapiens (Human)
          Length = 324

 Score =  114 bits (275), Expect = 2e-24
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>UniRef50_Q90WH1 Cluster: Cold-shock domain protein; n=1; Oryzias
           latipes|Rep: Cold-shock domain protein - Oryzias latipes
           (Medaka fish) (Japanese ricefish)
          Length = 366

 Score =  113 bits (273), Expect = 4e-24
 Identities = 54/80 (67%), Positives = 64/80 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF V+   KG EAA VTGPGG PV
Sbjct: 18  FINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPV 77

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA +KRR + R++FP+
Sbjct: 78  KGSRYAPNKRR-FRRRFFPQ 96



 Score = 41.9 bits (94), Expect = 0.019
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 VSGTVKWFNVKSGYGFINR 253
           V GTVKWFNV++GYGFINR
Sbjct: 3   VQGTVKWFNVRNGYGFINR 21


>UniRef50_P41824 Cluster: Y-box factor homolog; n=2; cellular
           organisms|Rep: Y-box factor homolog - Aplysia
           californica (California sea hare)
          Length = 253

 Score =  113 bits (273), Expect = 4e-24
 Identities = 55/80 (68%), Positives = 62/80 (77%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  +DDTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G  V
Sbjct: 48  FINRDDTKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNV 107

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           +GS YAAD+RR     ++PR
Sbjct: 108 QGSKYAADRRRFRRGGWYPR 127



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           +IA +VSGTVKWFNVKSGYGFINR
Sbjct: 28  IIASQVSGTVKWFNVKSGYGFINR 51


>UniRef50_Q9Y2T7 Cluster: Y-box-binding protein 2; n=21;
           Tetrapoda|Rep: Y-box-binding protein 2 - Homo sapiens
           (Human)
          Length = 364

 Score =  113 bits (273), Expect = 4e-24
 Identities = 55/80 (68%), Positives = 63/80 (78%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PV
Sbjct: 109 FINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPV 168

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA ++R+   R++ PR
Sbjct: 169 KGSRYAPNRRKS--RRFIPR 186



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A +V GTVKWFNV++GYGFINR
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINR 112


>UniRef50_O46173 Cluster: Y-box protein; n=5; cellular
           organisms|Rep: Y-box protein - Drosophila melanogaster
           (Fruit fly)
          Length = 359

 Score =  112 bits (270), Expect = 9e-24
 Identities = 54/73 (73%), Positives = 62/73 (84%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DT+EDVFVHQ+AIA NNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV
Sbjct: 78  FINRNDTREDVFVHQSAIA-NNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPV 136

Query: 421 KGSPYAADKRRGY 459
           +GS +AADKRR +
Sbjct: 137 RGSQFAADKRRNF 149



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/29 (79%), Positives = 25/29 (86%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRK 268
           VIA KV+GTVKWFNVKSGYGFINR   R+
Sbjct: 58  VIATKVTGTVKWFNVKSGYGFINRNDTRE 86


>UniRef50_UPI00005843EB Cluster: PREDICTED: similar to Y-Box factor;
           n=4; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Y-Box factor - Strongylocentrotus purpuratus
          Length = 326

 Score =  110 bits (264), Expect = 5e-23
 Identities = 57/82 (69%), Positives = 62/82 (75%), Gaps = 1/82 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  +DDTKEDVFVHQ+AI RNNPRK  RSVGDGE VEF VV G KG EAA VTGP G PV
Sbjct: 39  FINRDDTKEDVFVHQSAIVRNNPRKYQRSVGDGEVVEFDVVEGTKGNEAARVTGPEGAPV 98

Query: 421 KGSPYAADKRRGYHR-QYFPRQ 483
            GS YAADKRR   R +Y+ R+
Sbjct: 99  VGSKYAADKRRYRGRPRYYRRR 120



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KVSGTVKWFNVK+GYGFINR
Sbjct: 19  VLATKVSGTVKWFNVKNGYGFINR 42


>UniRef50_UPI00015B4254 Cluster: PREDICTED: similar to Y-box protein
           Ct-p40; n=1; Nasonia vitripennis|Rep: PREDICTED: similar
           to Y-box protein Ct-p40 - Nasonia vitripennis
          Length = 335

 Score =  106 bits (254), Expect = 8e-22
 Identities = 53/72 (73%), Positives = 57/72 (79%)
 Frame = +1

Query: 268 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADK 447
           D+FV Q  I+ N P KAVRSVGDGE VEF VV GEKG EAA VTGP GE VKGSPYAADK
Sbjct: 93  DIFVCQRCISNNLPSKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPDGEAVKGSPYAADK 152

Query: 448 RRGYHRQYFPRQ 483
           RRGY RQY+ R+
Sbjct: 153 RRGY-RQYYNRR 163



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           +IA KV+GTVKWFNVKSGYGFINR
Sbjct: 64  IIANKVTGTVKWFNVKSGYGFINR 87


>UniRef50_O62213 Cluster: Putative uncharacterized protein cey-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cey-1 - Caenorhabditis elegans
          Length = 208

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 43/69 (62%), Positives = 50/69 (72%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  + DT ED+FVHQTAI  NNP K +RS+GD E V F +V G KG EAA VTGP G PV
Sbjct: 36  FINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPV 95

Query: 421 KGSPYAADK 447
           +GS YAAD+
Sbjct: 96  QGSKYAADR 104



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V A KV GTVKWFNVK+GYGFINR
Sbjct: 16  VKATKVKGTVKWFNVKNGYGFINR 39


>UniRef50_UPI00006A28C0 Cluster: Y-box-binding protein 2 (Germ
           cell-specific Y-box-binding protein) (Contrin) (MSY2
           homolog).; n=1; Xenopus tropicalis|Rep: Y-box-binding
           protein 2 (Germ cell-specific Y-box-binding protein)
           (Contrin) (MSY2 homolog). - Xenopus tropicalis
          Length = 199

 Score = 93.5 bits (222), Expect = 6e-18
 Identities = 46/65 (70%), Positives = 50/65 (76%)
 Frame = +1

Query: 286 TAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 465
           TAI RNNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PVKGS +A ++RR   R
Sbjct: 70  TAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRR 129

Query: 466 QYFPR 480
            Y PR
Sbjct: 130 FYRPR 134


>UniRef50_UPI0000DC0B3F Cluster: UPI0000DC0B3F related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0B3F UniRef100 entry -
           Rattus norvegicus
          Length = 292

 Score = 93.1 bits (221), Expect = 8e-18
 Identities = 44/72 (61%), Positives = 53/72 (73%)
 Frame = +1

Query: 250 QDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           ++DTKEDVFVHQTA+ +N+PRK +RSVGD E VEF  V GEK  EAA VTG GG PV+ S
Sbjct: 49  RNDTKEDVFVHQTAMKKNDPRKYLRSVGDAETVEFDFVEGEKDVEAASVTGLGGVPVQDS 108

Query: 430 PYAADKRRGYHR 465
            Y AD+    H+
Sbjct: 109 KYTADRNHCKHQ 120


>UniRef50_UPI0000DC181B Cluster: UPI0000DC181B related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC181B UniRef100 entry -
           Rattus norvegicus
          Length = 210

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 37/64 (57%), Positives = 46/64 (71%)
 Frame = +1

Query: 250 QDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           ++ +  DVFVHQTAI +NNPRK + + GD E VEF V+ GEK  EAA + GPGG  V+GS
Sbjct: 47  KNSSGNDVFVHQTAIKKNNPRKYLHTTGDRETVEFDVIEGEKDAEAANIIGPGG--VQGS 104

Query: 430 PYAA 441
            YAA
Sbjct: 105 QYAA 108


>UniRef50_Q23960 Cluster: Y-box protein; n=2; Dugesia|Rep: Y-box
           protein - Dugesia japonica (Planarian)
          Length = 266

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 34/72 (47%), Positives = 48/72 (66%)
 Frame = +1

Query: 250 QDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           ++D +ED+F+HQ+AI ++NP    +SVG+GE + F +V G KG EAA V+   G+ VKGS
Sbjct: 47  RNDNQEDIFIHQSAIVKSNPDHPRKSVGEGEEILFDIVKGAKGNEAANVSAIDGKCVKGS 106

Query: 430 PYAADKRRGYHR 465
            YA    RG  R
Sbjct: 107 EYALRYPRGRGR 118



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +2

Query: 197 VSGTVKWFNVKSGYGFINR 253
           ++G VKWFNVK GYGF+ R
Sbjct: 29  ITGKVKWFNVKRGYGFVCR 47


>UniRef50_A4V6J7 Cluster: Y-Box factor protein; n=1; Dugesia
           japonica|Rep: Y-Box factor protein - Dugesia japonica
           (Planarian)
          Length = 178

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 36/66 (54%), Positives = 44/66 (66%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  +DD  EDVFVHQ+AI+R  P K  +S+G+ E V F VV G KG EA  VTGP G+ V
Sbjct: 18  FIHRDDVDEDVFVHQSAISRCQPGKQ-KSLGEDEDVLFDVVKGSKGNEAMNVTGPNGDAV 76

Query: 421 KGSPYA 438
            GS +A
Sbjct: 77  LGSKFA 82



 Score = 35.5 bits (78), Expect = 1.6
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINR 253
           G VKW+NVK GYGFI+R
Sbjct: 5   GKVKWYNVKKGYGFIHR 21


>UniRef50_Q17JD9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 192

 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 35/75 (46%), Positives = 48/75 (64%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  + DT ED+FVH++ I + N     +S+GDGE VEF ++A +       VTGPG +PV
Sbjct: 49  FITRHDTGEDIFVHKSCIFKPNRNHFTKSIGDGEIVEFGLIASK-------VTGPGFKPV 101

Query: 421 KGSPYAADKRRGYHR 465
           KGSP+ A  +RG HR
Sbjct: 102 KGSPFVA--KRGGHR 114



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 13/22 (59%), Positives = 19/22 (86%)
 Frame = +2

Query: 188 AEKVSGTVKWFNVKSGYGFINR 253
           +++++GTVKWFN K G+GFI R
Sbjct: 31  SKRITGTVKWFNAKDGFGFITR 52


>UniRef50_P91306 Cluster: Y-box protein 2; n=2; Caenorhabditis
           elegans|Rep: Y-box protein 2 - Caenorhabditis elegans
          Length = 267

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEP 417
           F  ++D ++D+FVHQTAIA++   K  +R++GD E V F +V G+ G EAA VTGP G+ 
Sbjct: 81  FISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDN 140

Query: 418 VKGSPYAADKRRGYHRQYFPR 480
           V GS Y       + +   PR
Sbjct: 141 VIGSRYRHKLLSRFRKNRKPR 161


>UniRef50_Q9XTJ6 Cluster: Putative uncharacterized protein cey-4;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cey-4 - Caenorhabditis elegans
          Length = 294

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSP 432
           D  ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS 
Sbjct: 112 DENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSR 171

Query: 433 YA 438
           +A
Sbjct: 172 FA 173


>UniRef50_A1L2L1 Cluster: LOC100036881 protein; n=1; Xenopus
           laevis|Rep: LOC100036881 protein - Xenopus laevis
           (African clawed frog)
          Length = 131

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG- 378
           G C+    ++   F   DD   D+FVHQ+ I  +      RS+ +GE VEF+V+  E+  
Sbjct: 6   GTCKWFNAEKGYGFLTPDDGSPDIFVHQSTIHAD----GFRSLAEGEPVEFSVITDERSG 61

Query: 379 -FEAAGVTGPGGEPVKGSP 432
             +AA VTGP G  V+G+P
Sbjct: 62  KLKAADVTGPNGAAVRGAP 80



 Score = 33.5 bits (73), Expect = 6.6
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +2

Query: 194 KVSGTVKWFNVKSGYGFI 247
           K++GT KWFN + GYGF+
Sbjct: 3   KLTGTCKWFNAEKGYGFL 20


>UniRef50_UPI0000DC0B82 Cluster: UPI0000DC0B82 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0B82 UniRef100 entry -
           Rattus norvegicus
          Length = 147

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/37 (64%), Positives = 28/37 (75%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVE 351
           F  ++DTKED FVHQT I +NNP K + SVGDGE VE
Sbjct: 111 FINRNDTKEDTFVHQTVIKKNNP-KYLHSVGDGETVE 146



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV G V WFNV++GY FINR
Sbjct: 91  VIAMKVLGIVTWFNVRNGYVFINR 114


>UniRef50_Q5CVY2 Cluster: Cold shock RNA binding domain of the OB
           fold; n=2; Cryptosporidium|Rep: Cold shock RNA binding
           domain of the OB fold - Cryptosporidium parvum Iowa II
          Length = 135

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 33/89 (37%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG- 378
           G C+     +   F   DD  ED+FVHQ    +N   +  RS+   E VE+ +   +KG 
Sbjct: 13  GVCKWFDSTKGFGFITPDDGSEDIFVHQ----QNIKVEGFRSLAQDERVEYEIETDDKGR 68

Query: 379 FEAAGVTGPGGEPVKGSPYAADKRRGYHR 465
            +A  V+GP G PVKG     D+RRG  R
Sbjct: 69  RKAVNVSGPNGAPVKG-----DRRRGRGR 92


>UniRef50_Q1RLA8 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 193

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = +1

Query: 193 ESIGHCEMVQRQEWIWFHQQDDT---KEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV 363
           E+ G+C+    ++   F   D +   K DVFVHQ++I      +  RS+ +G+ V+F   
Sbjct: 26  EAFGNCKWFNSKQGYGFITPDTSSQEKTDVFVHQSSI----DMEGFRSLQEGDRVKFWYK 81

Query: 364 AGEKGFEAAGVTGPGGEPVKGS 429
             +KG EA  V GPGGE + G+
Sbjct: 82  PSKKGLEAVKVVGPGGEKLVGA 103


>UniRef50_A7RV03 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 671

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 28/63 (44%), Positives = 37/63 (58%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  +DD  EDVFVHQ+AI  +      RS+ +GE V+  +   +KG  A  VT PGG  V
Sbjct: 498 FITRDDGGEDVFVHQSAIKASG----YRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNV 553

Query: 421 KGS 429
           KG+
Sbjct: 554 KGA 556


>UniRef50_UPI000155640A Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 502

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRKMCLC--IRLPSPVTTHVRLCARSATERRWSL 355
           V+A +V GTVKWFNV++GYGFINR      C C       P T   R  +R+       L
Sbjct: 56  VLATQVLGTVKWFNVRNGYGFINRYRSAPGCGCGSRGRGGPSTRGARSASRAPDNPAKLL 115

Query: 356 PWLP 367
           P+ P
Sbjct: 116 PFSP 119


>UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triticum
           aestivum|Rep: Cold shock domain protein 3 - Triticum
           aestivum (Wheat)
          Length = 231

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD  ED+FVHQ+AI  +      RS+ + +AVEF ++ G+ G  +A+ VT PGG  
Sbjct: 20  FISPDDGGEDLFVHQSAIKSD----GYRSLNENDAVEFEIITGDDGRTKASDVTAPGGGA 75

Query: 418 VKG 426
           + G
Sbjct: 76  LSG 78



 Score = 37.9 bits (84), Expect = 0.30
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFIN 250
           + E+V GTVKWFNV  G+GFI+
Sbjct: 1   MGERVKGTVKWFNVTKGFGFIS 22


>UniRef50_Q6ZN17 Cluster: Lin-28 homolog B; n=40; Coelomata|Rep:
           Lin-28 homolog B - Homo sapiens (Human)
          Length = 250

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 57  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>UniRef50_Q52KT6 Cluster: MGC115344 protein; n=2; Xenopus|Rep:
           MGC115344 protein - Xenopus laevis (African clawed frog)
          Length = 221

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 31  VLATKVQGTVKWFNVRNGYGFINR 54



 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/34 (64%), Positives = 26/34 (76%)
 Frame = +1

Query: 373 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYF 474
           +G EAA VTGP G PV+GS YAAD+RR Y R Y+
Sbjct: 65  QGAEAANVTGPKGAPVQGSRYAADRRR-YRRGYY 97


>UniRef50_A3BPB0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 238

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD  ED+FVHQ+++  +      RS+ DG+ VEF+V +G  G  +A  VT PGG  
Sbjct: 21  FITPDDGGEDLFVHQSSLKSDG----YRSLNDGDVVEFSVGSGNDGRTKAVNVTAPGGRA 76

Query: 418 V 420
           V
Sbjct: 77  V 77



 Score = 33.9 bits (74), Expect = 5.0
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 188 AEKVSGTVKWFNVKSGYGFI 247
           +E+V GTVKWF+   G+GFI
Sbjct: 3   SERVKGTVKWFDATKGFGFI 22


>UniRef50_A4RZ32 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 106

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/66 (40%), Positives = 36/66 (54%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPY 435
           D  E++FVHQT I+        RSV +GE VE+ V   +   +A  VTGP G  VKG+P 
Sbjct: 25  DGSEEIFVHQTGISC----AGFRSVWEGEEVEYDVDDTDFAPKAVNVTGPDGVAVKGAPR 80

Query: 436 AADKRR 453
              + R
Sbjct: 81  RRHRNR 86


>UniRef50_Q1QAP9 Cluster: Cold-shock DNA-binding domain protein;
           n=5; cellular organisms|Rep: Cold-shock DNA-binding
           domain protein - Psychrobacter cryohalolentis (strain
           K5)
          Length = 71

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 24/49 (48%), Positives = 31/49 (63%)
 Frame = +1

Query: 250 QDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           Q D+ ED+FVH  AI  +      RS+ DGE VEF+VV G+KG +A  V
Sbjct: 22  QRDSGEDIFVHFRAIQGDG----YRSLKDGEKVEFSVVEGDKGLQAEEV 66


>UniRef50_Q2LZN5 Cluster: GA14466-PA; n=3; Endopterygota|Rep:
           GA14466-PA - Drosophila pseudoobscura (Fruit fly)
          Length = 168

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = +1

Query: 199 IGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG 378
           +G C+     +   F   +D  ++VFVHQ+ I  +      RS+G+ E VEF      +G
Sbjct: 22  LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIKMS----GFRSLGEQEEVEFECHRTARG 77

Query: 379 FEAAGVTGPGGEPVKGSPY 435
            EA  V+G  G+   GS Y
Sbjct: 78  LEATRVSGRAGDECHGSTY 96


>UniRef50_UPI0000589074 Cluster: PREDICTED: similar to
           ENSANGP00000011455; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ENSANGP00000011455
           - Strongylocentrotus purpuratus
          Length = 234

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 29/76 (38%), Positives = 33/76 (43%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 381
           G C+     +   F   DD   DVFVHQ  I         RS+   E VE+     EKG 
Sbjct: 65  GKCKWFSLAKCYGFLTPDDGSGDVFVHQRVIKM----VGYRSLDTNEEVEYKFQFSEKGR 120

Query: 382 EAAGVTGPGGEPVKGS 429
           EA  VTG  G   KGS
Sbjct: 121 EATTVTGVDGGDCKGS 136


>UniRef50_A5BWB0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 189

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +1

Query: 196 SIGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEK 375
           S G  +    Q+   F   DD  ED+FVHQT+I  +      R++ +GE VEFAV  GE 
Sbjct: 7   STGTVKWFSGQKGFGFIAPDDGGEDLFVHQTSIRSD----GFRTLSEGETVEFAVDHGED 62

Query: 376 G-FEAAGVTGPGGEPVKG 426
           G  +A  VT   G    G
Sbjct: 63  GRTKAVEVTAVRGSYSSG 80


>UniRef50_O65639 Cluster: Glycine-rich protein; n=8;
           Magnoliophyta|Rep: Glycine-rich protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 299

 Score = 42.3 bits (95), Expect = 0.014
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD   ++FVHQ++I      +  RS+  G+AVEFA+  G  G  +A  VT PGG  
Sbjct: 26  FITPDDGSVELFVHQSSIVS----EGYRSLTVGDAVEFAITQGSDGKTKAVNVTAPGGGS 81

Query: 418 VK 423
           +K
Sbjct: 82  LK 83


>UniRef50_Q74BX3 Cluster: Cold shock domain family protein; n=13;
           cellular organisms|Rep: Cold shock domain family protein
           - Geobacter sulfurreducens
          Length = 66

 Score = 41.1 bits (92), Expect = 0.033
 Identities = 26/67 (38%), Positives = 38/67 (56%)
 Frame = +1

Query: 196 SIGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEK 375
           +IG  +     +   F +QD+  EDVFVH +AI ++      +S+ +GE V F VV G K
Sbjct: 2   AIGRVKWFNDAKGFGFIEQDNG-EDVFVHFSAIQQD----GFKSLAEGEQVSFDVVNGPK 56

Query: 376 GFEAAGV 396
           G +AA V
Sbjct: 57  GLQAANV 63


>UniRef50_Q4S6T5 Cluster: Chromosome 14 SCAF14723, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 14
           SCAF14723, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 206

 Score = 40.7 bits (91), Expect = 0.043
 Identities = 19/36 (52%), Positives = 22/36 (61%)
 Frame = +1

Query: 322 RSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 111 RSLKEGEQVEFTFKKSTKGLESLRVTGPGGGPCAGS 146


>UniRef50_Q016S2 Cluster: Putative nucleic acid binding protein;
           n=1; Ostreococcus tauri|Rep: Putative nucleic acid
           binding protein - Ostreococcus tauri
          Length = 125

 Score = 40.7 bits (91), Expect = 0.043
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 9/81 (11%)
 Frame = +1

Query: 253 DDTKEDVFVHQTAIARNNPRK--AVRSVGDGEAVEFAV---VAGEKGFEAAGVTGPGGEP 417
           DD + DVFVHQ+A+     R+    R    G++VEF V      ++  +A  VTG GG P
Sbjct: 30  DDGEPDVFVHQSALKMEGFRRTDGRRFATQGDSVEFDVEHESPTDERLKAVCVTGIGGAP 89

Query: 418 VKGSPYA----ADKRRGYHRQ 468
           +K  P      + K+RG  R+
Sbjct: 90  LKAPPRTNYRRSSKKRGPRRE 110


>UniRef50_Q013V8 Cluster: Glycogen debranching enzyme; n=1;
           Ostreococcus tauri|Rep: Glycogen debranching enzyme -
           Ostreococcus tauri
          Length = 141

 Score = 40.3 bits (90), Expect = 0.057
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKA--VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D  EDVFVHQ+ +  +  R    VR    G+ +EF +   E+   A  VTGP G P+K +
Sbjct: 60  DGSEDVFVHQSELQMDGFRSVWEVRLQQAGDEIEFELDDDERR-RAKNVTGPAGAPLKKT 118

Query: 430 P 432
           P
Sbjct: 119 P 119


>UniRef50_Q9VRN5 Cluster: Lin-28 homolog; n=1; Drosophila
           melanogaster|Rep: Lin-28 homolog - Drosophila
           melanogaster (Fruit fly)
          Length = 195

 Score = 39.9 bits (89), Expect = 0.076
 Identities = 25/79 (31%), Positives = 38/79 (48%)
 Frame = +1

Query: 199 IGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG 378
           +G C+     +   F   +D  ++VFVHQ+ I  +      RS+G+ E VEF      +G
Sbjct: 40  LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMS----GFRSLGEQEEVEFECQRTSRG 95

Query: 379 FEAAGVTGPGGEPVKGSPY 435
            EA  V+   G   +GS Y
Sbjct: 96  LEATRVSSRHGGSCQGSTY 114


>UniRef50_Q9ZBH4 Cluster: Putative DNA-binding protein; n=2;
           Actinomycetales|Rep: Putative DNA-binding protein -
           Streptomyces coelicolor
          Length = 162

 Score = 39.5 bits (88), Expect = 0.100
 Identities = 24/58 (41%), Positives = 34/58 (58%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGE 414
           F   +D  EDVF+H   +    P ++VRS   G  VEF V +GE+G +A+G+  P GE
Sbjct: 37  FIAPEDGGEDVFLHVNDLLI--PEESVRS---GLVVEFEVESGERGLKASGIRLPEGE 89


>UniRef50_A4VMZ2 Cluster: Cold shock protein CspA; n=12;
           Bacteria|Rep: Cold shock protein CspA - Pseudomonas
           stutzeri (strain A1501)
          Length = 136

 Score = 39.5 bits (88), Expect = 0.100
 Identities = 16/24 (66%), Positives = 19/24 (79%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+AE+ +GTVKWFN   GYGFI R
Sbjct: 67  VMAERETGTVKWFNDAKGYGFIQR 90



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +1

Query: 268 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTG 402
           DVFVH  AI  +  R    S+ +G+ VEF+V+ G+KG +A  V G
Sbjct: 95  DVFVHYRAIRGDGHR----SLAEGQQVEFSVIQGQKGLQAEDVAG 135


>UniRef50_Q38896 Cluster: Glycine-rich protein 2b; n=26; cellular
           organisms|Rep: Glycine-rich protein 2b - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 201

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 381
           G  +    Q+   F    D  +D+FVHQ++I      +  RS+   E+VEF V     G 
Sbjct: 17  GTVKWFDTQKGFGFITPSDGGDDLFVHQSSIR----SEGFRSLAAEESVEFDVEVDNSGR 72

Query: 382 -EAAGVTGPGGEPVKGS 429
            +A  V+GP G PV+G+
Sbjct: 73  PKAIEVSGPDGAPVQGN 89


>UniRef50_A5NZH6 Cluster: Putative cold-shock DNA-binding domain
           protein precursor; n=1; Methylobacterium sp. 4-46|Rep:
           Putative cold-shock DNA-binding domain protein precursor
           - Methylobacterium sp. 4-46
          Length = 242

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 20/48 (41%), Positives = 30/48 (62%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVT 399
           D  +DVFVH++A+A    R  + S+ +G+ V   VV G+KG EA  +T
Sbjct: 196 DGGKDVFVHRSALA----RAGLDSLAEGQQVTMGVVEGQKGREAQSIT 239


>UniRef50_P0A981 Cluster: Cold shock-like protein cspG; n=154;
           Bacteria|Rep: Cold shock-like protein cspG - Shigella
           flexneri
          Length = 70

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F   DD  +DVFVH TAI  N      R++ + + VEF++  G++G  AA V
Sbjct: 20  FITPDDGSKDVFVHFTAIQSNE----FRTLNENQKVEFSIEQGQRGPAAANV 67


>UniRef50_Q9ZFK9 Cluster: CspA; n=25; Bacteria|Rep: CspA -
           Myxococcus xanthus
          Length = 68

 Score = 37.1 bits (82), Expect = 0.53
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F  QDD   DVF H TAI  +      R++ +G+ VEF    G KG +A  V
Sbjct: 17  FIAQDDGGADVFCHHTAIQTD----GFRTLAEGQKVEFETRKGPKGLQAENV 64


>UniRef50_Q9ZFK8 Cluster: CspB; n=4; cellular organisms|Rep: CspB -
           Myxococcus xanthus
          Length = 66

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           D  EDVF H TAI  +      R++ +G+ VEF V  G KG +A  V
Sbjct: 21  DNGEDVFCHHTAINMD----GFRTLQEGQQVEFEVTRGPKGLQAQNV 63


>UniRef50_Q08VT0 Cluster: Conserved domain protein; n=2;
           Bacteria|Rep: Conserved domain protein - Stigmatella
           aurantiaca DW4/3-1
          Length = 100

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F  QD   EDVF H TAI  +      R++ +G+ V+F V  G KG +A  V
Sbjct: 50  FITQDGGGEDVFCHHTAINMD----GFRTLQEGQKVQFDVARGPKGLQAQNV 97


>UniRef50_A0YCJ0 Cluster: Cold-shock DNA-binding protein; n=1;
           marine gamma proteobacterium HTCC2143|Rep: Cold-shock
           DNA-binding protein - marine gamma proteobacterium
           HTCC2143
          Length = 144

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINRMTPRKMCLCIR 286
           GTVKWFNV  GYGF+ R +  ++ +  R
Sbjct: 79  GTVKWFNVSKGYGFVTRASGEEIFVHFR 106



 Score = 35.1 bits (77), Expect = 2.2
 Identities = 19/44 (43%), Positives = 30/44 (68%)
 Frame = +1

Query: 265 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           E++FVH  +I+ N  RK +R   +G+ +EF+VV G+KG +A  V
Sbjct: 99  EEIFVHFRSISGNG-RKVLR---EGQKIEFSVVDGDKGPQAEDV 138


>UniRef50_Q4UBG6 Cluster: Cold shock protein, putative; n=2;
           Theileria|Rep: Cold shock protein, putative - Theileria
           annulata
          Length = 95

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = +1

Query: 265 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           EDVFVHQ+ I  +      RS+ + E VE  V+      +A  VTGP G  V G+
Sbjct: 26  EDVFVHQSEIYADG----FRSLHENEKVELEVIMDNNRKKAIHVTGPNGTHVTGT 76


>UniRef50_P72366 Cluster: Cold shock-like protein cspA; n=29;
           Bacteria|Rep: Cold shock-like protein cspA - Stigmatella
           aurantiaca
          Length = 68

 Score = 36.7 bits (81), Expect = 0.70
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F  QD   EDVF H +AI  +      R++ +G+ VEF V  G KG +A  V
Sbjct: 17  FITQDGGGEDVFCHHSAINMD----GFRTLQEGQKVEFEVTRGPKGLQAQNV 64


>UniRef50_UPI00015BD510 Cluster: UPI00015BD510 related cluster; n=1;
           unknown|Rep: UPI00015BD510 UniRef100 entry - unknown
          Length = 86

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 381
           G  +   +++   F  +DD + DVFVH +AI  N  R+  +++  G+ VEF V    KG 
Sbjct: 20  GTVKWFSKEKGYGFLTRDDNQGDVFVHFSAIDPN--RQGFKTLVQGQRVEFEVDQDSKGP 77

Query: 382 EAAGV 396
            A  V
Sbjct: 78  RAKNV 82



 Score = 33.5 bits (73), Expect = 6.6
 Identities = 11/19 (57%), Positives = 16/19 (84%)
 Frame = +2

Query: 197 VSGTVKWFNVKSGYGFINR 253
           ++GTVKWF+ + GYGF+ R
Sbjct: 18  ITGTVKWFSKEKGYGFLTR 36


>UniRef50_Q4JMV8 Cluster: Predicted cold shock family protein; n=1;
           uncultured bacterium BAC17H8|Rep: Predicted cold shock
           family protein - uncultured bacterium BAC17H8
          Length = 83

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFIN 250
           GTVKWFN + GYGFIN
Sbjct: 18  GTVKWFNTQKGYGFIN 33


>UniRef50_Q2BKV8 Cluster: Cold-shock domain family protein; n=3;
           Bacteria|Rep: Cold-shock domain family protein -
           Neptuniibacter caesariensis
          Length = 149

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 191 EKVSGTVKWFNVKSGYGFINR 253
           ++  GTVKWFNV  G+GFI R
Sbjct: 81  DREQGTVKWFNVSKGFGFITR 101


>UniRef50_Q5JKD6 Cluster: Cold shock domain protein 2-like protein;
           n=3; Oryza sativa|Rep: Cold shock domain protein 2-like
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 221

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD  ED+F+HQ+++  +      RS+ D + +E +V + + G  +A  VT PG + 
Sbjct: 21  FITPDDGSEDLFIHQSSLKFD----GYRSLNDDDVIELSVGSSDDGRTKAVDVTAPGSDA 76

Query: 418 VKG 426
             G
Sbjct: 77  HTG 79


>UniRef50_Q8G880 Cluster: Cold shock protein; n=3;
           Bifidobacterium|Rep: Cold shock protein -
           Bifidobacterium longum
          Length = 79

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F Q DD  EDVFVH   I  +      + + +G+ VE+   +  KG +A  V
Sbjct: 17  FIQPDDGGEDVFVHYAEIKDDGSTNKFKMLYEGDRVEYTPASSGKGTQAKDV 68


>UniRef50_P92186 Cluster: Protein lin-28; n=5; Caenorhabditis|Rep:
           Protein lin-28 - Caenorhabditis elegans
          Length = 227

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV--AGEK 375
           G C+     +   F   D T ED+FVHQ+    N   +  RS+ +GE V + +   +  K
Sbjct: 55  GSCKWFNVSKGYGFVIDDITGEDLFVHQS----NLNMQGFRSLDEGERVSYYIQERSNGK 110

Query: 376 GFEAAGVTGP-GGEPVKGS 429
           G EA  V+G   G+ +KGS
Sbjct: 111 GREAYAVSGEVEGQGLKGS 129


>UniRef50_Q83RI9 Cluster: Cold shock-like protein cspC; n=38;
           Gammaproteobacteria|Rep: Cold shock-like protein cspC -
           Shigella flexneri
          Length = 69

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVT 399
           D  +DVFVH +AI  N     ++++ +G+ VEF +  G+KG  A  VT
Sbjct: 24  DGSKDVFVHFSAIQGNG----LKTLAEGQNVEFEIQDGQKGPAAVNVT 67


>UniRef50_A1CFX7 Cluster: Cold shock NA binding domain protein; n=2;
           cellular organisms|Rep: Cold shock NA binding domain
           protein - Aspergillus clavatus
          Length = 125

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 191 EKVSGTVKWFNVKSGYGFINRMT 259
           E+ +GTVKWFN + GYGFI   T
Sbjct: 58  ERQNGTVKWFNDEKGYGFITPET 80


>UniRef50_Q3Y013 Cluster: Cold-shock protein, DNA-binding; n=6;
           cellular organisms|Rep: Cold-shock protein, DNA-binding
           - Enterococcus faecium DO
          Length = 35

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 12/18 (66%), Positives = 16/18 (88%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFINR 253
           +GTVKWFN + G+GFI+R
Sbjct: 3   NGTVKWFNAEKGFGFISR 20


>UniRef50_Q1N1Z0 Cluster: Cold shock protein; n=14; Bacteria|Rep:
           Cold shock protein - Oceanobacter sp. RED65
          Length = 171

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINR 253
           G VKWFNVK G+GFI R
Sbjct: 108 GLVKWFNVKKGFGFITR 124


>UniRef50_A5ZS66 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 75

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFI 247
           ++E + GTVKWF+ + GYGFI
Sbjct: 1   MSETLQGTVKWFSAQKGYGFI 21


>UniRef50_A3YF52 Cluster: Cold-shock protein, DNA-binding; n=2;
           Marinomonas|Rep: Cold-shock protein, DNA-binding -
           Marinomonas sp. MED121
          Length = 79

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFINR 253
           + +K+ GTVKWFN   G GFI R
Sbjct: 1   MTDKLKGTVKWFNDSKGVGFIQR 23


>UniRef50_Q38CH1 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 334

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +2

Query: 260 PRKMC-LCIRLPSPVTTHVRLCARSATERRWSLPWL 364
           PR+ C +C RL +P   H R+C R    R    PW+
Sbjct: 114 PRRFCHICERLKAPREYHCRICGRCIARRDHHCPWI 149


>UniRef50_P0A363 Cluster: Cold shock-like protein cspB; n=367;
           root|Rep: Cold shock-like protein cspB - Yersinia
           enterocolitica
          Length = 70

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           D  +DVFVH +AI  N+     +++ +G+ VEF++  G+KG  A  V
Sbjct: 25  DGSKDVFVHFSAIQGND----YKTLDEGQNVEFSIEQGQKGPSAVNV 67


>UniRef50_Q9S1B7 Cluster: Cold shock-like protein cspA; n=10;
           Bacteria|Rep: Cold shock-like protein cspA - Shewanella
           violacea
          Length = 70

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F  QD+   DVFVH  AIA     +  +++ +G+ V F V  G KG +A+ V
Sbjct: 20  FLTQDNGGADVFVHFRAIA----SEGFKTLDEGQKVTFEVEQGPKGLQASNV 67


>UniRef50_Q60AQ4 Cluster: Cold shock protein; n=27; Bacteria|Rep:
           Cold shock protein - Methylococcus capsulatus
          Length = 69

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFINR 253
           ++++  GTVKWFN   G+GFI R
Sbjct: 1   MSQQQQGTVKWFNESKGFGFIQR 23


>UniRef50_Q2RQP4 Cluster: Cold-shock DNA-binding domain protein;
           n=1; Rhodospirillum rubrum ATCC 11170|Rep: Cold-shock
           DNA-binding domain protein - Rhodospirillum rubrum
           (strain ATCC 11170 / NCIB 8255)
          Length = 70

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 12/16 (75%), Positives = 15/16 (93%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFI 247
           +GTVKWFNV+ G+GFI
Sbjct: 3   TGTVKWFNVQKGFGFI 18


>UniRef50_P39158 Cluster: Cold shock protein cspC; n=41;
           Bacteria|Rep: Cold shock protein cspC - Bacillus
           subtilis
          Length = 66

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 12/17 (70%), Positives = 14/17 (82%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINR 253
           GTVKWFN + G+GFI R
Sbjct: 4   GTVKWFNAEKGFGFIER 20


>UniRef50_P72188 Cluster: Cold shock protein capA; n=23;
           Proteobacteria|Rep: Cold shock protein capA -
           Pseudomonas fragi
          Length = 64

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 12/21 (57%), Positives = 18/21 (85%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFI 247
           ++++ SGTVKWFN + G+GFI
Sbjct: 1   MSQRQSGTVKWFNDEKGFGFI 21


>UniRef50_Q2J4H7 Cluster: Cold-shock DNA-binding domain protein;
           n=13; Bacteria|Rep: Cold-shock DNA-binding domain
           protein - Frankia sp. (strain CcI3)
          Length = 67

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           F   D    DVFVH ++I  +      +S+ +G++V+F +V G+KG +A  V
Sbjct: 17  FISVDGGGPDVFVHYSSIVADG----YKSLDEGQSVQFEIVQGQKGPQADNV 64


>UniRef50_A5ZXC4 Cluster: Putative uncharacterized protein; n=2;
           cellular organisms|Rep: Putative uncharacterized protein
           - Ruminococcus obeum ATCC 29174
          Length = 66

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFI 247
           GTVKWFN + GYGFI
Sbjct: 4   GTVKWFNAEKGYGFI 18


>UniRef50_A3Y9L0 Cluster: Cold-shock DNA-binding domain protein;
           n=2; Marinomonas|Rep: Cold-shock DNA-binding domain
           protein - Marinomonas sp. MED121
          Length = 97

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 197 VSGTVKWFNVKSGYGFINR 253
           VSG VKWFN + G+GFI R
Sbjct: 33  VSGIVKWFNDEKGFGFIER 51


>UniRef50_Q53VE0 Cluster: Ser/Thr protein kinase; n=3;
           Papilionoideae|Rep: Ser/Thr protein kinase - Lotus
           japonicus
          Length = 691

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = -1

Query: 677 TLLYSLGQ-DXPHGVHRENCDGKNALRWY--NASFLTLISLCTPLV 549
           TLLY+ G  D P G +R +CDG + + +Y      L+  S CT +V
Sbjct: 156 TLLYNCGSIDPPSGFYRSSCDGGSRVVYYIVGVGPLSFASACTSVV 201


>UniRef50_Q6FAY9 Cluster: Cold shock-like protein; n=44;
           Bacteria|Rep: Cold shock-like protein - Acinetobacter
           sp. (strain ADP1)
          Length = 69

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFINR 253
           ++  V+GTVKWFN   G+GFI +
Sbjct: 1   MSNSVNGTVKWFNEVKGFGFIQQ 23


>UniRef50_Q8GI47 Cluster: Cold shock protein homolog; n=5;
           Deinococci|Rep: Cold shock protein homolog - Thermus
           thermophilus
          Length = 73

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINR 253
           G VKWFN + GYGFI R
Sbjct: 4   GRVKWFNAEKGYGFIER 20


>UniRef50_Q7D268 Cluster: AGR_C_161p; n=7; Proteobacteria|Rep:
           AGR_C_161p - Agrobacterium tumefaciens (strain C58 /
           ATCC 33970)
          Length = 163

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 12/16 (75%), Positives = 13/16 (81%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFI 247
           +GTVKWFN   GYGFI
Sbjct: 97  TGTVKWFNATKGYGFI 112


>UniRef50_Q1ZKE8 Cluster: Cold shock protein; n=3;
           Gammaproteobacteria|Rep: Cold shock protein - Vibrio
           angustum S14
          Length = 68

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = +2

Query: 194 KVSGTVKWFNVKSGYGFIN 250
           K++GTVKWFN   G+GFI+
Sbjct: 3   KLTGTVKWFNDDKGFGFIS 21


>UniRef50_Q0BPU3 Cluster: Cold shock protein; n=1; Granulibacter
           bethesdensis CGDNIH1|Rep: Cold shock protein -
           Granulobacter bethesdensis (strain ATCC BAA-1260 /
           CGDNIH1)
          Length = 100

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 14/22 (63%), Positives = 14/22 (63%)
 Frame = +2

Query: 203 GTVKWFNVKSGYGFINRMTPRK 268
           GTVKWFN   GYGFI   T  K
Sbjct: 35  GTVKWFNPTKGYGFIAPSTGEK 56


>UniRef50_A6C5W3 Cluster: Putative uncharacterized protein; n=1;
           Planctomyces maris DSM 8797|Rep: Putative
           uncharacterized protein - Planctomyces maris DSM 8797
          Length = 848

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 562 HKEMRVKKEALYHLSAFFPSQFSRWTPWGXSWPNE 666
           HKE+++  +A   L     + F RW  WG  WP E
Sbjct: 102 HKELKMPPDADEKLKPETITHFKRWIEWGAPWPAE 136


>UniRef50_A4BC11 Cluster: Cold shock protein; n=1; Reinekea sp.
           MED297|Rep: Cold shock protein - Reinekea sp. MED297
          Length = 153

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +2

Query: 191 EKVSGTVKWFNVKSGYGFINR 253
           ++  G VKWFNV  G+GF+ R
Sbjct: 84  DREEGLVKWFNVSKGFGFVTR 104


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 643,871,630
Number of Sequences: 1657284
Number of extensions: 10424080
Number of successful extensions: 34772
Number of sequences better than 10.0: 87
Number of HSP's better than 10.0 without gapping: 33326
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34743
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71324098314
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -