SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9GP16 Cluster: 60S ribosomal protein L31; n=27; Coelom...   141   6e-33
UniRef50_P62899 Cluster: 60S ribosomal protein L31; n=48; Metazo...   120   2e-26
UniRef50_Q9GN74 Cluster: 60S ribosomal protein L31; n=20; Coelom...   110   2e-23
UniRef50_Q9V597 Cluster: 60S ribosomal protein L31; n=173; Eukar...   109   2e-23
UniRef50_UPI00005A08CD Cluster: PREDICTED: similar to ribosomal ...    99   4e-20
UniRef50_Q4PI65 Cluster: Putative uncharacterized protein; n=1; ...    94   1e-18
UniRef50_P51420 Cluster: 60S ribosomal protein L31-3; n=12; Euka...    92   5e-18
UniRef50_UPI0000DA1BEE Cluster: PREDICTED: similar to ribosomal ...    88   1e-16
UniRef50_UPI0001505641 Cluster: 60S ribosomal protein L31 (RPL31...    85   5e-16
UniRef50_UPI0000D9FB71 Cluster: PREDICTED: similar to ribosomal ...    75   6e-13
UniRef50_Q6Y207 Cluster: Ribosomal protein L31; n=9; Euteleostom...    73   4e-12
UniRef50_UPI00005A10F5 Cluster: PREDICTED: similar to ribosomal ...    70   3e-11
UniRef50_Q22DH9 Cluster: 60S ribosomal protein L31, putative; n=...    67   2e-10
UniRef50_Q06740 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_UPI000049A444 Cluster: 60S ribosomal protein L31; n=2; ...    58   7e-08
UniRef50_Q7RSL1 Cluster: Ribosomal protein L31e, putative; n=7; ...    58   1e-07
UniRef50_UPI00005A550D Cluster: PREDICTED: similar to ribosomal ...    48   1e-04
UniRef50_Q1X7K2 Cluster: Ribosomal protein L31; n=7; Trypanosoma...    45   0.001
UniRef50_A0CQV2 Cluster: Chromosome undetermined scaffold_24, wh...    44   0.002
UniRef50_Q98RR6 Cluster: 60S ribosomal protein L31; n=1; Guillar...    43   0.003
UniRef50_A2X8Z3 Cluster: Putative uncharacterized protein; n=1; ...    40   0.020
UniRef50_Q7QSE2 Cluster: GLP_426_16236_15916; n=1; Giardia lambl...    39   0.047
UniRef50_P54009 Cluster: 50S ribosomal protein L31e; n=7; Euryar...    39   0.047
UniRef50_Q8U3S7 Cluster: 50S ribosomal protein L31e; n=5; Thermo...    35   1.0  
UniRef50_A2EKX9 Cluster: Ribosomal protein L31e, putative; n=6; ...    33   3.1  
UniRef50_Q74MC9 Cluster: NEQ364; n=1; Nanoarchaeum equitans|Rep:...    33   3.1  
UniRef50_Q820F4 Cluster: Holliday junction ATP-dependent DNA hel...    33   3.1  
UniRef50_UPI00015BAD97 Cluster: LSU ribosomal protein L31E; n=1;...    33   4.1  
UniRef50_Q8PYQ4 Cluster: 50S ribosomal protein L31e; n=11; Eurya...    33   4.1  
UniRef50_A0RW54 Cluster: Ribosomal protein L31E; n=2; Thermoprot...    32   5.4  
UniRef50_Q9YD25 Cluster: 50S ribosomal protein L31e; n=1; Aeropy...    32   7.1  

>UniRef50_Q9GP16 Cluster: 60S ribosomal protein L31; n=27;
           Coelomata|Rep: 60S ribosomal protein L31 - Heliothis
           virescens (Noctuid moth) (Owlet moth)
          Length = 124

 Score =  141 bits (342), Expect = 6e-33
 Identities = 66/67 (98%), Positives = 67/67 (100%)
 Frame = +2

Query: 53  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD+R
Sbjct: 1   MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDVR 60

Query: 233 VDTRLNK 253
           VDTRLNK
Sbjct: 61  VDTRLNK 67



 Score = 97.9 bits (233), Expect = 1e-19
 Identities = 47/60 (78%), Positives = 48/60 (80%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 423
           L + LWSKGVRNVPF          NDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE
Sbjct: 65  LNKFLWSKGVRNVPFRVRVRLSRRRNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 124


>UniRef50_P62899 Cluster: 60S ribosomal protein L31; n=48;
           Metazoa|Rep: 60S ribosomal protein L31 - Homo sapiens
           (Human)
          Length = 125

 Score =  120 bits (288), Expect = 2e-26
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 5e-11
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>UniRef50_Q9GN74 Cluster: 60S ribosomal protein L31; n=20;
           Coelomata|Rep: 60S ribosomal protein L31 - Aedes aegypti
           (Yellowfever mosquito)
          Length = 124

 Score =  110 bits (264), Expect = 2e-23
 Identities = 50/68 (73%), Positives = 61/68 (89%)
 Frame = +2

Query: 53  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           MAK K E+K KSAINEVVTRE T+NL++RLH VG+KKRAPRA+K +RKFAEK+MGT D+R
Sbjct: 1   MAKTKTEKKAKSAINEVVTRECTINLNRRLHKVGYKKRAPRAVKIVRKFAEKEMGTNDVR 60

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 61  IDTRLNKA 68



 Score = 71.7 bits (168), Expect = 7e-12
 Identities = 31/60 (51%), Positives = 43/60 (71%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 423
           L + LW +G+RN PF          NDDEDS +KL+TLVTYVPV++ K LQTENV+++++
Sbjct: 65  LNKALWHRGIRNPPFRIRVRLSRRRNDDEDSPNKLYTLVTYVPVSTFKELQTENVESTED 124


>UniRef50_Q9V597 Cluster: 60S ribosomal protein L31; n=173;
           Eukaryota|Rep: 60S ribosomal protein L31 - Drosophila
           melanogaster (Fruit fly)
          Length = 124

 Score =  109 bits (263), Expect = 2e-23
 Identities = 50/67 (74%), Positives = 59/67 (88%)
 Frame = +2

Query: 53  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 233 VDTRLNK 253
           +DTRLNK
Sbjct: 61  IDTRLNK 67



 Score = 71.3 bits (167), Expect = 9e-12
 Identities = 31/60 (51%), Positives = 42/60 (70%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 423
           L + +WSKG+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 65  LNKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>UniRef50_UPI00005A08CD Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L31 - Canis familiaris
          Length = 130

 Score = 99.1 bits (236), Expect = 4e-20
 Identities = 41/50 (82%), Positives = 49/50 (98%)
 Frame = +2

Query: 107 TREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKS 256
           TREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R+DTRLNK+
Sbjct: 60  TREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKA 109


>UniRef50_Q4PI65 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 175

 Score = 94.3 bits (224), Expect = 1e-18
 Identities = 44/76 (57%), Positives = 57/76 (75%)
 Frame = +2

Query: 59  KPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 238
           K +  +K +SA+N+VVTREYTVNLHKR+H V FKKRAPRAIKE+  FA+K MGT D+R+D
Sbjct: 55  KSQKGKKTRSALNDVVTREYTVNLHKRVHDVAFKKRAPRAIKEVVAFAQKAMGTKDVRLD 114

Query: 239 TRLNKSFGLRESEMFP 286
            +LN+       + FP
Sbjct: 115 PKLNQEVWKYGVKNFP 130



 Score = 38.7 bits (86), Expect = 0.062
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFT-LVTYVPVASIKGLQTENVD 411
           L Q +W  GV+N P           NDDE +  KL+T  V  + + + KGLQT  +D
Sbjct: 117 LNQEVWKYGVKNFPRRLRVRLERKRNDDEGAKEKLYTYAVPVLGLGTAKGLQTTVID 173


>UniRef50_P51420 Cluster: 60S ribosomal protein L31-3; n=12;
           Eukaryota|Rep: 60S ribosomal protein L31-3 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 119

 Score = 92.3 bits (219), Expect = 5e-18
 Identities = 42/61 (68%), Positives = 51/61 (83%)
 Frame = +2

Query: 71  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60

Query: 251 K 253
           K
Sbjct: 61  K 61



 Score = 44.8 bits (101), Expect = 0.001
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  PK+ +   K   K  G         L + +WSKG+R  P           NDD
Sbjct: 27  CTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD 86

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVD 411
           ED+  + F+LVT   +P   + GL T+ ++
Sbjct: 87  EDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>UniRef50_UPI0000DA1BEE Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to ribosomal protein L31 - Rattus norvegicus
          Length = 163

 Score = 87.8 bits (208), Expect = 1e-16
 Identities = 43/68 (63%), Positives = 52/68 (76%)
 Frame = +2

Query: 56  AKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 235
           AK  G++KG SAINE+VTREYT+N+HKR+H VGFK  AP A+KEI KFA K MGTP+  +
Sbjct: 4   AKKGGKKKGHSAINEMVTREYTINIHKRIHEVGFKMHAPWALKEIWKFAIKAMGTPEFVI 63

Query: 236 DTRLNKSF 259
            T LN  F
Sbjct: 64  CT-LNSLF 70


>UniRef50_UPI0001505641 Cluster: 60S ribosomal protein L31 (RPL31C);
           n=1; Arabidopsis thaliana|Rep: 60S ribosomal protein L31
           (RPL31C) - Arabidopsis thaliana
          Length = 85

 Score = 85.4 bits (202), Expect = 5e-16
 Identities = 39/56 (69%), Positives = 47/56 (83%)
 Frame = +2

Query: 71  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 238
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVD 56


>UniRef50_UPI0000D9FB71 Cluster: PREDICTED: similar to ribosomal
           protein L31, partial; n=1; Macaca mulatta|Rep:
           PREDICTED: similar to ribosomal protein L31, partial -
           Macaca mulatta
          Length = 129

 Score = 75.4 bits (177), Expect = 6e-13
 Identities = 38/77 (49%), Positives = 53/77 (68%)
 Frame = +2

Query: 104 VTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESEMF 283
           VTR YT N+ K + GVGFKKR P+A+KEI+KFA K+M T D+R+DTR NK+   + +   
Sbjct: 25  VTRGYTSNIQKHIRGVGFKKRGPQALKEIQKFAMKEMRTLDVRLDTRQNKAVWNKGTSNV 84

Query: 284 PSVSV*GFHEDVMMMKI 334
             V + GF E++M + I
Sbjct: 85  SWVPICGF-ENMMKLNI 100



 Score = 35.1 bits (77), Expect = 0.76
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = +1

Query: 256 LWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGL 393
           +W+KG  NV +          N  + + HKL+TL+TYVPV + K L
Sbjct: 76  VWNKGTSNVSWVPICGFE---NMMKLNIHKLYTLITYVPVTTFKNL 118


>UniRef50_Q6Y207 Cluster: Ribosomal protein L31; n=9;
           Euteleostomi|Rep: Ribosomal protein L31 - Pagrus major
           (Red sea bream) (Chrysophrys major)
          Length = 91

 Score = 72.5 bits (170), Expect = 4e-12
 Identities = 33/56 (58%), Positives = 40/56 (71%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +WSKGVRNVP+          N+DEDS +KL+TLVTYVPV + KGLQT NVD
Sbjct: 34  LNKAVWSKGVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTCKGLQTVNVD 89



 Score = 44.4 bits (100), Expect = 0.001
 Identities = 19/27 (70%), Positives = 23/27 (85%)
 Frame = +2

Query: 176 AIKEIRKFAEKQMGTPDIRVDTRLNKS 256
           A   IRKFA K+MGTPD+R+DTRLNK+
Sbjct: 11  APSRIRKFAVKEMGTPDVRMDTRLNKA 37


>UniRef50_UPI00005A10F5 Cluster: PREDICTED: similar to ribosomal
           protein L31; n=2; Eutheria|Rep: PREDICTED: similar to
           ribosomal protein L31 - Canis familiaris
          Length = 175

 Score = 69.7 bits (163), Expect = 3e-11
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV ++K LQT NVD
Sbjct: 118 LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTLKNLQTVNVD 173



 Score = 52.4 bits (120), Expect = 5e-06
 Identities = 21/33 (63%), Positives = 29/33 (87%)
 Frame = +2

Query: 158 KKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKS 256
           +K   RA+K+IRKFA K++GTPD+R+DTRLNK+
Sbjct: 89  RKERRRALKDIRKFAMKELGTPDVRIDTRLNKA 121


>UniRef50_Q22DH9 Cluster: 60S ribosomal protein L31, putative; n=1;
           Tetrahymena thermophila SB210|Rep: 60S ribosomal protein
           L31, putative - Tetrahymena thermophila SB210
          Length = 111

 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 29/45 (64%), Positives = 36/45 (80%)
 Frame = +2

Query: 119 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 253
           TVNLHK+ H + FKK+APRAI+EI   A+K MGT D+R+DT LNK
Sbjct: 12  TVNLHKQCHKISFKKKAPRAIREIVAIAKKTMGTDDVRIDTELNK 56



 Score = 44.8 bits (101), Expect = 0.001
 Identities = 24/85 (28%), Positives = 39/85 (45%)
 Frame = +1

Query: 160 KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDDEDSA 339
           K  P++ +    +  KT G         L + +WS G+RN+P           N++E + 
Sbjct: 26  KKAPRAIREIVAIAKKTMGTDDVRIDTELNKFIWSNGIRNIPRRVRVRLCKRKNEEEGAQ 85

Query: 340 HKLFTLVTYVPVASIKGLQTENVDA 414
            + +TLV ++ V S  GL TE   A
Sbjct: 86  SQFYTLVQHLQVDSYHGLLTEKTKA 110


>UniRef50_Q06740 Cluster: Putative uncharacterized protein; n=1;
           Saccharomyces cerevisiae|Rep: Putative uncharacterized
           protein - Saccharomyces cerevisiae (Baker's yeast)
          Length = 77

 Score = 59.7 bits (138), Expect = 3e-08
 Identities = 31/50 (62%), Positives = 34/50 (68%)
 Frame = -1

Query: 249 FKRVSTRMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTT 100
           F   + R S VP+C  ANF ISL ALGA FL  TP + LCKL VYSRVTT
Sbjct: 28  FNSGARRTSSVPMCNLANFLISLTALGALFLKETPCNLLCKLMVYSRVTT 77


>UniRef50_UPI000049A444 Cluster: 60S ribosomal protein L31; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L31 - Entamoeba histolytica HM-1:IMSS
          Length = 150

 Score = 58.4 bits (135), Expect = 7e-08
 Identities = 32/70 (45%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  KITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP 223
           K+   KP  E K K      +TRE T+++HK LH   FKKRAP+AIK IR  A K M T 
Sbjct: 28  KVGNKKPSKEIKAKEMAP--ITREMTIHMHKYLHKESFKKRAPKAIKIIRFLAIKTMKTH 85

Query: 224 DIRVDTRLNK 253
           +++ D  LN+
Sbjct: 86  NVKFDMGLNQ 95



 Score = 46.0 bits (104), Expect = 4e-04
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420
           L Q +WS+G+R+V             + E+   K +TLV+YVPVAS KGL T+ V+ ++
Sbjct: 93  LNQFIWSQGIRSVADRIRVRMARLPMEGEEG--KFYTLVSYVPVASFKGLVTKTVEETE 149


>UniRef50_Q7RSL1 Cluster: Ribosomal protein L31e, putative; n=7;
           Apicomplexa|Rep: Ribosomal protein L31e, putative -
           Plasmodium yoelii yoelii
          Length = 142

 Score = 57.6 bits (133), Expect = 1e-07
 Identities = 26/49 (53%), Positives = 35/49 (71%)
 Frame = +2

Query: 107 TREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 253
           T+  T+NL K  H V +K++APRAIKEI+  A K M T D+R+D +LNK
Sbjct: 39  TKVITINLSKLTHDVCYKRKAPRAIKEIKNIAGKLMHTKDVRLDVKLNK 87



 Score = 49.6 bits (113), Expect = 3e-05
 Identities = 23/53 (43%), Positives = 31/53 (58%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 402
           L + +WSKG+RN P           N+DEDS  +++TLV +V V S KGL  E
Sbjct: 85  LNKFIWSKGIRNPPKRVRVKIERVRNEDEDSKERMYTLVQHVMVDSYKGLVNE 137


>UniRef50_UPI00005A550D Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L31 - Canis familiaris
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 19/35 (54%), Positives = 26/35 (74%)
 Frame = +2

Query: 152 GFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKS 256
           GF++  P  +KEIRKFA K+MGTPD+ +D   NK+
Sbjct: 49  GFREACPSGLKEIRKFAMKEMGTPDVHMDPGFNKA 83



 Score = 36.3 bits (80), Expect = 0.33
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +1

Query: 160 KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRN-VPFXXXXXXXXXXNDDEDS 336
           +ACP   +   K   K  G           + + ++G+RN VP            +DEDS
Sbjct: 52  EACPSGLKEIRKFAMKEMGTPDVHMDPGFNKAVQAEGIRNNVPHRIPVRLSRKCKEDEDS 111

Query: 337 AHKLFTLVTYVPVAS 381
            +KL+ LVT VPV +
Sbjct: 112 PNKLYRLVTCVPVTT 126


>UniRef50_Q1X7K2 Cluster: Ribosomal protein L31; n=7;
           Trypanosomatidae|Rep: Ribosomal protein L31 - Leishmania
           major
          Length = 188

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +2

Query: 98  EVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           + V+ E T++L K L    F KRAP AIK I+ F  + M T D R+D  LN
Sbjct: 82  DAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLN 132



 Score = 43.2 bits (97), Expect = 0.003
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 241 SLKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLF-TLVTYVPVASIKGLQTENVD 411
           SL   +W KGV+ VP              E + HK F T+++ VPVAS KGL T+ V+
Sbjct: 130 SLNTYIWHKGVKGVPGRVRVLIQRKSETTEGNKHKHFYTVISNVPVASFKGLTTKTVE 187


>UniRef50_A0CQV2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=9; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_24,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 372

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 241 SLKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 402
           SL + +W++G+RN+P            +++D   K +TL  +VPV +  GL+TE
Sbjct: 314 SLNEAVWARGIRNLPRRIRVRLQRKKKEEDDGKGKYYTLAQHVPVDTFDGLKTE 367


>UniRef50_Q98RR6 Cluster: 60S ribosomal protein L31; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L31 - Guillardia theta
           (Cryptomonas phi)
          Length = 97

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +2

Query: 125 NLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           N+HKR+ G  F KR   AIKEI+KFA K     +IR++  LN
Sbjct: 15  NIHKRVFGKKFNKRVSIAIKEIKKFAWKLTKCNNIRIEPELN 56


>UniRef50_A2X8Z3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 93

 Score = 40.3 bits (90), Expect = 0.020
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 95  NEVVTREYTVNLHKRLHG 148
           +EVVTREYT+NLHKRLHG
Sbjct: 13  DEVVTREYTINLHKRLHG 30


>UniRef50_Q7QSE2 Cluster: GLP_426_16236_15916; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_426_16236_15916 - Giardia lamblia
           ATCC 50803
          Length = 106

 Score = 39.1 bits (87), Expect = 0.047
 Identities = 19/49 (38%), Positives = 28/49 (57%)
 Frame = +2

Query: 104 VTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           +  E+T+ L+K + G   KK AP AI+ IR   EK     D+R+D  +N
Sbjct: 3   IVYEHTIRLNKAVRGKPSKKAAPIAIRAIRAQVEKLAKVEDVRLDPSVN 51


>UniRef50_P54009 Cluster: 50S ribosomal protein L31e; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L31e -
           Methanococcus jannaschii
          Length = 87

 Score = 39.1 bits (87), Expect = 0.047
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +2

Query: 110 REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESEMFPS 289
           R YT+ L   ++     KRAPRAIK+I++F ++ M    +++D  LN+    R  +  P+
Sbjct: 9   RIYTIPLRDVINKSVRTKRAPRAIKKIKQFLKRHMKAEIVKIDNELNEKIWERGIQKPPA 68


>UniRef50_Q8U3S7 Cluster: 50S ribosomal protein L31e; n=5;
           Thermococcaceae|Rep: 50S ribosomal protein L31e -
           Pyrococcus furiosus
          Length = 95

 Score = 34.7 bits (76), Expect = 1.0
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +2

Query: 116 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESEMFPS 289
           +TV + K    V   KRAPRA+K +R+F  +     ++ +D ++N+    R  E  PS
Sbjct: 11  FTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPKVNEKIWERGIEKPPS 68


>UniRef50_A2EKX9 Cluster: Ribosomal protein L31e, putative; n=6;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L31e,
           putative - Trichomonas vaginalis G3
          Length = 133

 Score = 33.1 bits (72), Expect = 3.1
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +1

Query: 325 DEDSAHKLFTLVTYVPVASIKGLQTENV 408
           DE+ A K+ T+ +Y  VAS  GLQT+ V
Sbjct: 103 DEEDAEKMVTIASYKNVASFNGLQTQKV 130


>UniRef50_Q74MC9 Cluster: NEQ364; n=1; Nanoarchaeum equitans|Rep:
           NEQ364 - Nanoarchaeum equitans
          Length = 79

 Score = 33.1 bits (72), Expect = 3.1
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = +2

Query: 113 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 253
           EYTVNL K +      KR  +A+K +++F  +      +++   LNK
Sbjct: 2   EYTVNLRKAVLVTSRFKRTKKAVKALKEFVMRHTKAKIVKISQELNK 48


>UniRef50_Q820F4 Cluster: Holliday junction ATP-dependent DNA
           helicase ruvA; n=6; Actinomycetales|Rep: Holliday
           junction ATP-dependent DNA helicase ruvA - Streptomyces
           avermitilis
          Length = 203

 Score = 33.1 bits (72), Expect = 3.1
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +2

Query: 38  KLKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR-APRAIKEIRKFAEKQM 214
           +LK  + +P G   G  AI   VT  +   LH  L G+G+  R A  A+  +   AE   
Sbjct: 126 ELKDRLGEPLGT--GGPAIGRAVTTGWREQLHAALIGLGYATREADEAVAAVAPQAEAAG 183

Query: 215 GTPDI 229
           GTP +
Sbjct: 184 GTPQV 188


>UniRef50_UPI00015BAD97 Cluster: LSU ribosomal protein L31E; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L31E - Ignicoccus hospitalis KIN4/I
          Length = 101

 Score = 32.7 bits (71), Expect = 4.1
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +2

Query: 116 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGT--PDIRVDTRLN 250
           YT+NL +RL+      RA RA++ +R+F  +  G    D+++D  +N
Sbjct: 10  YTINL-RRLYWGRRSNRAKRAVRMVREFVARHFGVEPEDVKIDNTVN 55


>UniRef50_Q8PYQ4 Cluster: 50S ribosomal protein L31e; n=11;
           Euryarchaeota|Rep: 50S ribosomal protein L31e -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 93

 Score = 32.7 bits (71), Expect = 4.1
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +2

Query: 80  GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGT--PDIRVDTRLNK 253
           GK A + V  + YT+ L + +  V   KRA RA+KE+R F  + M T    +++D  +N+
Sbjct: 3   GKMADDMVKEQIYTIPL-REVRKVPAWKRAGRAVKEVRGFLVRHMKTEAEQVKLDKTINE 61


>UniRef50_A0RW54 Cluster: Ribosomal protein L31E; n=2;
           Thermoprotei|Rep: Ribosomal protein L31E - Cenarchaeum
           symbiosum
          Length = 217

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +2

Query: 110 REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLR 268
           R YT+ L K L      +RA RAI  I++FA   M   +IR+D  ++    LR
Sbjct: 7   RVYTIPLGKVLLSPD-NRRAMRAINMIKEFATHHMKNANIRIDEEVSHQIWLR 58


>UniRef50_Q9YD25 Cluster: 50S ribosomal protein L31e; n=1; Aeropyrum
           pernix|Rep: 50S ribosomal protein L31e - Aeropyrum
           pernix
          Length = 104

 Score = 31.9 bits (69), Expect = 7.1
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +2

Query: 116 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESEMFPS 289
           Y VNL +R++     +RA RA++ +R+F  +     ++ +D  LN     R  E  P+
Sbjct: 9   YVVNL-RRVYWGRRTRRAIRAVRMVREFVRRHTKADEVVIDNELNNYIWSRSREKPPA 65


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 402,865,557
Number of Sequences: 1657284
Number of extensions: 7105391
Number of successful extensions: 14286
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 14018
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14282
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 25191138900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -