SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5QBM3 Cluster: O-phosphoserine phosphatase; n=1; Culic...   120   5e-26
UniRef50_Q17M50 Cluster: Phosphoserine phosphatase; n=6; Endopte...   119   1e-25
UniRef50_P78330 Cluster: Phosphoserine phosphatase; n=19; Coelom...   112   1e-23
UniRef50_Q4REM8 Cluster: Chromosome 10 SCAF15123, whole genome s...   109   7e-23
UniRef50_Q0IHZ7 Cluster: Psph protein; n=12; Eumetazoa|Rep: Psph...   109   7e-23
UniRef50_Q9VSY6 Cluster: Phosphoserine phosphatase; n=3; Sophoph...   106   7e-22
UniRef50_O82796 Cluster: Phosphoserine phosphatase, chloroplast ...   104   3e-21
UniRef50_Q26545 Cluster: Phosphoserine phosphohydrolase-like pro...    91   3e-17
UniRef50_Q0MYU8 Cluster: Putative phosphoserine phosphatase serb...    79   1e-13
UniRef50_UPI0000E214DD Cluster: PREDICTED: hypothetical protein;...    71   5e-11
UniRef50_UPI0000E0E125 Cluster: Phosphoserine phosphatase; n=1; ...    64   3e-09
UniRef50_A5FJ80 Cluster: Phosphoserine phosphatase SerB; n=2; Ba...    64   3e-09
UniRef50_A4FYT5 Cluster: Phosphoserine phosphatase SerB; n=4; Me...    64   3e-09
UniRef50_Q7MWG4 Cluster: Phosphoserine phosphatase; n=33; Bacter...    63   1e-08
UniRef50_Q52ZA0 Cluster: Glycerol-3-phosphate dehydrogenase; n=3...    62   1e-08
UniRef50_A0Z8F6 Cluster: Phosphoserine phosphatase; n=1; marine ...    62   2e-08
UniRef50_Q47EM3 Cluster: Phosphoserine phosphatase SerB:HAD-supe...    61   3e-08
UniRef50_Q04RT1 Cluster: Phosphoserine phosphatase; n=4; Leptosp...    61   3e-08
UniRef50_O28142 Cluster: Phosphoserine phosphatase; n=2; Euryarc...    61   3e-08
UniRef50_Q58989 Cluster: Phosphoserine phosphatase; n=3; Euryarc...    60   7e-08
UniRef50_A3UEM1 Cluster: Putative uncharacterized protein; n=1; ...    60   1e-07
UniRef50_Q62JZ6 Cluster: Phosphoserine phosphatase; n=42; Proteo...    59   1e-07
UniRef50_A3VNP9 Cluster: Phosphoserine phosphatase; n=1; Parvula...    59   2e-07
UniRef50_Q75CP9 Cluster: ACL130Cp; n=2; Saccharomycetales|Rep: A...    59   2e-07
UniRef50_A1D856 Cluster: Phosphoserine phosphatase; n=8; Pezizom...    58   2e-07
UniRef50_P0AGB2 Cluster: Phosphoserine phosphatase; n=44; Gammap...    58   2e-07
UniRef50_O74382 Cluster: Probable phosphoserine phosphatase; n=1...    58   3e-07
UniRef50_A4A8Q7 Cluster: Phosphoserine phosphatase; n=1; Congreg...    57   7e-07
UniRef50_Q5LN59 Cluster: Phosphoserine phosphatase; n=42; Alphap...    56   9e-07
UniRef50_Q6M2V2 Cluster: Phosphoserine Phosphatase; n=30; Actino...    56   9e-07
UniRef50_Q3VJT9 Cluster: Phosphoserine phosphatase SerB:HAD-supe...    56   9e-07
UniRef50_Q1JVE4 Cluster: Phosphoserine phosphatase SerB; n=2; De...    56   1e-06
UniRef50_Q15WD4 Cluster: Phosphoserine phosphatase SerB; n=1; Ps...    56   1e-06
UniRef50_Q9KPM2 Cluster: Phosphoserine phosphatase; n=30; Vibrio...    56   2e-06
UniRef50_Q83AZ5 Cluster: L-3-phosphoserine phosphatase; n=4; Cox...    56   2e-06
UniRef50_A6F6B2 Cluster: Phosphoserine phosphatase; n=1; Moritel...    55   3e-06
UniRef50_Q1QUG9 Cluster: Phosphoserine phosphatase SerB; n=1; Ch...    54   4e-06
UniRef50_Q031D3 Cluster: Phosphoserine phosphatase; n=22; Bacter...    54   4e-06
UniRef50_A6DFT1 Cluster: Phosphoserine phosphatase SerB; n=1; Le...    54   4e-06
UniRef50_Q0W3U7 Cluster: Putative phosphoserine phosphatase; n=1...    54   5e-06
UniRef50_Q0ATD9 Cluster: HAD-superfamily hydrolase, subfamily IB...    53   8e-06
UniRef50_UPI0000E499BA Cluster: PREDICTED: similar to O-phosphos...    53   1e-05
UniRef50_Q28VU3 Cluster: Phosphoserine phosphatase SerB; n=13; A...    53   1e-05
UniRef50_Q54ES3 Cluster: Phosphoserine phosphatase; n=1; Dictyos...    53   1e-05
UniRef50_P44997 Cluster: Phosphoserine phosphatase; n=20; Gammap...    53   1e-05
UniRef50_A1SXG2 Cluster: Phosphoserine phosphatase SerB; n=2; Ps...    52   1e-05
UniRef50_Q9RNY2 Cluster: SerB; n=3; Zymomonas mobilis|Rep: SerB ...    52   2e-05
UniRef50_A4C6W9 Cluster: Putative phosphoserine phosphatase; n=3...    52   2e-05
UniRef50_A1RH92 Cluster: Phosphoserine phosphatase SerB; n=10; S...    52   2e-05
UniRef50_Q6A649 Cluster: Putative phosphoserine phosphatase; n=1...    52   3e-05
UniRef50_A4B7F8 Cluster: SerB; n=1; Alteromonas macleodii 'Deep ...    52   3e-05
UniRef50_A6GN83 Cluster: Phosphoserine phosphatase SerB; n=1; Li...    51   3e-05
UniRef50_UPI00015C52DD Cluster: hypothetical protein CKO_00632; ...    50   6e-05
UniRef50_Q609G7 Cluster: Phosphoserine phosphatase; n=1; Methylo...    50   6e-05
UniRef50_Q9A6J6 Cluster: Phosphoserine phosphatase; n=10; Alphap...    50   8e-05
UniRef50_Q18CY3 Cluster: Phosphoserine phosphatase; n=1; Clostri...    50   8e-05
UniRef50_A5CRR3 Cluster: SerB2 protein; n=2; Microbacteriaceae|R...    50   8e-05
UniRef50_Q1GT41 Cluster: Phosphoserine phosphatase SerB; n=2; Sp...    50   1e-04
UniRef50_Q8TZ20 Cluster: Phosphoserine phosphatase; n=1; Methano...    50   1e-04
UniRef50_A5UL46 Cluster: Phosphoserine phosphatase, HAD family, ...    50   1e-04
UniRef50_A6VUW0 Cluster: Phosphoserine phosphatase SerB; n=2; Ma...    49   1e-04
UniRef50_Q8ZNL2 Cluster: Putative phosphoserine phosphatase; n=4...    49   2e-04
UniRef50_Q8THT3 Cluster: Phosphoserine phosphatase; n=4; Methano...    49   2e-04
UniRef50_Q2G627 Cluster: Phosphoserine phosphatase SerB; n=4; Sp...    48   2e-04
UniRef50_Q12QF6 Cluster: Phosphoserine phosphatase SerB; n=8; Sh...    48   2e-04
UniRef50_A4IZ30 Cluster: HAD-superfamily hydrolase; n=13; Franci...    48   2e-04
UniRef50_Q487B4 Cluster: Phosphoserine phosphatase; n=1; Colwell...    48   3e-04
UniRef50_A0KPD9 Cluster: Phosphoserine phosphatase; n=2; Aeromon...    48   3e-04
UniRef50_Q5FRZ2 Cluster: Phosphoserine phosphatase; n=2; Acetoba...    48   4e-04
UniRef50_Q1H030 Cluster: Phosphoserine phosphatase SerB; n=2; Pr...    48   4e-04
UniRef50_A1SJU3 Cluster: Phosphoserine phosphatase SerB; n=10; B...    48   4e-04
UniRef50_A7EG80 Cluster: Phosphoserine phosphatase; n=7; Pezizom...    48   4e-04
UniRef50_Q2NFC4 Cluster: Putative phosphoserine phosphatase; n=1...    47   6e-04
UniRef50_Q5LQX0 Cluster: Phosphoserine phosphatase; n=1; Silicib...    47   7e-04
UniRef50_Q12A06 Cluster: Phosphoserine phosphatase SerB; n=8; ce...    47   7e-04
UniRef50_A7TEU0 Cluster: Putative uncharacterized protein; n=1; ...    47   7e-04
UniRef50_Q9HMR1 Cluster: Phosphoserine phosphatase; n=2; Halobac...    47   7e-04
UniRef50_A5WHI3 Cluster: Phosphoserine phosphatase SerB; n=3; Ps...    46   0.001
UniRef50_Q7VK14 Cluster: Phosphoserine phosphatase; n=9; Proteob...    46   0.002
UniRef50_A7BCN9 Cluster: Putative uncharacterized protein; n=1; ...    46   0.002
UniRef50_A6EAP2 Cluster: Phosphoserine phosphatase and phosphogl...    45   0.002
UniRef50_Q7NSB0 Cluster: Phosphoserine phosphatase; n=3; Proteob...    45   0.003
UniRef50_Q3J889 Cluster: Phosphoserine phosphatase SerB; n=1; Ni...    45   0.003
UniRef50_A4SXD0 Cluster: Phosphoserine phosphatase SerB; n=1; Po...    45   0.003
UniRef50_P42941 Cluster: Phosphoserine phosphatase; n=3; Sacchar...    45   0.003
UniRef50_A5EXY1 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q31F61 Cluster: Phosphoserine phosphatase; n=1; Thiomic...    44   0.007
UniRef50_Q9JZM9 Cluster: Phosphoserine phosphatase; n=4; Neisser...    43   0.009
UniRef50_Q7MVA7 Cluster: SerB family protein; n=1; Porphyromonas...    43   0.012
UniRef50_A2TIR8 Cluster: Receptor for egg jelly protein 9; n=9; ...    42   0.016
UniRef50_Q0C510 Cluster: Phosphoserine phosphatase SerB; n=1; Hy...    42   0.021
UniRef50_A3LND7 Cluster: Phosphoserine phosphatase activity; n=6...    42   0.021
UniRef50_Q86U85 Cluster: Phosphoserine phosphatase-like; n=2; Ho...    42   0.028
UniRef50_O15172 Cluster: Phosphoserine phosphatase-like protein;...    42   0.028
UniRef50_A1AVU6 Cluster: Phosphoserine phosphatase SerB; n=2; su...    39   0.15 
UniRef50_Q82X56 Cluster: Possible serB; phosphoserine phosphatas...    39   0.20 
UniRef50_A5G8S0 Cluster: Uncharacterized protein-like protein; n...    39   0.20 
UniRef50_Q6FW57 Cluster: Candida glabrata strain CBS138 chromoso...    39   0.20 
UniRef50_A4XW77 Cluster: HAD-superfamily hydrolase, subfamily IB...    38   0.34 
UniRef50_Q0BS21 Cluster: Phosphoserine phosphatase; n=1; Granuli...    38   0.45 
UniRef50_Q2H4F1 Cluster: Putative uncharacterized protein; n=1; ...    37   0.60 
UniRef50_UPI0000DC0D54 Cluster: Immediate early response 3-inter...    37   0.79 
UniRef50_A3FII3 Cluster: Phosphoserine phosphatase; n=5; pseudom...    37   0.79 
UniRef50_Q96WV6 Cluster: Glycoprotein; n=1; Schizosaccharomyces ...    37   0.79 
UniRef50_A4UBV9 Cluster: Cation-transporting ATPase; n=1; Magnap...    37   0.79 
UniRef50_Q552T8 Cluster: Putative uncharacterized protein; n=2; ...    36   1.0  
UniRef50_A6RCP4 Cluster: Predicted protein; n=1; Ajellomyces cap...    36   1.0  
UniRef50_UPI000050F70E Cluster: COG0560: Phosphoserine phosphata...    36   1.4  
UniRef50_Q6UUM5 Cluster: Putative mucin; n=5; Oryza sativa (japo...    36   1.4  
UniRef50_Q55G46 Cluster: Putative uncharacterized protein; n=1; ...    36   1.8  
UniRef50_Q54E70 Cluster: Putative uncharacterized protein; n=1; ...    36   1.8  
UniRef50_Q6CBU0 Cluster: Yarrowia lipolytica chromosome C of str...    36   1.8  
UniRef50_A5DNX6 Cluster: Predicted protein; n=1; Pichia guillier...    36   1.8  
UniRef50_Q2LGV0 Cluster: Phosphoserine phosphatase; n=4; Halobac...    36   1.8  
UniRef50_A2SQX4 Cluster: Haloacid dehalogenase domain protein hy...    36   1.8  
UniRef50_UPI0000397724 Cluster: COG5295: Autotransporter adhesin...    35   2.4  
UniRef50_Q03WA3 Cluster: Exopolysaccharide biosynthesis protein;...    35   2.4  
UniRef50_Q4FX64 Cluster: Proteophosphoglycan ppg3, putative; n=3...    35   2.4  
UniRef50_Q4FX62 Cluster: Proteophosphoglycan 5; n=5; Eukaryota|R...    35   2.4  
UniRef50_Q685J3 Cluster: Mucin-17; n=14; Amniota|Rep: Mucin-17 -...    35   2.4  
UniRef50_UPI00015BABC5 Cluster: HAD-superfamily hydrolase, subfa...    35   3.2  
UniRef50_UPI0001553895 Cluster: PREDICTED: similar to C6orf205 p...    35   3.2  
UniRef50_Q7PC53 Cluster: Chitinase B; n=3; Bacteria|Rep: Chitina...    35   3.2  
UniRef50_A7CZQ9 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_A6FW48 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_Q4Q0J5 Cluster: Putative uncharacterized protein; n=4; ...    35   3.2  
UniRef50_A2ECQ1 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_Q4J7Y7 Cluster: Conserved Archaeal protein; n=5; Sulfol...    35   3.2  
UniRef50_A0RUI6 Cluster: Phosphoserine phosphatase; n=2; Crenarc...    35   3.2  
UniRef50_O42970 Cluster: Uncharacterized serine-rich protein C1E...    35   3.2  
UniRef50_P53189 Cluster: Probable family 17 glucosidase SCW11 pr...    35   3.2  
UniRef50_Q5LKP2 Cluster: HAD-superfamily hydrolase, subfamily IB...    34   4.2  
UniRef50_Q8IFX6 Cluster: Putative uncharacterized protein; n=5; ...    34   4.2  
UniRef50_Q4X874 Cluster: Pc-fam-2 protein, putative; n=1; Plasmo...    34   4.2  
UniRef50_Q1JSA7 Cluster: Putative uncharacterized protein; n=1; ...    34   4.2  
UniRef50_A7F3R4 Cluster: Predicted protein; n=2; Sclerotiniaceae...    34   4.2  
UniRef50_A7DSI4 Cluster: Phosphoserine phosphatase SerB; n=1; Ca...    34   4.2  
UniRef50_P46591 Cluster: Hyphally-regulated protein precursor; n...    34   4.2  
UniRef50_P06800 Cluster: Leukocyte common antigen precursor; n=1...    34   4.2  
UniRef50_UPI0000F1D401 Cluster: PREDICTED: hypothetical protein,...    34   5.6  
UniRef50_UPI0000ECCA49 Cluster: CDNA FLJ16464 fis, clone BRHIP20...    34   5.6  
UniRef50_Q62E20 Cluster: Dyp-type peroxidase family protein; n=2...    34   5.6  
UniRef50_Q2RGV3 Cluster: Spore germination B3 GerAC like; n=1; M...    34   5.6  
UniRef50_UPI00004D5DA1 Cluster: YLP motif containing protein 1 (...    33   7.4  
UniRef50_Q2JB76 Cluster: HAD-superfamily subfamily IB, PSPase-li...    33   7.4  
UniRef50_Q3VW96 Cluster: Radical SAM; n=2; Chlorobiaceae|Rep: Ra...    33   7.4  
UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel d...    33   7.4  
UniRef50_Q559J2 Cluster: Putative uncharacterized protein; n=2; ...    33   7.4  
UniRef50_Q6VBJ3 Cluster: Epa4p; n=6; Fungi/Metazoa group|Rep: Ep...    33   7.4  
UniRef50_Q6FTA2 Cluster: Similar to sp|P20840 Saccharomyces cere...    33   7.4  
UniRef50_Q6CD44 Cluster: Similar to DEHA0F04158g Debaryomyces ha...    33   7.4  
UniRef50_A5DD47 Cluster: Putative uncharacterized protein; n=1; ...    33   7.4  
UniRef50_P02836 Cluster: Segmentation polarity homeobox protein ...    33   7.4  
UniRef50_UPI0000F2CA5F Cluster: PREDICTED: hypothetical protein;...    33   9.7  
UniRef50_UPI0000EBC2F4 Cluster: PREDICTED: similar to down-regul...    33   9.7  
UniRef50_A6Q7Z2 Cluster: Phosphoserine phosphatase; n=8; Epsilon...    33   9.7  
UniRef50_Q98SA9 Cluster: Putative uncharacterized protein orf301...    33   9.7  
UniRef50_A3ABE8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   9.7  
UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant...    33   9.7  
UniRef50_Q4Z3X9 Cluster: Pb-reticulocyte binding protein; n=2; P...    33   9.7  
UniRef50_Q49BJ0 Cluster: Rhino; n=4; obscura group|Rep: Rhino - ...    33   9.7  
UniRef50_Q26882 Cluster: Surface coat glycoprotein TES-120; n=1;...    33   9.7  
UniRef50_Q17BE7 Cluster: Putative uncharacterized protein; n=2; ...    33   9.7  
UniRef50_Q172W8 Cluster: Sin3a-associated protein sap130; n=2; A...    33   9.7  
UniRef50_Q16R75 Cluster: Condensin, XCAP-G'-subunit, putative; n...    33   9.7  
UniRef50_A7AQ91 Cluster: GCC2 and GCC3 domain containing protein...    33   9.7  
UniRef50_A4IJ82 Cluster: LD40879p; n=6; Drosophila melanogaster|...    33   9.7  
UniRef50_Q2USG1 Cluster: Predicted protein; n=1; Aspergillus ory...    33   9.7  
UniRef50_A5DG98 Cluster: Predicted protein; n=1; Pichia guillier...    33   9.7  
UniRef50_P87179 Cluster: Cell wall integrity and stress response...    33   9.7  

>UniRef50_Q5QBM3 Cluster: O-phosphoserine phosphatase; n=1;
           Culicoides sonorensis|Rep: O-phosphoserine phosphatase -
           Culicoides sonorensis
          Length = 270

 Score =  120 bits (289), Expect = 5e-26
 Identities = 55/82 (67%), Positives = 67/82 (81%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           E+ +    VCFDVDSTVI++EGIDELAKFCGKG EV+ LT EAMGG M+FQEAL +RL+I
Sbjct: 134 EILKATQVVCFDVDSTVIKEEGIDELAKFCGKGKEVQELTKEAMGGAMSFQEALDRRLNI 193

Query: 436 IRPNVGQIREFIEKFPVRLTPG 501
           IRP+  QI+EFI+ +P  LTPG
Sbjct: 194 IRPSQAQIKEFIKLYPSTLTPG 215



 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 25/53 (47%), Positives = 35/53 (66%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGF 668
           L+ +L + G  ++L+SGGF  LI PVA +L     N++AN L F FNG+YA F
Sbjct: 219 LINKLKQEGKHIFLISGGFDCLINPVALKLEF-LGNVYANSLHFLFNGDYASF 270


>UniRef50_Q17M50 Cluster: Phosphoserine phosphatase; n=6;
           Endopterygota|Rep: Phosphoserine phosphatase - Aedes
           aegypti (Yellowfever mosquito)
          Length = 330

 Score =  119 bits (286), Expect = 1e-25
 Identities = 54/88 (61%), Positives = 69/88 (78%)
 Frame = +1

Query: 241 PTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALK 420
           P +  E+ + A  VCFDVDST+I +EGIDELA+FCGKG EV  LT EAMGG+MTFQEALK
Sbjct: 112 PQEAREMLKRAQIVCFDVDSTIITEEGIDELAQFCGKGAEVAALTKEAMGGSMTFQEALK 171

Query: 421 KRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           +RLDII+P+  QIREF++  P  ++ G+
Sbjct: 172 RRLDIIKPSQRQIREFLKTHPSTVSAGV 199



 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 42/94 (44%), Positives = 60/94 (63%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           L+ +L +    +YLVSGGF  LIEPVA+ L +P  N+FAN+L F+FNG YAGFD N+ TS
Sbjct: 202 LIDQLRQNSAEIYLVSGGFDCLIEPVADALEVPLCNLFANKLYFHFNGSYAGFDTNQVTS 261

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           +SGG    ++ +       ++V + G G+   EA
Sbjct: 262 KSGGKGEAIKIIKSRFNSDKVVAMVGDGMTDLEA 295


>UniRef50_P78330 Cluster: Phosphoserine phosphatase; n=19;
           Coelomata|Rep: Phosphoserine phosphatase - Homo sapiens
           (Human)
          Length = 225

 Score =  112 bits (269), Expect = 1e-23
 Identities = 52/94 (55%), Positives = 69/94 (73%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L ER V V+L+SGGFRS++E VA +LNIP  N+FANRLKFYFNGEYAGFDE +PT+
Sbjct: 94  LVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V++ L E   +++++++ G G    EA
Sbjct: 154 ESGGKGKVIKLLKEKFHFKKIIMI-GDGATDMEA 186



 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 47/90 (52%), Positives = 64/90 (71%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           V+ ++  +LF +AD VCFDVDSTVI++EGIDELAK CG  D V  +T  AMGG + F+ A
Sbjct: 2   VSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 415 LKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           L +RL +I+P+  Q++  I + P  LTPGI
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGI 91


>UniRef50_Q4REM8 Cluster: Chromosome 10 SCAF15123, whole genome
           shotgun sequence; n=3; Deuterostomia|Rep: Chromosome 10
           SCAF15123, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 273

 Score =  109 bits (263), Expect = 7e-23
 Identities = 52/83 (62%), Positives = 64/83 (77%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           ELFR A+ VCFDVDSTVI++EGIDELAKFCG GD V  +T +AMGG+MTF+ AL +RL I
Sbjct: 9   ELFRRAEAVCFDVDSTVIREEGIDELAKFCGVGDAVTEMTRKAMGGSMTFKTALNERLSI 68

Query: 436 IRPNVGQIREFIEKFPVRLTPGI 504
           IR +  Q+ + I   P +LTPGI
Sbjct: 69  IRCSREQVNKLITDHPPQLTPGI 91



 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 34/64 (53%), Positives = 43/64 (67%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH+R V V+L+SGGFR ++E VA +LNIP  +++ANRLKFYFNGE      N    
Sbjct: 94  LVDSLHQRNVKVFLISGGFRCIVEHVAAQLNIPQHHVYANRLKFYFNGEQKSSSGNVREP 153

Query: 690 RSGG 701
           R  G
Sbjct: 154 RRPG 157


>UniRef50_Q0IHZ7 Cluster: Psph protein; n=12; Eumetazoa|Rep: Psph
           protein - Xenopus tropicalis (Western clawed frog)
           (Silurana tropicalis)
          Length = 237

 Score =  109 bits (263), Expect = 7e-23
 Identities = 51/87 (58%), Positives = 66/87 (75%)
 Frame = +1

Query: 244 TDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKK 423
           ++  E FR+AD VCFDVDSTVI++EGIDELAKFCG GD V  +T  AMGG++TF+ AL +
Sbjct: 5   SEIKETFRSADAVCFDVDSTVIKEEGIDELAKFCGVGDAVAEMTRRAMGGSLTFRAALTE 64

Query: 424 RLDIIRPNVGQIREFIEKFPVRLTPGI 504
           RL +IRP+  Q++  I + P RLT GI
Sbjct: 65  RLALIRPSREQVQALITEHPPRLTEGI 91



 Score =  109 bits (262), Expect = 9e-23
 Identities = 50/94 (53%), Positives = 71/94 (75%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  LH+R V V+L+SGGFRS++E VA +L+IP  N++ANRLKFYFNGEYAGFDE + T+
Sbjct: 94  LVCRLHQRNVQVFLISGGFRSIVEHVASQLDIPLTNVYANRLKFYFNGEYAGFDETQLTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V+ +L E +G+++++++ G G    EA
Sbjct: 154 ESGGKGKVIAQLKEKYGFRKIIMI-GDGATDMEA 186


>UniRef50_Q9VSY6 Cluster: Phosphoserine phosphatase; n=3;
           Sophophora|Rep: Phosphoserine phosphatase - Drosophila
           melanogaster (Fruit fly)
          Length = 270

 Score =  106 bits (255), Expect = 7e-22
 Identities = 50/88 (56%), Positives = 66/88 (75%)
 Frame = +1

Query: 241 PTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALK 420
           P    ++ + +  VCFDVDSTVI +EGIDELA++CGKG EV R+T EAMGG MTFQ+ALK
Sbjct: 51  PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALK 110

Query: 421 KRLDIIRPNVGQIREFIEKFPVRLTPGI 504
            RL+IIRP   Q+R+FI++ P  L+  +
Sbjct: 111 IRLNIIRPTQQQVRDFIQERPSTLSKNV 138



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 41/95 (43%), Positives = 54/95 (56%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPT 686
           R V  L   G  VYL+SGGF  LI PVA  L IP  N++AN++ F + GEY  FD N+PT
Sbjct: 140 RFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPT 199

Query: 687 SRSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           SRSGG    +  + + +    L+ + G G    EA
Sbjct: 200 SRSGGKAEAIALIRKENSDDSLITMIGDGATDLEA 234


>UniRef50_O82796 Cluster: Phosphoserine phosphatase, chloroplast
           precursor; n=11; Eukaryota|Rep: Phosphoserine
           phosphatase, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 295

 Score =  104 bits (249), Expect = 3e-21
 Identities = 49/106 (46%), Positives = 72/106 (67%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           +V+  E +  G +   V   +  +L+R+ + VCFDVDSTV  DEGIDELA+FCG G  V 
Sbjct: 55  SVQPHELSTLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCVDEGIDELAEFCGAGKAVA 114

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
             TA AMGG++ F+EAL  RL + +P++ ++ E+++K P RL+PGI
Sbjct: 115 EWTARAMGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSPGI 160



 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 47/94 (50%), Positives = 61/94 (64%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LVK+L    + VYL+SGGFR +I PVA  L IP  NIFAN L F  +GE+ GFDENEPTS
Sbjct: 163 LVKKLRANNIDVYLISGGFRQMINPVASILGIPRENIFANNLLFGNSGEFLGFDENEPTS 222

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           RSGG    V+++ +   Y+ + ++ G G    EA
Sbjct: 223 RSGGKAKAVQQIRKGRLYKTMAMI-GDGATDLEA 255


>UniRef50_Q26545 Cluster: Phosphoserine phosphohydrolase-like
           protein trans-spliced; n=2; Schistosoma|Rep:
           Phosphoserine phosphohydrolase-like protein
           trans-spliced - Schistosoma mansoni (Blood fluke)
          Length = 223

 Score = 91.5 bits (217), Expect = 3e-17
 Identities = 39/76 (51%), Positives = 55/76 (72%)
 Frame = +1

Query: 277 CVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQ 456
           CVC DVDSTV +DEG+DE+A + G  D VK++T EAM G +   +AL+ RL I+  NV +
Sbjct: 10  CVCLDVDSTVCEDEGLDEIASYIGVTDRVKKITDEAMNGELDINKALEARLSIMNLNVKK 69

Query: 457 IREFIEKFPVRLTPGI 504
           + +F++  PVRLTPG+
Sbjct: 70  LTDFLDNHPVRLTPGV 85



 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 40/77 (51%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV +  E G+ VYLVSGG   L+  VAE LNIP  N++AN+L F   G Y G D N PTS
Sbjct: 88  LVNQFKENGIDVYLVSGGLYPLVSRVAELLNIPEENVYANKLIFNNEGTYVGLDHNAPTS 147

Query: 690 RSGGXXLVVRR-LXELH 737
           RS G  L+V   L +LH
Sbjct: 148 RSDGKALIVNELLNKLH 164


>UniRef50_Q0MYU8 Cluster: Putative phosphoserine phosphatase serb;
           n=1; Emiliania huxleyi|Rep: Putative phosphoserine
           phosphatase serb - Emiliania huxleyi
          Length = 304

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 35/72 (48%), Positives = 50/72 (69%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           E  RTAD +CFDVD+TVI++EGI+ LA   G G++++ +T   M G+  F EAL++RLDI
Sbjct: 81  EALRTADAICFDVDATVIREEGINRLATHNGCGEQIEAMTVRTMEGDTPFHEALRERLDI 140

Query: 436 IRPNVGQIREFI 471
           IRP+   +   I
Sbjct: 141 IRPSQSDVASLI 152



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 35/84 (41%), Positives = 54/84 (64%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV+ LHE G  V+L+SGGFR +I P A +L +   +++AN L F   G+Y+G D  E TS
Sbjct: 168 LVRSLHESGRPVFLLSGGFRQIINPFAAQLGVEESHVYANTLLFDEQGDYSGVDPTELTS 227

Query: 690 RSGGXXLVVRRLXELHGYQRLVIV 761
           +  G   V+  L E HG++++V++
Sbjct: 228 QPSGKARVISMLKETHGFEKVVMI 251


>UniRef50_UPI0000E214DD Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 189

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 40/61 (65%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L E  V+V+L  GGFRS++E VA +LNIP  N+FAN+ KFYFNG     D+    S
Sbjct: 81  LVSLLQELNVLVFLTPGGFRSIVEHVASKLNIPATNVFANKQKFYFNGSQETLDQTRQLS 140

Query: 690 R 692
           R
Sbjct: 141 R 141


>UniRef50_UPI0000E0E125 Cluster: Phosphoserine phosphatase; n=1;
           alpha proteobacterium HTCC2255|Rep: Phosphoserine
           phosphatase - alpha proteobacterium HTCC2255
          Length = 335

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query: 247 DCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKR 426
           + P L  T   +  D+DSTVIQ E IDE+AK CGKGDEV  +T  AM G + F ++L++R
Sbjct: 122 NAPRL-ETPGIIVMDMDSTVIQIECIDEIAKLCGKGDEVSEVTELAMQGKLDFAQSLRQR 180

Query: 427 LDIIRP-NVGQIREFIEKFPVRLTPGI 504
           + ++   +V  ++   +  P  L PGI
Sbjct: 181 VGVLAGIDVALLQGIRDSIP--LMPGI 205


>UniRef50_A5FJ80 Cluster: Phosphoserine phosphatase SerB; n=2;
           Bacteria|Rep: Phosphoserine phosphatase SerB -
           Flavobacterium johnsoniae UW101
          Length = 410

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 33/76 (43%), Positives = 46/76 (60%)
 Frame = +1

Query: 265 RTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP 444
           R    VCFD+DST+IQ E IDELA+  G GD+V+ +T  AM G + F E+ KKR+ ++  
Sbjct: 193 RNRRLVCFDMDSTLIQTEVIDELAELNGVGDQVRAITESAMNGEIDFNESFKKRMALLE- 251

Query: 445 NVGQIREFIEKFPVRL 492
             G   E ++   V L
Sbjct: 252 --GLSEEVLQNVAVNL 265


>UniRef50_A4FYT5 Cluster: Phosphoserine phosphatase SerB; n=4;
           Methanococcus|Rep: Phosphoserine phosphatase SerB -
           Methanococcus maripaludis
          Length = 213

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 30/70 (42%), Positives = 48/70 (68%), Gaps = 1/70 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           + FD+DST+   E IDE+AKF G   E+K++T EAM G + F+E+LK+R+  ++   V +
Sbjct: 10  ILFDLDSTLADCEVIDEIAKFAGVESEIKKITEEAMKGKIKFEESLKRRVKFLKGIPVEK 69

Query: 457 IREFIEKFPV 486
           + EF +K P+
Sbjct: 70  LDEFAKKIPI 79


>UniRef50_Q7MWG4 Cluster: Phosphoserine phosphatase; n=33;
           Bacteria|Rep: Phosphoserine phosphatase - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 413

 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           +CFD+DST+IQ E IDELA   G GD VK +T  AM G + F E+ ++R+ +++  +V  
Sbjct: 195 ICFDMDSTLIQTEVIDELAIRAGVGDRVKAITESAMRGEIDFTESFRQRVALLKGLDVSV 254

Query: 457 IREFIEKFPV 486
           ++E  E  P+
Sbjct: 255 MQEIAESLPI 264


>UniRef50_Q52ZA0 Cluster: Glycerol-3-phosphate dehydrogenase; n=3;
           Viridiplantae|Rep: Glycerol-3-phosphate dehydrogenase -
           Dunaliella salina
          Length = 701

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           +L++ AD VCFDVD TV  D  +  LAKF G  DE + LT +A  G +   +A + RL  
Sbjct: 105 DLWQQADAVCFDVDRTVTTDASVGLLAKFMGIEDEAQSLTEQANRGEINLTKAFEDRLAK 164

Query: 436 IRPNVGQIREFIEKFP--VRLTPGI 504
           +      I  F+E+ P   RL PG+
Sbjct: 165 LNFTPTDIDRFLEEHPAHTRLVPGV 189



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 29/82 (35%), Positives = 40/82 (48%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           L+  L  RGV V+L+SGGFR +  P+A  L IP  N+F N + +  +      D  EP  
Sbjct: 192 LIAALKARGVEVFLISGGFREMALPIASHLKIPAKNVFCNTMSWQLD------DHGEPVR 245

Query: 690 RSGGXXLVVRRLXELHGYQRLV 755
             G   L + R  E H   R +
Sbjct: 246 LQG---LDMTRAAESHFKSRAI 264


>UniRef50_A0Z8F6 Cluster: Phosphoserine phosphatase; n=1; marine
           gamma proteobacterium HTCC2080|Rep: Phosphoserine
           phosphatase - marine gamma proteobacterium HTCC2080
          Length = 306

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
 Frame = +1

Query: 211 LTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMG 390
           L G  Q D A        R      FD+DST+IQ E IDELA++ G G++V  +T  AM 
Sbjct: 73  LQGEAQMDWAIQTLASRVRRYRLAVFDMDSTLIQCEVIDELARYAGVGEQVAAITDRAMR 132

Query: 391 GNMTFQEALKKRLDIIRP-NVGQIREFIEKFPV 486
           G++ FQE+  +R+ +++  +VG I   +E  P+
Sbjct: 133 GDLEFQESFVERVALLKGLDVGVIDGILETLPI 165


>UniRef50_Q47EM3 Cluster: Phosphoserine phosphatase
           SerB:HAD-superfamily hydrolase subfamily IB,
           PSPase-like; n=1; Dechloromonas aromatica RCB|Rep:
           Phosphoserine phosphatase SerB:HAD-superfamily hydrolase
           subfamily IB, PSPase-like - Dechloromonas aromatica
           (strain RCB)
          Length = 279

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 27/53 (50%), Positives = 39/53 (73%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           +CFD+DST+I  E IDELA F GK DEV  +T  AM G + ++E+L++RL ++
Sbjct: 75  ICFDMDSTLITIECIDELADFAGKKDEVSAVTEAAMRGEIDYRESLRRRLSLL 127


>UniRef50_Q04RT1 Cluster: Phosphoserine phosphatase; n=4;
           Leptospira|Rep: Phosphoserine phosphatase - Leptospira
           borgpetersenii serovar Hardjo-bovis (strain JB197)
          Length = 293

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 286 FDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIRE 465
           FD+DST+IQ E IDELA+  G  +EV  +T EAM GN+ F EALKKR   ++     I  
Sbjct: 92  FDMDSTLIQQEVIDELARLTGVYEEVASVTKEAMEGNLDFHEALKKRCVHLKGLSSSI-- 149

Query: 466 FIEKFP-VRLTPGITG**KSYTKEES 540
           F E +P ++L  G+    +S  ++ S
Sbjct: 150 FTELYPKLKLNAGVESLLRSLKEKNS 175


>UniRef50_O28142 Cluster: Phosphoserine phosphatase; n=2;
           Euryarchaeota|Rep: Phosphoserine phosphatase -
           Archaeoglobus fulgidus
          Length = 344

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 32/74 (43%), Positives = 50/74 (67%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           + FD+DST+++ E IDELAK  G GDEV +LT  AM G + F+EAL++R+ +++    ++
Sbjct: 132 IVFDMDSTLVEAEIIDELAKEAGVGDEVSKLTERAMRGEIGFKEALEERVRLLKGLPVEV 191

Query: 460 REFIEKFPVRLTPG 501
            E I    ++LT G
Sbjct: 192 LERIYS-RIKLTEG 204


>UniRef50_Q58989 Cluster: Phosphoserine phosphatase; n=3;
           Euryarchaeota|Rep: Phosphoserine phosphatase -
           Methanococcus jannaschii
          Length = 211

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 29/73 (39%), Positives = 49/73 (67%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           + FD DST++ +E IDE+A+  G  +EVK++T EAM G + F+++L+KR+ +++      
Sbjct: 8   ILFDFDSTLVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQSLRKRVSLLK---DLP 64

Query: 460 REFIEKFPVRLTP 498
            E +EK   R+TP
Sbjct: 65  IEKVEKAIKRITP 77



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 22/56 (39%), Positives = 31/56 (55%)
 Frame = +3

Query: 513 VKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENE 680
           +KEL  RG +V +VSGGF   +  + E+L +     FANRL    +G+  G  E E
Sbjct: 85  IKELKNRGYVVAVVSGGFDIAVNKIKEKLGLD--YAFANRL-IVKDGKLTGDVEGE 137


>UniRef50_A3UEM1 Cluster: Putative uncharacterized protein; n=1;
           Oceanicaulis alexandrii HTCC2633|Rep: Putative
           uncharacterized protein - Oceanicaulis alexandrii
           HTCC2633
          Length = 222

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 50/141 (35%), Positives = 60/141 (42%)
 Frame = +3

Query: 369 TDGGSNGRQYDIPGSLEEETGHHQA*RRSDQRIH*EISS*TNSWYYRLVKELHERGVIVY 548
           TD G  G Q D   SLE+        R + +     + +        L+  L  RG  V 
Sbjct: 44  TDQGMAG-QLDFRSSLEQRLAIAGLTRPAVEAARERLRTQLTEGMVELLNALRTRGNDVA 102

Query: 549 LVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTSRSGGXXLVVRRLX 728
            VSGGF  L+EP    L      I ANR   Y   E  GFD   P SRSGG   VV  L 
Sbjct: 103 AVSGGFVDLVEPALSDLGFANGEIRANRF-VYEGDEVIGFDRQNPLSRSGGKAPVVASLK 161

Query: 729 ELHGYQRLVIVRGPGLPMPEA 791
            L G + L I+ G G+   EA
Sbjct: 162 TLFG-KPLAIMVGDGMTDYEA 181



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 8/83 (9%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGID----ELAKFCGKGDE----VKRLTAEAMGGNMTFQEALKKRLDI 435
           + FDVDST+++ E +D            G E    +K LT + M G + F+ +L++RL I
Sbjct: 5   IVFDVDSTLLKVESLDFAVEHALSSAPDGAERTARLKALTDQGMAGQLDFRSSLEQRLAI 64

Query: 436 IRPNVGQIREFIEKFPVRLTPGI 504
                  +    E+   +LT G+
Sbjct: 65  AGLTRPAVEAARERLRTQLTEGM 87


>UniRef50_Q62JZ6 Cluster: Phosphoserine phosphatase; n=42;
           Proteobacteria|Rep: Phosphoserine phosphatase -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 568

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 2/115 (1%)
 Frame = +1

Query: 163 SLQFEK-QPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAK 339
           S++ E+  PA R   DA  G    D A  D          V  D+DST+I  E IDE+A 
Sbjct: 324 SIRIERANPAQRADIDAYCGTHALDYAFVDAARKLADFGLVAMDMDSTLITIECIDEIAD 383

Query: 340 FCGKGDEVKRLTAEAMGGNM-TFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
           FCG   EV  +T  AM G +  F E+L +R+ ++        E + +  +RL+PG
Sbjct: 384 FCGLKAEVSAITEAAMRGEIKDFNESLTRRVALLAGLEASALERVYEERLRLSPG 438


>UniRef50_A3VNP9 Cluster: Phosphoserine phosphatase; n=1;
           Parvularcula bermudensis HTCC2503|Rep: Phosphoserine
           phosphatase - Parvularcula bermudensis HTCC2503
          Length = 287

 Score = 58.8 bits (136), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 54/115 (46%)
 Frame = +1

Query: 160 GSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAK 339
           G       P    V+DA+       +     P   R    +  D+DSTVI  E +DELA 
Sbjct: 33  GGAALVNMPVGEAVKDAMAAARADGLDAAYLPHGARPVRLLLADMDSTVIGQECLDELAD 92

Query: 340 FCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
             G G+ VK +T +AM G + F+EAL+ R+  ++     + + +    + L PG+
Sbjct: 93  KAGHGEAVKAITEQAMRGELNFEEALRDRVATLKDLPASVVDEVLAERITLDPGV 147


>UniRef50_Q75CP9 Cluster: ACL130Cp; n=2; Saccharomycetales|Rep:
           ACL130Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 316

 Score = 58.8 bits (136), Expect = 2e-07
 Identities = 39/115 (33%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = +1

Query: 172 FEKQPAVRDVEDALTGVDQRDVAPTDC---PELFRTADCVCFDVDSTVIQDEGIDELAKF 342
           F   P    +E   T V  +  A  D    P   R    V FD+DST+IQ E ID +A +
Sbjct: 51  FVDVPTTLTLEQLRTHVAAQPAAGVDVAVQPTAHRRKGLVVFDMDSTLIQQEVIDLIAGY 110

Query: 343 CGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIREFIEKFPVRLTPGI 504
            G  D V  +T  AM   + F ++L++R+ ++R   V ++ E I K  ++LTPG+
Sbjct: 111 AGVEDRVAAITERAMNNELDFTQSLRERVSLLRGIPVARLYEEI-KAKLQLTPGV 164


>UniRef50_A1D856 Cluster: Phosphoserine phosphatase; n=8;
           Pezizomycotina|Rep: Phosphoserine phosphatase -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 469

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/74 (39%), Positives = 47/74 (63%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           V FD+DST+IQ+E IDE+AKF G   EV  +T  AM G + F  +LK+R+ +++     +
Sbjct: 248 VVFDMDSTLIQNEVIDEIAKFVGVEKEVSEITERAMNGELDFSASLKERVGLLKGVPADV 307

Query: 460 REFIEKFPVRLTPG 501
            E ++   + ++PG
Sbjct: 308 FEKLKPI-LTVSPG 320


>UniRef50_P0AGB2 Cluster: Phosphoserine phosphatase; n=44;
           Gammaproteobacteria|Rep: Phosphoserine phosphatase -
           Shigella flexneri
          Length = 322

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
 Frame = +1

Query: 226 QRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTF 405
           Q DVAP       RT   +  D+DST IQ E IDE+AK  G G+ V  +T  AM G + F
Sbjct: 95  QLDVAPLGKIPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGTGEMVAEVTERAMRGELDF 154

Query: 406 QEALKKRLDIIR-PNVGQIREFIEKFPVRLTPGIT 507
             +L+ R+  ++  +   +++  E  P  L PG+T
Sbjct: 155 TASLRSRVATLKGADANILQQVRENLP--LMPGLT 187


>UniRef50_O74382 Cluster: Probable phosphoserine phosphatase; n=1;
           Schizosaccharomyces pombe|Rep: Probable phosphoserine
           phosphatase - Schizosaccharomyces pombe (Fission yeast)
          Length = 298

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 4/106 (3%)
 Frame = +1

Query: 196 DVEDALTGVDQRDVAPTDC--PELFRTAD-CVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           D +DA   +   +    +C     F T    V FD+DST+IQ E IDELA   G   EV 
Sbjct: 48  DAKDACNRISATENVDCNCLSEATFSTKKKLVVFDMDSTLIQQECIDELAAEAGIQKEVA 107

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIREFIEKFPVRLTPG 501
            +T+ AM G + FQE+L++R+ +++  +V  I + I K  +  TPG
Sbjct: 108 TITSLAMNGEIDFQESLRRRVSLLQGLSVDVINKVIGK--ITFTPG 151


>UniRef50_A4A8Q7 Cluster: Phosphoserine phosphatase; n=1;
           Congregibacter litoralis KT71|Rep: Phosphoserine
           phosphatase - Congregibacter litoralis KT71
          Length = 380

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 30/69 (43%), Positives = 45/69 (65%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           +AP+D     R    + FD+DST+IQ E IDELA+  G GDEV  +TA AM G + F+++
Sbjct: 161 LAPSDSKRPRRRL--IAFDMDSTLIQCEVIDELARRAGVGDEVAGVTARAMRGELDFRQS 218

Query: 415 LKKRLDIIR 441
            ++R+  +R
Sbjct: 219 FRERMAKLR 227


>UniRef50_Q5LN59 Cluster: Phosphoserine phosphatase; n=42;
           Alphaproteobacteria|Rep: Phosphoserine phosphatase -
           Silicibacter pomeroyi
          Length = 302

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           D+DST+IQ E IDELA   G GD VK +TA AM G + F+ AL +R+ ++R
Sbjct: 92  DMDSTMIQQECIDELADEAGVGDRVKDITARAMNGELDFEGALLERVGLLR 142


>UniRef50_Q6M2V2 Cluster: Phosphoserine Phosphatase; n=30;
           Actinobacteria (class)|Rep: Phosphoserine Phosphatase -
           Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 446

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 37/105 (35%), Positives = 54/105 (51%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           A+R    ALT     D+A      L R+   VCFD DST+I  E I+ LA   GK  EV 
Sbjct: 188 AMRKALAALTSELNVDIAIERSGLLRRSKRLVCFDCDSTLITGEVIEMLAAHAGKEAEVA 247

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
            +T  AM G + F+E+L++R+  +      + + +    + LTPG
Sbjct: 248 AVTERAMRGELDFEESLRERVKALAGLDASVIDEVAA-AIELTPG 291


>UniRef50_Q3VJT9 Cluster: Phosphoserine phosphatase
           SerB:HAD-superfamily hydrolase, subfamily IB; n=24;
           Bacteria|Rep: Phosphoserine phosphatase
           SerB:HAD-superfamily hydrolase, subfamily IB -
           Pelodictyon phaeoclathratiforme BU-1
          Length = 437

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 27/55 (49%), Positives = 37/55 (67%)
 Frame = +1

Query: 265 RTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL 429
           R    V FD+DST+I  E IDELAK  G G+EV  +T +AM G + F E+L++R+
Sbjct: 220 RNRRMVVFDMDSTLITSEVIDELAKEAGVGEEVSAITEQAMRGELDFNESLQRRV 274


>UniRef50_Q1JVE4 Cluster: Phosphoserine phosphatase SerB; n=2;
           Desulfuromonadales|Rep: Phosphoserine phosphatase SerB -
           Desulfuromonas acetoxidans DSM 684
          Length = 399

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 36/96 (37%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = +1

Query: 157 DGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTAD-CVCFDVDSTVIQDEGIDEL 333
           DG L     PA++     + G  + DVA      L+R A   V  D+DST+IQ E IDEL
Sbjct: 147 DGQLDI---PALKRKLLQVGGSQRVDVA-VQKERLYRRAKRLVVMDMDSTLIQVEVIDEL 202

Query: 334 AKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           A+  G G++V R+T +AM G + F ++L  R+ +++
Sbjct: 203 ARLAGVGEDVARITEQAMNGELDFGQSLAARVALLK 238


>UniRef50_Q15WD4 Cluster: Phosphoserine phosphatase SerB; n=1;
           Pseudoalteromonas atlantica T6c|Rep: Phosphoserine
           phosphatase SerB - Pseudoalteromonas atlantica (strain
           T6c / BAA-1087)
          Length = 357

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREF 468
           D+DSTVI  E IDE+AK  G G+EV  +T +AM G + F+E+L+ R+  ++     I + 
Sbjct: 150 DMDSTVISIECIDEIAKLAGVGEEVSSVTEQAMQGKLDFEESLRSRVGCLKDANEDILQQ 209

Query: 469 IEKFPVRLTPGI 504
           + +  + L PGI
Sbjct: 210 VRR-ALPLMPGI 220


>UniRef50_Q9KPM2 Cluster: Phosphoserine phosphatase; n=30;
           Vibrionales|Rep: Phosphoserine phosphatase - Vibrio
           cholerae
          Length = 328

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 4/83 (4%)
 Frame = +1

Query: 247 DCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKR 426
           D P+L +    +  D+DST IQ E IDE+AK  G G+EV  +T  AM G + F+++L+ R
Sbjct: 100 DVPDLTKPG-LIVLDMDSTAIQIECIDEIAKLAGVGEEVAEVTERAMQGELDFEQSLRLR 158

Query: 427 LDIIR--PN--VGQIREFIEKFP 483
           +  ++  P   + Q+RE +   P
Sbjct: 159 VSKLKDAPEQILSQVRETLPLMP 181


>UniRef50_Q83AZ5 Cluster: L-3-phosphoserine phosphatase; n=4;
           Coxiella burnetii|Rep: L-3-phosphoserine phosphatase -
           Coxiella burnetii
          Length = 258

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 29/75 (38%), Positives = 40/75 (53%)
 Frame = +1

Query: 274 DCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVG 453
           D V FD D T+ Q EGID LA+      EV+ LT  AM       +  +KRLD++ P   
Sbjct: 13  DAVIFDCDGTLSQIEGIDHLAEINNVDSEVRLLTETAMNLTGITADIYRKRLDLVNPTKD 72

Query: 454 QIREFIEKFPVRLTP 498
           Q+ +  E++   LTP
Sbjct: 73  QVDQLDEQYYANLTP 87



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 30/94 (31%), Positives = 46/94 (48%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           ++  LH     VY++S G ++ +E  A+RL IPT ++FA  + F   G Y  ++   P +
Sbjct: 92  IISILHNLNKTVYVISAGIQAAVEAFAKRLGIPTSHVFAVAVYFDGKGRYLNYEHQSPLT 151

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
              G   V+  L   H   R V V G G+   EA
Sbjct: 152 YQLGKRKVIEALRLNH--HRFVYV-GDGMNDIEA 182


>UniRef50_A6F6B2 Cluster: Phosphoserine phosphatase; n=1; Moritella
           sp. PE36|Rep: Phosphoserine phosphatase - Moritella sp.
           PE36
          Length = 394

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 25/50 (50%), Positives = 35/50 (70%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL 429
           V  D+DST IQ E IDE+AK  G G++V  +TA+AM G + F E+L+ R+
Sbjct: 181 VLMDMDSTTIQIECIDEIAKLAGVGEQVAAVTAKAMNGELDFSESLRSRV 230


>UniRef50_Q1QUG9 Cluster: Phosphoserine phosphatase SerB; n=1;
           Chromohalobacter salexigens DSM 3043|Rep: Phosphoserine
           phosphatase SerB - Chromohalobacter salexigens (strain
           DSM 3043 / ATCC BAA-138 / NCIMB13768)
          Length = 411

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           +CFD+DST+IQ E IDELA+  G  DEV  +T  +M G + FQ++ ++R+  +   +   
Sbjct: 191 ICFDMDSTLIQAEVIDELARRHGVYDEVAAVTERSMRGELDFQQSFRERMAKLEGLDESV 250

Query: 457 IREFIEKFPV 486
           +R+  E  P+
Sbjct: 251 LRDIAENLPL 260


>UniRef50_Q031D3 Cluster: Phosphoserine phosphatase; n=22;
           Bacteria|Rep: Phosphoserine phosphatase - Lactococcus
           lactis subsp. cremoris (strain SK11)
          Length = 220

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 30/74 (40%), Positives = 46/74 (62%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREF 468
           DVDST+I++E ID L +  G G+++  +T  AM G + F+EALK+R+ ++      I + 
Sbjct: 10  DVDSTLIEEEVIDLLGEKAGLGEKISEITEAAMSGELDFKEALKERVALLSGLRTTIFDE 69

Query: 469 IEKFPVRLTPGITG 510
           I K  + LT G TG
Sbjct: 70  IYK-EIHLTNGATG 82



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRL---KFYFNGEYAG 665
           L++ LH RG  V +VSGGF  +++ +A  L +    +FANRL   + Y  GE  G
Sbjct: 83  LIETLHGRGWKVGVVSGGFHEIVDKLAVDLKLD--YVFANRLAVQEGYLTGETYG 135


>UniRef50_A6DFT1 Cluster: Phosphoserine phosphatase SerB; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Phosphoserine
           phosphatase SerB - Lentisphaera araneosa HTCC2155
          Length = 295

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           + FD+DST+I+ E IDELA   G GD+VK +TA AM G + F  +  KRL ++    +  
Sbjct: 91  IAFDMDSTLIECECIDELAVKAGVGDQVKAVTAAAMRGELDFSGSFVKRLALLDGLKLEA 150

Query: 457 IREFIEKFPVRLTPGI 504
           + E  E+ P  L PG+
Sbjct: 151 LDELKEELP--LMPGM 164


>UniRef50_Q0W3U7 Cluster: Putative phosphoserine phosphatase; n=1;
           uncultured methanogenic archaeon RC-I|Rep: Putative
           phosphoserine phosphatase - Uncultured methanogenic
           archaeon RC-I
          Length = 227

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 5/64 (7%)
 Frame = +1

Query: 265 RTADC-----VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL 429
           + ADC     + FD+DSTVI  EGI ELA+  G GD V  +T  AM G + F++AL +R+
Sbjct: 9   KEADCSRKKLIIFDMDSTVIDCEGIIELARARGVGDYVADVTRRAMNGELDFEQALIERV 68

Query: 430 DIIR 441
            ++R
Sbjct: 69  KLLR 72


>UniRef50_Q0ATD9 Cluster: HAD-superfamily hydrolase, subfamily IB;
           n=1; Maricaulis maris MCS10|Rep: HAD-superfamily
           hydrolase, subfamily IB - Maricaulis maris (strain
           MCS10)
          Length = 224

 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 1/95 (1%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGE-YAGFDENEPT 686
           L+++L +RG +++ +SGGF  L+EPV   L     +I ANR  F + GE  +G D + P 
Sbjct: 90  LIRKLRDRGDVLHAISGGFADLLEPVLTDLGFGQGDIHANR--FVWTGEAVSGLDTDYPL 147

Query: 687 SRSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           SR+GG   +   L  + G     I+ G G+   EA
Sbjct: 148 SRNGGKAEI---LNSISGQAHETIMVGDGMTDFEA 179



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 8/83 (9%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDEL--AKFCGKGDE------VKRLTAEAMGGNMTFQEALKKRLDI 435
           + FDVDST+++ E +D    A   G+ D       +  +T   M G+M  +++L+ RL +
Sbjct: 5   IAFDVDSTLLRVESLDTALEAALAGREDRGAAKARLHEITRAGMSGSMALRDSLEARLQL 64

Query: 436 IRPNVGQIREFIEKFPVRLTPGI 504
              +  Q+R   E+   RLTPG+
Sbjct: 65  AALDREQVRVVGEQLRQRLTPGM 87


>UniRef50_UPI0000E499BA Cluster: PREDICTED: similar to
           O-phosphoserine phosphohydrolase Astray, partial; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           O-phosphoserine phosphohydrolase Astray, partial -
           Strongylocentrotus purpuratus
          Length = 89

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 33/47 (70%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFN 650
           LV ++ ERG  +YLV+GGF  ++   A+ LNIP  NI+AN+L F ++
Sbjct: 43  LVSKMQERGTAIYLVTGGFTCIVRSFAKELNIPVENIYANKLLFDYD 89



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 17/41 (41%), Positives = 29/41 (70%)
 Frame = +1

Query: 385 MGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGIT 507
           MGG  +++E+L+ RLD+I+P+   +  FI + P++ T GIT
Sbjct: 1   MGGQKSYKESLEARLDLIKPSKSTMERFITQTPIKFTKGIT 41


>UniRef50_Q28VU3 Cluster: Phosphoserine phosphatase SerB; n=13;
           Alphaproteobacteria|Rep: Phosphoserine phosphatase SerB
           - Jannaschia sp. (strain CCS1)
          Length = 291

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIRE 465
           D+DST+IQ E IDELA   G G  V  +TA AM G + F++AL +R+ +++  +   I  
Sbjct: 81  DMDSTMIQQECIDELADEAGVGKRVADITARAMNGELEFEDALLERVGLLKGLSEATIAT 140

Query: 466 FIEKFPVRLTPG 501
            +EK  + L PG
Sbjct: 141 VLEK-RITLMPG 151


>UniRef50_Q54ES3 Cluster: Phosphoserine phosphatase; n=1;
           Dictyostelium discoideum AX4|Rep: Phosphoserine
           phosphatase - Dictyostelium discoideum AX4
          Length = 365

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 23/52 (44%), Positives = 36/52 (69%)
 Frame = +1

Query: 286 FDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           FD+DS +I++E IDE+A   G  ++V  +TA AM G + F +AL +RL ++R
Sbjct: 103 FDMDSCIIKNECIDEMAGIMGVSEKVSMITARAMAGELDFNQALVERLSLLR 154


>UniRef50_P44997 Cluster: Phosphoserine phosphatase; n=20;
           Gammaproteobacteria|Rep: Phosphoserine phosphatase -
           Haemophilus influenzae
          Length = 314

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 26/70 (37%), Positives = 40/70 (57%)
 Frame = +1

Query: 232 DVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQE 411
           D+A  D       A  +  D+DST IQ E IDE+AK  G G+ V  +T  AM G + F++
Sbjct: 90  DIAKLDFSPKLSQAGLLVMDMDSTAIQIECIDEIAKLAGVGELVSAITESAMRGELDFEQ 149

Query: 412 ALKKRLDIIR 441
           +L+ R+  ++
Sbjct: 150 SLRCRVGTLK 159


>UniRef50_A1SXG2 Cluster: Phosphoserine phosphatase SerB; n=2;
           Psychromonas|Rep: Phosphoserine phosphatase SerB -
           Psychromonas ingrahamii (strain 37)
          Length = 369

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL-DIIRPNVGQ 456
           V  D+DST IQ E IDE+A+  G G++V  +TA AM G + F E+L+ R+  +    V  
Sbjct: 158 VLMDMDSTTIQIECIDEIARLFGVGEQVSAVTALAMQGKIDFNESLRTRVGKLAGAPVSI 217

Query: 457 IREFIEKFPVRLTPGI 504
           ++E  +  P  L PG+
Sbjct: 218 LKEVADNMP--LMPGL 231


>UniRef50_Q9RNY2 Cluster: SerB; n=3; Zymomonas mobilis|Rep: SerB -
           Zymomonas mobilis
          Length = 329

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/72 (37%), Positives = 40/72 (55%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREF 468
           D+DST I DE +DELA + G   E + +T  AM G + F E+LK R  ++      + + 
Sbjct: 120 DMDSTAIADECMDELADYAGFRKESEEITIRAMRGELNFDESLKARTKLLAGLKTSVIQE 179

Query: 469 IEKFPVRLTPGI 504
             +  + LTPGI
Sbjct: 180 CVRDRIHLTPGI 191


>UniRef50_A4C6W9 Cluster: Putative phosphoserine phosphatase; n=3;
           Alteromonadales|Rep: Putative phosphoserine phosphatase
           - Pseudoalteromonas tunicata D2
          Length = 354

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +1

Query: 178 KQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGD 357
           + P VR+  + L       +A    P        +  D+DST I+ E IDE+A+  G  D
Sbjct: 112 ENPIVRERFELLQTEVSLQLALFSTPPTLSQPGLLVMDMDSTAIEIECIDEIARLAGVYD 171

Query: 358 EVKRLTAEAMGGNMTFQEALKKRL 429
           EV ++TA+AM G + F E+L+ R+
Sbjct: 172 EVSQVTAQAMQGALEFSESLRLRV 195


>UniRef50_A1RH92 Cluster: Phosphoserine phosphatase SerB; n=10;
           Shewanella|Rep: Phosphoserine phosphatase SerB -
           Shewanella sp. (strain W3-18-1)
          Length = 331

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/62 (41%), Positives = 39/62 (62%)
 Frame = +1

Query: 244 TDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKK 423
           TD P+L      +  D+DST IQ E IDELA   G G++V  +T  AM G + F+++L++
Sbjct: 116 TDLPKL-SVPGLLVMDMDSTAIQIECIDELAAMAGVGEQVAAITERAMQGELDFEQSLRQ 174

Query: 424 RL 429
           R+
Sbjct: 175 RV 176


>UniRef50_Q6A649 Cluster: Putative phosphoserine phosphatase; n=1;
           Propionibacterium acnes|Rep: Putative phosphoserine
           phosphatase - Propionibacterium acnes
          Length = 285

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           VC DVDSTV + E ID LA+  GK DEV+ +TA AM G + F ++L  R+  +   ++G 
Sbjct: 82  VC-DVDSTVTRTEAIDLLAECAGKADEVREITARAMVGELDFTQSLYARVRCLEGLHIGA 140

Query: 457 IRE 465
           + E
Sbjct: 141 LEE 143



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERL 599
           LV   H+ G  V LVSGGF ++++P+AE++
Sbjct: 157 LVAAAHDVGAAVGLVSGGFTAVVDPLAEQI 186


>UniRef50_A4B7F8 Cluster: SerB; n=1; Alteromonas macleodii 'Deep
           ecotype'|Rep: SerB - Alteromonas macleodii 'Deep
           ecotype'
          Length = 327

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR-PNVGQIRE 465
           D+DSTVI  E IDE+AK  G G++V  +TA+AM G + F ++L  R+  +    V  +++
Sbjct: 126 DMDSTVIAIECIDEIAKLAGLGEQVAEVTAKAMRGEIAFNDSLTHRVACLEGVPVAHLKK 185

Query: 466 FIEKFPVRLTPGI 504
             +  P+   PGI
Sbjct: 186 IRDSLPI--MPGI 196


>UniRef50_A6GN83 Cluster: Phosphoserine phosphatase SerB; n=1;
           Limnobacter sp. MED105|Rep: Phosphoserine phosphatase
           SerB - Limnobacter sp. MED105
          Length = 290

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 1/106 (0%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           A+ D    L  V Q D A  +          +  D+DST+I  E IDE+A F GK  EV 
Sbjct: 51  AITDTLRPLGRVHQFDFAILEAEFQANEFKLLAMDMDSTLITIECIDEIADFAGKKKEVS 110

Query: 367 RLTAEAMGGNM-TFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
            +T  AM G +  F E+L +R+ +++       + + +  +RL+PG
Sbjct: 111 EITEAAMRGEIKDFSESLNRRVALLKGVPESCLQSVFEERLRLSPG 156


>UniRef50_UPI00015C52DD Cluster: hypothetical protein CKO_00632;
           n=1; Citrobacter koseri ATCC BAA-895|Rep: hypothetical
           protein CKO_00632 - Citrobacter koseri ATCC BAA-895
          Length = 296

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 20/63 (31%), Positives = 38/63 (60%)
 Frame = +1

Query: 253 PELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLD 432
           P+   T   + FD+DST I++EG+DE+A   G   ++  +T +AM G + F  +  +R+ 
Sbjct: 81  PQSIPTKGLIAFDMDSTFIEEEGVDEIAHTLGISAQIAEMTQQAMEGKVDFDTSFTRRIR 140

Query: 433 IIR 441
           +++
Sbjct: 141 MLK 143


>UniRef50_Q609G7 Cluster: Phosphoserine phosphatase; n=1;
           Methylococcus capsulatus|Rep: Phosphoserine phosphatase
           - Methylococcus capsulatus
          Length = 280

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 32/108 (29%), Positives = 54/108 (50%)
 Frame = +1

Query: 178 KQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGD 357
           ++PA R+  + L    + D+ P     +      +  D+DST+I  E IDELA   G+  
Sbjct: 39  ERPAERETVEVLRRSLRLDINPLPPGFVGAAVGLLVTDMDSTLIAIECIDELADRAGQRQ 98

Query: 358 EVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
            V  +T  AM G + F +AL++R+ ++R     + + +    V L PG
Sbjct: 99  AVMAITEAAMNGKLDFVQALQRRVALLRGLPVSVLQAVYAEKVVLNPG 146


>UniRef50_Q9A6J6 Cluster: Phosphoserine phosphatase; n=10;
           Alphaproteobacteria|Rep: Phosphoserine phosphatase -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 296

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 PELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLD 432
           P   R    +  D+DST+I  E +DELA F G   +V  +T  AM G + F+ AL++R+ 
Sbjct: 75  PAANRRKGLLIADMDSTIINVECLDELADFAGVKAQVSEITERAMRGELAFEGALRERVG 134

Query: 433 IIRP-NVGQIREFIEKFPVRLTPG 501
           +++   V  ++   ++  VRL PG
Sbjct: 135 MLKGLGVSALQACYDE-RVRLNPG 157


>UniRef50_Q18CY3 Cluster: Phosphoserine phosphatase; n=1;
           Clostridium difficile 630|Rep: Phosphoserine phosphatase
           - Clostridium difficile (strain 630)
          Length = 200

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 21/52 (40%), Positives = 38/52 (73%)
 Frame = +1

Query: 286 FDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           FD+DST+ + E + E++K   K + ++ LT E M GN++F+E+ KKR+D+++
Sbjct: 8   FDLDSTLTKQEILPEISKCINKYELMQNLTNETMLGNLSFEESFKKRVDLLK 59


>UniRef50_A5CRR3 Cluster: SerB2 protein; n=2; Microbacteriaceae|Rep:
           SerB2 protein - Clavibacter michiganensis subsp.
           michiganensis (strain NCPPB 382)
          Length = 232

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 28/74 (37%), Positives = 41/74 (55%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           V  DVDST+I+DE I+ LA   G  DEV  +T  AM G + F E+L+ R+  +      +
Sbjct: 26  VVLDVDSTLIEDEAIELLAAEAGSLDEVAAVTDRAMRGELDFAESLRSRVATLAGLPSSV 85

Query: 460 REFIEKFPVRLTPG 501
              +    +R+TPG
Sbjct: 86  HATVGA-RIRVTPG 98



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 21/44 (47%), Positives = 31/44 (70%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLK 638
           R+++ LHE G +V +VSGGF  L++P+AERL +      ANRL+
Sbjct: 101 RMIQGLHEAGHVVAVVSGGFHELLDPLAERLGLDLWR--ANRLE 142


>UniRef50_Q1GT41 Cluster: Phosphoserine phosphatase SerB; n=2;
           Sphingomonadaceae|Rep: Phosphoserine phosphatase SerB -
           Sphingopyxis alaskensis (Sphingomonas alaskensis)
          Length = 294

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 23/58 (39%), Positives = 37/58 (63%)
 Frame = +1

Query: 265 RTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           RT   +  D+DST+I  E IDELA + G   ++  +TA AM G + F+ AL++R+ ++
Sbjct: 76  RTKKLIVADMDSTMITVECIDELADYAGLKPQIAAITARAMNGELDFRAALEERVGLL 133


>UniRef50_Q8TZ20 Cluster: Phosphoserine phosphatase; n=1;
           Methanopyrus kandleri|Rep: Phosphoserine phosphatase -
           Methanopyrus kandleri
          Length = 217

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           V  D D T++  E ID +A+  G  DEV+ +T  AM G + F EAL++R+ ++      +
Sbjct: 8   VVLDFDGTLVDGETIDLIAEAAGVDDEVEEITRRAMRGELEFGEALRERVRLLAGTPASV 67

Query: 460 REFIEKFPVRLTPGI 504
            + +    +RL PG+
Sbjct: 68  LDEVVT-ELRLNPGV 81


>UniRef50_A5UL46 Cluster: Phosphoserine phosphatase, HAD family,
           SerB; n=1; Methanobrevibacter smithii ATCC 35061|Rep:
           Phosphoserine phosphatase, HAD family, SerB -
           Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM
           861)
          Length = 529

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 21/70 (30%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR-PNVGQ 456
           V FD+D+ +I  E IDE+ K     DE+  +T +AM G + F+ ++K R+ ++   ++  
Sbjct: 5   VVFDLDNVIIDGEAIDEIGKLANVEDEIAEITEKAMQGEIDFETSIKDRVKLLEGTSIED 64

Query: 457 IREFIEKFPV 486
           I++  ++ P+
Sbjct: 65  IQKVADELPL 74


>UniRef50_A6VUW0 Cluster: Phosphoserine phosphatase SerB; n=2;
           Marinomonas|Rep: Phosphoserine phosphatase SerB -
           Marinomonas sp. MWYL1
          Length = 303

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/59 (38%), Positives = 38/59 (64%)
 Frame = +1

Query: 265 RTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           +T     FD+DST+I+ E +DELA   G G+++  +TA AM G + F E+  +RL +++
Sbjct: 84  KTPGVAVFDMDSTLIKAEVMDELAVEAGIGEQISAVTASAMRGEIDFVESFVQRLALLK 142


>UniRef50_Q8ZNL2 Cluster: Putative phosphoserine phosphatase; n=4;
           Salmonella|Rep: Putative phosphoserine phosphatase -
           Salmonella typhimurium
          Length = 295

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 18/54 (33%), Positives = 35/54 (64%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           + FD+DST I +EG+DE+A+  G   ++  +T +AM G + F  +  +R+ +++
Sbjct: 89  IAFDMDSTFIAEEGVDEIARELGMSTQITAITQQAMEGKLDFNASFTRRIGMLK 142


>UniRef50_Q8THT3 Cluster: Phosphoserine phosphatase; n=4;
           Methanosarcinaceae|Rep: Phosphoserine phosphatase -
           Methanosarcina acetivorans
          Length = 231

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 37/54 (68%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           + FD+DST+I  E IDELA+  G   +V+ +T  AM G++ F++AL +R  +++
Sbjct: 10  IVFDMDSTLIDAETIDELARAAGVISKVEEITKRAMYGDLDFEQALAERARLLK 63


>UniRef50_Q2G627 Cluster: Phosphoserine phosphatase SerB; n=4;
           Sphingomonadales|Rep: Phosphoserine phosphatase SerB -
           Novosphingobium aromaticivorans (strain DSM 12444)
          Length = 294

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 34/51 (66%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           D+DST+I  E IDELA F G  + +  +T  AM G + F+ AL++R+ +++
Sbjct: 85  DMDSTMIGQECIDELADFAGLKERIAAITERAMQGELDFESALRERVGLLK 135


>UniRef50_Q12QF6 Cluster: Phosphoserine phosphatase SerB; n=8;
           Shewanella|Rep: Phosphoserine phosphatase SerB -
           Shewanella denitrificans (strain OS217 / ATCC BAA-1090 /
           DSM 15013)
          Length = 348

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = +1

Query: 268 TADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL 429
           T   +  D+DST I+ E IDELA   G G+EV  +T  AM G + F+++L++R+
Sbjct: 140 TPGLLVMDMDSTAIEIECIDELAALAGVGEEVAAVTELAMQGELDFEQSLRQRV 193


>UniRef50_A4IZ30 Cluster: HAD-superfamily hydrolase; n=13;
           Francisella tularensis|Rep: HAD-superfamily hydrolase -
           Francisella tularensis subsp. tularensis (strain
           WY96-3418)
          Length = 216

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDE-----LAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP 444
           + FD DST+I+ E ++      L K   K  E++ +T   M G+++F+++L+KRL I  P
Sbjct: 4   IIFDFDSTLIKKESLELILEPILQKSPAKLKEIEYITNLGMQGDISFRDSLQKRLAIASP 63

Query: 445 NVGQIREFIEKF-PVRLTPGI 504
               I+EF +K+ P  LT GI
Sbjct: 64  TKQSIKEFSDKYCPNLLTDGI 84



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDEN 677
           LV++L  +G  +++ SGG    I+P A+ LNIP  NIFA    +  +G +   D +
Sbjct: 87  LVQDLKNKGFEIWIFSGGLSESIQPFADYLNIPRENIFAVETIWNSDGSFKELDNS 142


>UniRef50_Q487B4 Cluster: Phosphoserine phosphatase; n=1; Colwellia
           psychrerythraea 34H|Rep: Phosphoserine phosphatase -
           Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 306

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/62 (40%), Positives = 37/62 (59%)
 Frame = +1

Query: 244 TDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKK 423
           T  P+L      +  D+DST I+ E IDE+AK  G G+EV  +T  AM G + F ++L +
Sbjct: 92  TQVPKL-AVPGLLVMDMDSTTIEIECIDEIAKLAGVGEEVAEVTERAMLGELDFAQSLHQ 150

Query: 424 RL 429
           R+
Sbjct: 151 RV 152


>UniRef50_A0KPD9 Cluster: Phosphoserine phosphatase; n=2;
           Aeromonas|Rep: Phosphoserine phosphatase - Aeromonas
           hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB
           9240)
          Length = 568

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/50 (42%), Positives = 35/50 (70%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           D+DST I+ E IDE+A+  G G++V  +TA AM G + F ++L+ R+ ++
Sbjct: 356 DMDSTAIRIECIDEIARLAGVGEQVAAVTAAAMQGQLEFADSLRARVALL 405


>UniRef50_Q5FRZ2 Cluster: Phosphoserine phosphatase; n=2;
           Acetobacteraceae|Rep: Phosphoserine phosphatase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 297

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREF 468
           D+DST++  E +DELA   G G++V  +T  +M G + F+ AL++R+ ++      + E 
Sbjct: 88  DMDSTIVTGETLDELADLLGCGEDVAAITRASMNGELDFETALEERVALLAGKPASVLED 147

Query: 469 IEKFPVRLTPG 501
           +    V LT G
Sbjct: 148 VWA-SVTLTEG 157


>UniRef50_Q1H030 Cluster: Phosphoserine phosphatase SerB; n=2;
           Proteobacteria|Rep: Phosphoserine phosphatase SerB -
           Methylobacillus flagellatus (strain KT / ATCC 51484 /
           DSM 6875)
          Length = 302

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 28/90 (31%), Positives = 45/90 (50%)
 Frame = +1

Query: 232 DVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQE 411
           DVA  D             D+DST+I  E IDE+A   G   +V  +T  AM G + F E
Sbjct: 71  DVALVDDQHQLNNLGLAVMDMDSTLITIECIDEIADMQGLKPQVAAITESAMRGEIEFAE 130

Query: 412 ALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
           +L++R+ +++       + +    ++LTPG
Sbjct: 131 SLRRRVALLQGLEASALQRVIDERLQLTPG 160


>UniRef50_A1SJU3 Cluster: Phosphoserine phosphatase SerB; n=10;
           Bacteria|Rep: Phosphoserine phosphatase SerB -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 420

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 31/84 (36%), Positives = 44/84 (52%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           A+R V  A       D+A      L R A  +  DVDST+IQ E I+ LA   G   EV 
Sbjct: 164 ALRTVLAAEASRQGVDIAVQPANLLRRGARLIVMDVDSTLIQGEVIEMLAAHAGCEAEVA 223

Query: 367 RLTAEAMGGNMTFQEALKKRLDII 438
           R+T  AM G + F+ +L+ R+ ++
Sbjct: 224 RVTEAAMRGEIDFEASLRARVALL 247


>UniRef50_A7EG80 Cluster: Phosphoserine phosphatase; n=7;
           Pezizomycotina|Rep: Phosphoserine phosphatase -
           Sclerotinia sclerotiorum 1980
          Length = 482

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/54 (40%), Positives = 34/54 (62%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           V FD+DST+I+ E ID +A   G  D V  +TA AM G + F  +L++R  +++
Sbjct: 266 VVFDMDSTLIEQEVIDLIAASIGVEDAVSAITARAMNGELDFSASLRERAKLLK 319


>UniRef50_Q2NFC4 Cluster: Putative phosphoserine phosphatase; n=1;
           Methanosphaera stadtmanae DSM 3091|Rep: Putative
           phosphoserine phosphatase - Methanosphaera stadtmanae
           (strain DSM 3091)
          Length = 533

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           V FD+D+ +I  E IDE+AK  G  +E+  +T +AM G + F+ ++++R+  +   +   
Sbjct: 5   VVFDLDNVLIDTETIDEIAKIKGIEEEISDITLQAMQGKIPFETSIRQRVKKLEGISTSD 64

Query: 457 IREFIEKFPVRLTPG 501
           I E ++K  + L PG
Sbjct: 65  IDEAMDK--ISLNPG 77


>UniRef50_Q5LQX0 Cluster: Phosphoserine phosphatase; n=1;
           Silicibacter pomeroyi|Rep: Phosphoserine phosphatase -
           Silicibacter pomeroyi
          Length = 297

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPN-VGQIRE 465
           D+++T+I DE +D LA+  G+G EV  +TA AM G + F ++L +R  ++    + Q+  
Sbjct: 88  DMEATIILDEMLDLLAEDRGQGAEVAAITARAMAGELDFAQSLAERTRLLAGTPLAQLEG 147

Query: 466 FIEKFPVRLTPG 501
             ++  +RL PG
Sbjct: 148 LCQR--IRLAPG 157


>UniRef50_Q12A06 Cluster: Phosphoserine phosphatase SerB; n=8;
           cellular organisms|Rep: Phosphoserine phosphatase SerB -
           Polaromonas sp. (strain JS666 / ATCC BAA-500)
          Length = 236

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 24/75 (32%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMT-FQEALKKRLDIIRPNVGQ 456
           + FD+DST+I  E +DE+A   G+  EV  +T  AM G ++ ++E+L++R+ +++     
Sbjct: 27  IAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEISDYKESLRQRVALLKGVSVA 86

Query: 457 IREFIEKFPVRLTPG 501
             + + +  +RL PG
Sbjct: 87  SMDEVYRTRLRLNPG 101


>UniRef50_A7TEU0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 305

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 25/86 (29%), Positives = 49/86 (56%)
 Frame = +1

Query: 181 QPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDE 360
           +P + D+ D+  G+D   +  TD     +    + FD+DST+I  E I+ +A +    D+
Sbjct: 58  KPLLADIIDSAQGIDV--IVQTDGTNR-QDKKLIVFDMDSTLIYQEVIEMIASYADVEDK 114

Query: 361 VKRLTAEAMGGNMTFQEALKKRLDII 438
           V+ +T  AM   + F+E+L++R+ ++
Sbjct: 115 VRDITNLAMNNEIDFKESLRQRVKLL 140


>UniRef50_Q9HMR1 Cluster: Phosphoserine phosphatase; n=2;
           Halobacteriaceae|Rep: Phosphoserine phosphatase -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 235

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 19/53 (35%), Positives = 33/53 (62%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           V FD D T+ + E +D +A   G GDEV  +T  AM G +++ ++L++R  ++
Sbjct: 28  VAFDFDGTLAESEMLDRIAARAGVGDEVAAITERAMRGELSYADSLRERAQLV 80


>UniRef50_A5WHI3 Cluster: Phosphoserine phosphatase SerB; n=3;
           Psychrobacter|Rep: Phosphoserine phosphatase SerB -
           Psychrobacter sp. PRwf-1
          Length = 435

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 256 ELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDI 435
           ++ R      FD+DST+I+ E I ELAK    GD+V  +T  AM G + F  +  +R+ +
Sbjct: 217 KMLRPHRVAVFDMDSTLIEQEVIVELAKHANIGDQVSEITESAMRGEIDFDTSFTERVAL 276

Query: 436 I 438
           +
Sbjct: 277 L 277


>UniRef50_Q7VK14 Cluster: Phosphoserine phosphatase; n=9;
           Proteobacteria|Rep: Phosphoserine phosphatase -
           Helicobacter hepaticus
          Length = 199

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +1

Query: 286 FDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII-RPNVGQIR 462
           FD+D T+ ++E + ++AKF     E+  LT E + GN+ F E+   R++I+ +  V +I 
Sbjct: 6   FDLDGTITKEETLPKIAKFFNVQAEIDNLTQETIAGNIPFMESFISRVNILGKLPVDKIA 65

Query: 463 EFIEKFPV 486
           + +E+  +
Sbjct: 66  DLLEQIEI 73


>UniRef50_A7BCN9 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 227

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRL 429
           V  DVDST+I+ E I+ELA+  G    V  +T+ AM G + F E+L++R+
Sbjct: 22  VVTDVDSTLIRQEVIEELAEAAGTRARVAEVTSRAMNGELDFAESLRERV 71


>UniRef50_A6EAP2 Cluster: Phosphoserine phosphatase and
           phosphoglycerate dehydrogenase (D-3- phosphoglycerate
           dehydrogenase) fusion; n=1; Pedobacter sp. BAL39|Rep:
           Phosphoserine phosphatase and phosphoglycerate
           dehydrogenase (D-3- phosphoglycerate dehydrogenase)
           fusion - Pedobacter sp. BAL39
          Length = 432

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 543 VYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTSRSGGXXLVVRR 722
           V +VSGGF+  I PV  + +I   NI+AN      +G+   +D + P S  GG   ++++
Sbjct: 103 VLIVSGGFKEFITPVVSQYHIKKENIYANTFVTTGDGKIIDYDHSNPLSEEGGKVKLMKQ 162

Query: 723 L 725
           L
Sbjct: 163 L 163


>UniRef50_Q7NSB0 Cluster: Phosphoserine phosphatase; n=3;
           Proteobacteria|Rep: Phosphoserine phosphatase -
           Chromobacterium violaceum
          Length = 213

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIRE 465
           D+DST+I  E IDE+A   G   +V  +T  AM G + F  AL++R+ +++  +   +R+
Sbjct: 12  DMDSTLINIECIDEIADIKGIKPQVAEITERAMRGELDFAAALRERVALLKGLDESALRQ 71

Query: 466 FIEKFPVRLTPG 501
             E+  +RL PG
Sbjct: 72  VYEE-RLRLNPG 82


>UniRef50_Q3J889 Cluster: Phosphoserine phosphatase SerB; n=1;
           Nitrosococcus oceani ATCC 19707|Rep: Phosphoserine
           phosphatase SerB - Nitrosococcus oceani (strain ATCC
           19707 / NCIMB 11848)
          Length = 278

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQIRE 465
           D+DST I  E I+E+A F GK  +V  +T  AM G + F+ +L +R+ ++   ++  + E
Sbjct: 77  DMDSTFINIECINEIAAFAGKEAQVSAITTAAMRGEINFETSLIQRVKLLAGISINVLAE 136

Query: 466 FIEKFPVRLTPG 501
             EK  + + PG
Sbjct: 137 IYEK-RLTINPG 147


>UniRef50_A4SXD0 Cluster: Phosphoserine phosphatase SerB; n=1;
           Polynucleobacter sp. QLW-P1DMWA-1|Rep: Phosphoserine
           phosphatase SerB - Polynucleobacter sp. QLW-P1DMWA-1
          Length = 296

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNM-TFQEALKKRLDIIRPNVGQ 456
           +  D+DST+I  E IDE+A F GK   V  +T   M G +  F+E+L++R+ ++      
Sbjct: 91  LAMDMDSTLINIECIDEIADFTGKKSAVAEITEATMRGEIKDFKESLRRRVALLEGVHAD 150

Query: 457 IREFIEKFPVRLTPG 501
             E + +  +R  PG
Sbjct: 151 ALEAVYRERLRPNPG 165


>UniRef50_P42941 Cluster: Phosphoserine phosphatase; n=3;
           Saccharomycetaceae|Rep: Phosphoserine phosphatase -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 309

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/87 (28%), Positives = 49/87 (56%), Gaps = 4/87 (4%)
 Frame = +1

Query: 193 RDVEDALTGV----DQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDE 360
           +D+++ LT V    +  DV  +   E  +      FD+DST+I  E I+ +A + G  ++
Sbjct: 61  KDLKNKLTNVIDSHNDVDVIVSVDNEYRQAKKLFVFDMDSTLIYQEVIELIAAYAGVEEQ 120

Query: 361 VKRLTAEAMGGNMTFQEALKKRLDIIR 441
           V  +T  AM   + F+E+L++R+ +++
Sbjct: 121 VHEITERAMNNELDFKESLRERVKLLQ 147


>UniRef50_A5EXY1 Cluster: Putative uncharacterized protein; n=1;
           Dichelobacter nodosus VCS1703A|Rep: Putative
           uncharacterized protein - Dichelobacter nodosus (strain
           VCS1703A)
          Length = 224

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/76 (27%), Positives = 41/76 (53%)
 Frame = +1

Query: 274 DCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVG 453
           D + FD D+T+    GID LA F  K  E+ ++  +   G+++ + A +KR+D + P+  
Sbjct: 8   DGIVFDCDATLSAVAGIDALADFKHKEKEIAKINNQLKVGSISAEVAYRKRIDALTPSRS 67

Query: 454 QIREFIEKFPVRLTPG 501
            +     ++  ++T G
Sbjct: 68  DLEILANRYLEQITEG 83


>UniRef50_Q31F61 Cluster: Phosphoserine phosphatase; n=1;
           Thiomicrospira crunogena XCL-2|Rep: Phosphoserine
           phosphatase - Thiomicrospira crunogena (strain XCL-2)
          Length = 275

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +1

Query: 253 PELFRTADC--VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKR 426
           PE F  AD   +  D+DST+I  E +DE+A       +V  +T  AM G + F+ +L KR
Sbjct: 60  PEHFNAADIKLLISDMDSTLIGIECVDEIADMMDLKPQVSEITEAAMRGELNFESSLTKR 119

Query: 427 LDIIR 441
           + +++
Sbjct: 120 VALLK 124


>UniRef50_Q9JZM9 Cluster: Phosphoserine phosphatase; n=4;
           Neisseria|Rep: Phosphoserine phosphatase - Neisseria
           meningitidis serogroup B
          Length = 277

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 28/106 (26%), Positives = 58/106 (54%), Gaps = 1/106 (0%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPEL-FRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEV 363
           ++ + + AL G  Q D A    P++ F     +  D+DST+I  E +DE+A   G  ++V
Sbjct: 43  SLSEKDAALLGSRQIDHAVL--PDMDFDELGLIVSDMDSTLITIECVDEIAAGVGLKNKV 100

Query: 364 KRLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPG 501
             +T  +M G + F+++L+ R+ ++     ++   + +  ++L+PG
Sbjct: 101 AEITERSMRGELDFEQSLRSRVALLAGLDERVLADVYENVLKLSPG 146


>UniRef50_Q7MVA7 Cluster: SerB family protein; n=1; Porphyromonas
           gingivalis|Rep: SerB family protein - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 290

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRP-NVGQ 456
           V FD+DST+++ E ++ELA   G  DE+  LT  AM G   F +   +R+ ++R   + +
Sbjct: 90  VAFDLDSTLVRTEIMNELATAHGCLDEMGELTEAAMSGREEFPDNFSRRVSMLRGLPLAK 149

Query: 457 IREFIEKFPV 486
           + E     P+
Sbjct: 150 LEELSASLPI 159


>UniRef50_A2TIR8 Cluster: Receptor for egg jelly protein 9; n=9;
           cellular organisms|Rep: Receptor for egg jelly protein 9
           - Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 2965

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 26/82 (31%), Positives = 44/82 (53%)
 Frame = -2

Query: 431 SSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSG 252
           SS F  +SW+   P  +S+ S   SSP   + + SS  SS  +  S+S  + S+  ++S 
Sbjct: 545 SSSFLSSSWSSSFPSFSSSSSSSWSSPSSSSSSGSSSSSSSSSSSSSSSSSSSSSSSSSS 604

Query: 251 QSVGATSR*STPVRASSTSRTA 186
            S  ++SR S+   +SS S ++
Sbjct: 605 SSSSSSSRSSSSWSSSSLSSSS 626


>UniRef50_Q0C510 Cluster: Phosphoserine phosphatase SerB; n=1;
           Hyphomonas neptunium ATCC 15444|Rep: Phosphoserine
           phosphatase SerB - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 299

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           D+DST+I  E IDE+A   G   ++  +T  AM G + F+ AL +R+ +++
Sbjct: 89  DMDSTIIGQECIDEIADAVGLKAKISEITERAMRGELDFEAALTERVAMLK 139


>UniRef50_A3LND7 Cluster: Phosphoserine phosphatase activity; n=6;
           Saccharomycetales|Rep: Phosphoserine phosphatase
           activity - Pichia stipitis (Yeast)
          Length = 306

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = +1

Query: 286 FDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           FD+DST+I  E I+ +A +    D+V  +T  AM G + F  +L +R+ +++
Sbjct: 92  FDMDSTLIYQEVIELIAAYANIEDKVAEITERAMNGELDFNASLAERVSLLK 143


>UniRef50_Q86U85 Cluster: Phosphoserine phosphatase-like; n=2; Homo
           sapiens|Rep: Phosphoserine phosphatase-like - Homo
           sapiens (Human)
          Length = 91

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGI 324
           R ++ ++  +LF +AD VCFDVDSTVI +EGI
Sbjct: 24  RMISHSELRKLFYSADAVCFDVDSTVISEEGI 55


>UniRef50_O15172 Cluster: Phosphoserine phosphatase-like protein;
           n=2; Homo/Pan/Gorilla group|Rep: Phosphoserine
           phosphatase-like protein - Homo sapiens (Human)
          Length = 72

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGI 324
           R ++ ++  +LF +AD VCFDVDSTVI +EGI
Sbjct: 24  RMISHSELRKLFYSADAVCFDVDSTVISEEGI 55


>UniRef50_A1AVU6 Cluster: Phosphoserine phosphatase SerB; n=2;
           sulfur-oxidizing symbionts|Rep: Phosphoserine
           phosphatase SerB - Ruthia magnifica subsp. Calyptogena
           magnifica
          Length = 269

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           D+DST+I  E IDE++ F     +V  +T  AM G + F ++L +R+ +++
Sbjct: 67  DMDSTLINIECIDEISDFANIKPQVAAITELAMQGKLDFDDSLIERVSLLK 117


>UniRef50_Q82X56 Cluster: Possible serB; phosphoserine phosphatase
           protein; n=5; Betaproteobacteria|Rep: Possible serB;
           phosphoserine phosphatase protein - Nitrosomonas
           europaea
          Length = 276

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIRPNVGQI 459
           +  D+DST++  E IDE+A       +V  +T   M G ++F E+L +R  ++     + 
Sbjct: 72  IAMDMDSTLLAIESIDEIADMHNVKPQVSAITQSTMRGEISFAESLTRRTALLEGLPQEA 131

Query: 460 REFIEKFPVRLTPG 501
            + +    VRL  G
Sbjct: 132 LQKVYDERVRLNRG 145


>UniRef50_A5G8S0 Cluster: Uncharacterized protein-like protein; n=1;
           Geobacter uraniumreducens Rf4|Rep: Uncharacterized
           protein-like protein - Geobacter uraniumreducens Rf4
          Length = 227

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +1

Query: 145 RSNRDGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGI 324
           R N +  + F KQP    V+  LT V    ++P +  EL+R   C+  D  S V Q EG+
Sbjct: 2   RHNNNALIVFAKQPIAGKVKTRLTTV----LSPEEAAELYR---CMLIDTLSKVKQLEGV 54

Query: 325 DELAKFCGKGDEVKRLTAEAMG 390
           D    F G GD        A G
Sbjct: 55  DIYLFFEGNGDAASYFATIAAG 76


>UniRef50_Q6FW57 Cluster: Candida glabrata strain CBS138 chromosome
           D complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome D complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 463

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 28/83 (33%), Positives = 41/83 (49%)
 Frame = -2

Query: 404 NVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR* 225
           + I+PP  S+ +  +S+P   + AS+S  S+  +  STS  T S    +S  S  +TS  
Sbjct: 104 SAIIPPRKSSNTAQSSTPSSTSAASTSSTSTSTSSTSTS-STSSTSSTSSTSSTSSTSTS 162

Query: 224 STPVRASSTSRTAGCFSNCKEPS 156
           ST   +SSTS T         PS
Sbjct: 163 STSSSSSSTSSTRSSSRTTLAPS 185


>UniRef50_A4XW77 Cluster: HAD-superfamily hydrolase, subfamily IB;
           n=4; Pseudomonas aeruginosa group|Rep: HAD-superfamily
           hydrolase, subfamily IB - Pseudomonas mendocina ymp
          Length = 201

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = +1

Query: 283 CFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           CFD+D T+ + E +  +A   G  DE+  LT   + G + F ++ K R+ ++R
Sbjct: 6   CFDLDGTLTRQELLPLIASSVGLEDEISVLTQATIDGLLPFDKSFKLRVRLLR 58


>UniRef50_Q0BS21 Cluster: Phosphoserine phosphatase; n=1;
           Granulibacter bethesdensis CGDNIH1|Rep: Phosphoserine
           phosphatase - Granulobacter bethesdensis (strain ATCC
           BAA-1260 / CGDNIH1)
          Length = 296

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 16/51 (31%), Positives = 32/51 (62%)
 Frame = +1

Query: 289 DVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           D+DST++  E +D +A   G G EV  L+  ++ G + F  +L++R+ +++
Sbjct: 93  DMDSTIVVGETLDRIAALHGCGAEVTALSQASVEGQIDFASSLRRRILLLQ 143


>UniRef50_Q2H4F1 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 900

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           I PP+ ++ +  ++S      +S+S  SS  T  STS  T ++   ++  +   ++  ST
Sbjct: 406 IPPPVTTSTTSTSTSSSTSTSSSTSTSSSTSTSTSTSTSTSTSTSTSTSTTTSTSTSTST 465

Query: 218 PVRAS-STSRTAGCFSNCKEPS 156
              AS STS +    S   EPS
Sbjct: 466 STSASTSTSTSTSTTSTTAEPS 487


>UniRef50_UPI0000DC0D54 Cluster: Immediate early response
           3-interacting protein 1.; n=6; Murinae|Rep: Immediate
           early response 3-interacting protein 1. - Rattus
           norvegicus
          Length = 860

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           ++ P    VS  +SS  P + +SSS  SS  +  S+S  + S+  ++S  S  ++S  S+
Sbjct: 685 VVAPSVVVVSSFSSSSSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 744

Query: 218 PVRASSTSRTA 186
           P   SS+S ++
Sbjct: 745 PSSFSSSSSSS 755


>UniRef50_A3FII3 Cluster: Phosphoserine phosphatase; n=5;
           pseudomallei group|Rep: Phosphoserine phosphatase -
           Burkholderia pseudomallei (Pseudomonas pseudomallei)
          Length = 202

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 15/54 (27%), Positives = 31/54 (57%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           +CFD+D T+ + E +  +A+     +E+  LT   + G + F+ + K R+ ++R
Sbjct: 6   ICFDLDGTLSKQEILPRIAELADISEEIAALTQATIQGVIPFEMSFKLRVRLLR 59


>UniRef50_Q96WV6 Cluster: Glycoprotein; n=1; Schizosaccharomyces
            pombe|Rep: Glycoprotein - Schizosaccharomyces pombe
            (Fission yeast)
          Length = 3971

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2303 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2362

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2363 PITSSTALNTS 2373



 Score = 36.7 bits (81), Expect = 0.79
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 2711 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 2770

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2771 PITSSTALNTS 2781



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTV-ESTSKQTQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  TV  S++  T S+VLN+S     +T    ST
Sbjct: 1067 PITSSTALNTSTPITSSSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 1126

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1127 PITSSTALNTS 1137



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 1583 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 1642

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1643 PITSSTALNTS 1653



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 1847 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 1906

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1907 PITSSTALNTS 1917



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 2039 PITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTVLNSST 2098

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 2099 PITSSTALNTS 2109



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+P   + + +SS P +  T  +TS   T S+VLN+S     +T    ST
Sbjct: 911  PITSSTALNTSTPITSSSVLNSSTPITSSTGLNTSTPITSSSVLNSSTPITSSTVLNSST 970

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 971  PITSSTALNTS 981



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQN-LASSSMPSSCMTVESTSKQ-TQSAVLNNSGQSVGAT-SR*ST 219
            PI S+ +L TS+    + + +SS P +  TV +TS   T S+VLN+S     +T    ST
Sbjct: 1295 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNSST 1354

Query: 218  PVRASSTSRTA 186
            P+ +S+   T+
Sbjct: 1355 PITSSTVVNTS 1365


>UniRef50_A4UBV9 Cluster: Cation-transporting ATPase; n=1; Magnaporthe
            grisea|Rep: Cation-transporting ATPase - Magnaporthe
            grisea (Rice blast fungus) (Pyricularia grisea)
          Length = 1157

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +3

Query: 510  LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINI 620
            +VK+L  RG+ V+LVSG  +  +E VA ++ IP  N+
Sbjct: 953  VVKQLQRRGISVHLVSGDQKRAVEAVAAQVGIPQSNV 989


>UniRef50_Q552T8 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 657

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 20/59 (33%), Positives = 29/59 (49%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           TSSP   + +S++ PS+  T  +TS  T S     S  +   TS  S    + STS T+
Sbjct: 519 TSSPSTSSTSSTTSPSTASTTSTTSPSTASTTSTTSPSTASTTSTTSPSTASPSTSSTS 577



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVG-ATSR*STPV 213
           P  S+ S  T+SP   +  S++ PS+  T  +TS  T S     S  +   +TS  S   
Sbjct: 522 PSTSSTSS-TTSPSTASTTSTTSPSTASTTSTTSPSTASTTSTTSPSTASPSTSSTSLTS 580

Query: 212 RASSTSRTAGCFSNCKEPS 156
             SST++TA   S+    S
Sbjct: 581 STSSTTKTASSSSSLSSTS 599



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           P  AS  S  T+SP   +  S++ PS+  T  +TS  T S   +++  +   +S   T  
Sbjct: 533 PSTASTTS--TTSPSTASTTSTTSPSTASTTSTTSPSTASPSTSSTSLTSSTSSTTKTAS 590

Query: 212 RASSTSRTAG 183
            +SS S T+G
Sbjct: 591 SSSSLSSTSG 600



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           TSS    + +S+S PS+  T  +TS  T S     S  +   TS  ++P  AS+TS T+
Sbjct: 508 TSSSSTTSSSSTSSPSTSSTSSTTSPSTASTTSTTSPSTASTTST-TSPSTASTTSTTS 565


>UniRef50_A6RCP4 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 1806

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 22/59 (37%), Positives = 27/59 (45%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQISMLARFHRSQRIH 652
           PPKP KPS  G   + SVA V G +  A T  I S++   N  H  S     H    +H
Sbjct: 362 PPKPSKPSKPGGPGKPSVA-VAGVAGAAATYGISSLMGSSNEHHSTSPPFSPHHESTLH 419


>UniRef50_UPI000050F70E Cluster: COG0560: Phosphoserine phosphatase;
           n=1; Brevibacterium linens BL2|Rep: COG0560:
           Phosphoserine phosphatase - Brevibacterium linens BL2
          Length = 226

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRL 635
           LV  +   G +V LVSGGF  +I PVAE + I    +FAN L
Sbjct: 94  LVAAVQSGGGVVALVSGGFTQIIAPVAEAMGI--TEVFANGL 133


>UniRef50_Q6UUM5 Cluster: Putative mucin; n=5; Oryza sativa
           (japonica cultivar-group)|Rep: Putative mucin - Oryza
           sativa subsp. japonica (Rice)
          Length = 438

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 6/88 (6%)
 Frame = -2

Query: 404 NVILPPIASAVSLLT--SSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSG---QSVG 240
           +V LP  A+A+   T  +SP PQ++A + +P S     + +  T S +         S+G
Sbjct: 178 SVALPSHAAAMPHCTPSTSPLPQSIAETPLPHSPSLSATVAHYTASPLRPTPHCVVASIG 237

Query: 239 ATSR*STPVRASSTSRTAG-CFSNCKEP 159
           +     TP  A   S T G CF +C  P
Sbjct: 238 SARTMRTPAAARFASSTTGICFPSCTAP 265


>UniRef50_Q55G46 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 827

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SSP      SSS PSS  +  S+S  + S+  ++S  S  ++S  S+ + + 
Sbjct: 572 SSSSSTSSSSPSSSTSTSSSSPSSSTSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSLPSK 631

Query: 203 STS 195
           STS
Sbjct: 632 STS 634


>UniRef50_Q54E70 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 229

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = -2

Query: 365 LTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           LT  P P   +SSS P++  T  STS  T +   + SG S  AT    TP   ++TS + 
Sbjct: 35  LTFHPLPTTPSSSSAPTT--TTSSTSAPTTTTTTSTSGGS-QATEPAETPTTTTTTSTSG 91

Query: 185 GCFSNCKEPS 156
           G  S   EP+
Sbjct: 92  G--SQATEPA 99


>UniRef50_Q6CBU0 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 812

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 21/65 (32%), Positives = 37/65 (56%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P++S+  + +SSP   N  SSS  S   +  S+S  + S+  ++S  S  ++S  S+P  
Sbjct: 387 PVSSSSPVSSSSPSSSNPGSSSSSSPSSSSPSSSSSSPSSSSSSSSPSSSSSSSSSSPSS 446

Query: 209 ASSTS 195
           +SS+S
Sbjct: 447 SSSSS 451


>UniRef50_A5DNX6 Cluster: Predicted protein; n=1; Pichia
           guilliermondii|Rep: Predicted protein - Pichia
           guilliermondii (Yeast) (Candida guilliermondii)
          Length = 891

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTS-KQTQSAVLNNSGQSVGATSR*STPVRAS 204
           S+ S L SS   ++++SSS+PSS  T+ S S   T+S++ ++S   +   S  S+   +S
Sbjct: 174 SSTSSLESSLSSESVSSSSIPSSLSTLSSLSLSTTESSITSSSEVPLATISLLSSETFSS 233

Query: 203 STSRTAGCFSN 171
           S S ++  FS+
Sbjct: 234 SVSSSSLVFSS 244


>UniRef50_Q2LGV0 Cluster: Phosphoserine phosphatase; n=4;
           Halobacteriaceae|Rep: Phosphoserine phosphatase -
           Haloquadratum walsbyi
          Length = 211

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           + FD D T+   E    L   CG  DE++ +T  AM   +++ ++L++R  ++
Sbjct: 4   IAFDFDGTLSDSEMTVLLGGRCGVADEMESITDRAMNDELSYAQSLRRRAALL 56


>UniRef50_A2SQX4 Cluster: Haloacid dehalogenase domain protein
           hydrolase; n=1; Methanocorpusculum labreanum Z|Rep:
           Haloacid dehalogenase domain protein hydrolase -
           Methanocorpusculum labreanum (strain ATCC 43576 / DSM
           4855 / Z)
          Length = 274

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIF 623
           ++  LH++GV VY+ SG   S +E +A+++ IP   ++
Sbjct: 156 MISMLHQKGVAVYIASGDRTSKLELIADKIGIPRERVY 193


>UniRef50_UPI0000397724 Cluster: COG5295: Autotransporter adhesin;
            n=1; Haemophilus somnus 2336|Rep: COG5295:
            Autotransporter adhesin - Haemophilus somnus 2336
          Length = 3391

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = -2

Query: 332  SSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCK 165
            S+   ++ MT  +TS  + SAV +  G S G+TS  +T   +SST+++ G  +N K
Sbjct: 2626 SAGSSATSMTAPTTSTPSSSAVGSIGGDSAGSTSTTTTSNSSSSTAQSNGAGTNGK 2681


>UniRef50_Q03WA3 Cluster: Exopolysaccharide biosynthesis protein;
           n=1; Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293|Rep: Exopolysaccharide biosynthesis protein -
           Leuconostoc mesenteroides subsp. mesenteroides (strain
           ATCC 8293 /NCDO 523)
          Length = 347

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 21/73 (28%), Positives = 30/73 (41%)
 Frame = +3

Query: 474 EISS*TNSWYYRLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNG 653
           E+S  T  W YR +K   +   I+ L  GG    I PV E +    + IF  +    F  
Sbjct: 66  EVSELTKDWQYRYLKNKMKSNDIIILPGGGNFGDIWPVTEEIRQKIVTIFMGKKIISFPQ 125

Query: 654 EYAGFDENEPTSR 692
            Y+  D+     R
Sbjct: 126 SYSFSDKKSDILR 138


>UniRef50_Q4FX64 Cluster: Proteophosphoglycan ppg3, putative; n=3;
            Leishmania|Rep: Proteophosphoglycan ppg3, putative -
            Leishmania major strain Friedlin
          Length = 1435

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 1057 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 1116

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 1117 APSASSSSAPSSSSSAPS 1134



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 731 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 790

Query: 209 A-SSTSRTAGCFSNCKEPS 156
           A S++S +A   S+   PS
Sbjct: 791 APSASSSSAPSSSSSSAPS 809


>UniRef50_Q4FX62 Cluster: Proteophosphoglycan 5; n=5; Eukaryota|Rep:
            Proteophosphoglycan 5 - Leishmania major strain Friedlin
          Length = 17392

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 853  PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 912

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 913  APSASSSSAPSSSSSAPS 930



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 2822 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 2881

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 2882 APSASSSSAPSSSSSAPS 2899



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 2975 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 3034

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 3035 APSASSSSAPSSSSSAPS 3052



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 3036 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 3095

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 3096 APSASSSSAPSSSSSAPS 3113



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 4262 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 4321

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 4322 APSASSSSAPSSSSSAPS 4339



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 6437 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 6496

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 6497 APSASSSSAPSSSSSAPS 6514



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 6498 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 6557

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 6558 APSASSSSAPSSSSSAPS 6575



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 7308 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 7367

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 7368 APSASSSSAPSSSSSAPS 7385



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 7463 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 7522

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 7523 APSASSSSAPSSSSSAPS 7540



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 7586 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 7645

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 7646 APSASSSSAPSSSSSAPS 7663



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 8330 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 8389

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 8390 APSASSSSAPSSSSSAPS 8407



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 13371 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSST 13430

Query: 209   ASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 13431 APSASSSSAPSSSSSAPS 13448



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    +  SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 7073 PSASSSSAPSSSSSAPSACSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 7132

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 7133 APSASSSSAPSSSSSAPS 7150



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSM-PSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
            P AS+ S  +SS     LASSS  PSS  T  S S  +  +  ++S  S  ++S  S+  
Sbjct: 5022 PSASSSSAPSSSSSSAPLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSS 5081

Query: 212  RASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 5082 SAPSASSSSAPSSSSSAPS 5100



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSM-PSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
            P AS+ S  +SS     LASSS  PSS  T  S S  +  +  ++S  S  ++S  S+  
Sbjct: 5787 PSASSSSAPSSSSSSAPLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSS 5846

Query: 212  RASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 5847 SAPSASSSSAPSSSSSAPS 5865



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S   +S  S+   
Sbjct: 11205 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASPSSAPSSSSS 11264

Query: 209   ASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 11265 APSASSSSAPSSSSSAPS 11282



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           P  +S+ +  +SS    + +SSS PSS  +  S S  +  +  ++S  SV ++S  S+  
Sbjct: 355 PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSVSSSSAPSSSS 414

Query: 212 RASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 415 SAPSASSSSAPSSSSSAPS 433



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P AS+ S  +SS    + +SSS PSS  +  S S  +  +  +++  S  ++S  S+   
Sbjct: 560 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSS 619

Query: 209 ASSTSRTAGCFSNCKEPS 156
           A S S ++   S+   PS
Sbjct: 620 APSASSSSAPSSSSSAPS 637



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 2329 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSGSSSSAPSSSSS 2388

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 2389 APSASSSSAPSSSSSAPS 2406



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 3733 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSGSSSSAPSSSSS 3792

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 3793 APSASSSSAPSSSSSAPS 3810



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  +++  S  ++S  S+   
Sbjct: 6221 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSS 6280

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 6281 APSASSSSAPSSSSSAPS 6298



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  +++  S  ++S  S+   
Sbjct: 8376 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSTAPSASSSSAPSSSSS 8435

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 8436 APSASSSSAPSSSSSAPS 8453



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/78 (29%), Positives = 40/78 (51%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S++  + +   ++S  S  ++S  S+   
Sbjct: 12593 PSASSSSAPSSSSSAPSASSSSAPSSSSSSASSASSSSAPSSSSSAPSASSSSAPSSSSS 12652

Query: 209   ASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 12653 APSASSSSAPSSSSSAPS 12670



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P+AS+ S  +SS     LASSS   S  +  + S  + SA  ++S  +  A+S  S P  
Sbjct: 464 PLASSSSAPSSSSSSAPLASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSS-SAPSS 522

Query: 209 ASSTSRTAGCFS 174
           +SST+ +A   S
Sbjct: 523 SSSTAPSASSSS 534



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P+AS+ S  +SS    + +SSS PSS  +   ++  + +   ++S  S  ++S  S+   
Sbjct: 5038 PLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 5097

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 5098 APSASSSSAPSSSSSAPS 5115



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P+AS+ S  +SS    + +SSS PSS  +   ++  + +   ++S  S  ++S  S+   
Sbjct: 5803 PLASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 5862

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 5863 APSASSSSAPSSSSSAPS 5880



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS      +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 8160 PSASSSSAPSSSSSAPLASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 8219

Query: 209  ASSTSRTAGCFSNCKEPS 156
            A S S ++   S+   PS
Sbjct: 8220 APSASSSSAPSSSSSAPS 8237



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -2

Query: 392   PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
             P  +S+ +  +SS    + +SSS PSS  T  S S  +  +  ++S  S  ++S  S+  
Sbjct: 16613 PSASSSSAPSSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSS 16672

Query: 212   RASSTSRTAGCFSNCKEPS 156
              A S S ++   S+   PS
Sbjct: 16673 SAPSASSSSAPSSSSTAPS 16691



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 621 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 680

Query: 209 A-SSTSRTAGCFSNCKEPS 156
           A S++S +A   S+   PS
Sbjct: 681 APSASSSSAPSSSSSSAPS 699



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 698 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 757

Query: 209 A-SSTSRTAGCFSNCKEPS 156
           A S++S +A   S+   PS
Sbjct: 758 APSASSSSAPSSSSSSAPS 776



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 1611 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 1670

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 1671 APSASSSSAPSSSSSSAPS 1689



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 2714 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 2773

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 2774 APSASSSSAPSSSSSSAPS 2792



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 3469 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 3528

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 3529 APSASSSSAPSSSSSSAPS 3547



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  T  S S  +  +  ++S  S  ++S  S+   
Sbjct: 4884 PSASSSSAPSSSSSAPSASSSSAPSSSSTAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 4943

Query: 209  ASSTSRTA 186
            A S S ++
Sbjct: 4944 APSASSSS 4951



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 7990 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 8049

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 8050 APSASSSSAPSSSSSSAPS 8068



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 8657 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 8716

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 8717 APSASSSSAPSSSSSSAPS 8735



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 9223 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 9282

Query: 209  A-SSTSRTAGCFSNCKEPS 156
            A S++S +A   S+   PS
Sbjct: 9283 APSASSSSAPSSSSSSAPS 9301



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 10258 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 10317

Query: 209   A-SSTSRTAGCFSNCKEPS 156
             A S++S +A   S+   PS
Sbjct: 10318 APSASSSSAPSSSSSSAPS 10336



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  T  S S  +  +  ++S  S  ++S  S+   
Sbjct: 10596 PSASSSSAPSSSSSAPSASSSSAPSSSSTAPSASSSSAPS-SSSSAPSASSSSAPSSSSS 10654

Query: 209   ASSTSRTAGCFSNCKEPS 156
             A S S ++   S+   PS
Sbjct: 10655 APSASSSSAPSSSSSAPS 10672



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 13462 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 13521

Query: 209   A-SSTSRTAGCFSNCKEPS 156
             A S++S +A   S+   PS
Sbjct: 13522 APSASSSSAPSSSSSSAPS 13540



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS+ S  +SS    + +SSS PSS  +  S S  +  +  ++S  S  ++S  S+   
Sbjct: 14040 PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 14099

Query: 209   A-SSTSRTAGCFSNCKEPS 156
             A S++S +A   S+   PS
Sbjct: 14100 APSASSSSAPSSSSSSAPS 14118



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/72 (34%), Positives = 41/72 (56%)
 Frame = -2

Query: 389   PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
             P AS++S  +SS    + +SSS PSS  +  S S  + SA  ++S  ++ A+S  S P  
Sbjct: 16253 PSASSLSAPSSSSSAPSASSSSAPSSSSSAPSAS--SSSAPSSSSSSALSASSS-SAPSS 16309

Query: 209   ASSTSRTAGCFS 174
             +SS++ +A   S
Sbjct: 16310 SSSSAPSASSSS 16321


>UniRef50_Q685J3 Cluster: Mucin-17; n=14; Amniota|Rep: Mucin-17 - Homo
            sapiens (Human)
          Length = 4493

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
            PP A   S+ TS+P   +   +SMP S  TV S+   T S    ++   V   S+  S+P
Sbjct: 3263 PPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSP 3322

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS     +S    P
Sbjct: 3323 PIADGTSMPTSTYSEGSTP 3341


>UniRef50_UPI00015BABC5 Cluster: HAD-superfamily hydrolase,
           subfamily IB (PSPase-like); n=1; Ignicoccus hospitalis
           KIN4/I|Rep: HAD-superfamily hydrolase, subfamily IB
           (PSPase-like) - Ignicoccus hospitalis KIN4/I
          Length = 208

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAG 665
           L+ EL +R  +  +VSGGF   + PVA  L    ++ + ++   Y NG   G
Sbjct: 81  LISELKKRQYVTMIVSGGFEEFVAPVAHALG---VDDYVSQKLIYHNGVIVG 129


>UniRef50_UPI0001553895 Cluster: PREDICTED: similar to C6orf205
           protein; n=2; Mus musculus|Rep: PREDICTED: similar to
           C6orf205 protein - Mus musculus
          Length = 1210

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 26/89 (29%), Positives = 42/89 (47%)
 Frame = -2

Query: 452 PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQS 273
           PTL   +SS     S +   P   ++ +   S+P P   ASS+   S  T+ +T+  + S
Sbjct: 191 PTLTTTVSST---VSDSTPTPTTTASSTASGSAPTPTTTASSTASGSTPTLTTTASSSGS 247

Query: 272 AVLNNSGQSVGATSR*STPVRASSTSRTA 186
                   +  +T+  STP R ++TS TA
Sbjct: 248 GSTPTLPTTESSTASGSTPTRTTTTSSTA 276


>UniRef50_Q7PC53 Cluster: Chitinase B; n=3; Bacteria|Rep: Chitinase
           B - Saccharophagus degradans (strain 2-40 / ATCC 43961 /
           DSM 17024)
          Length = 1271

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           I+  I S+ S  TSS       SSS  SS  +  S+S  + +   ++S    G+TS  S+
Sbjct: 102 IIDEIESSTSSSTSSSSSSGATSSSSTSSSSSSSSSSSSSGATGSSSSSSGAGSTSSSSS 161

Query: 218 PVRASSTSRTAGCFSNCKEPS 156
              +SS+S ++   S+    S
Sbjct: 162 SSSSSSSSSSSSSSSSSSSSS 182


>UniRef50_A7CZQ9 Cluster: Putative uncharacterized protein; n=1;
           Opitutaceae bacterium TAV2|Rep: Putative uncharacterized
           protein - Opitutaceae bacterium TAV2
          Length = 561

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS   + +S P P    + + PS+     ++S+ T S  LN +  S+   +  S+ +
Sbjct: 129 PPSASTKPIPSSRPSPPPFITKACPSTPAPPPASSRSTPS--LNAAAASLPKAAA-SSSL 185

Query: 212 RASSTSRTAGCFSNCKEP 159
            ASSTS TA   +  K P
Sbjct: 186 TASSTSSTAATSNTFKNP 203


>UniRef50_A6FW48 Cluster: Putative uncharacterized protein; n=1;
           Roseobacter sp. AzwK-3b|Rep: Putative uncharacterized
           protein - Roseobacter sp. AzwK-3b
          Length = 205

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 16/52 (30%), Positives = 27/52 (51%)
 Frame = +1

Query: 283 CFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDII 438
           CFD+D T+ Q E +  +A   G   ++  LT  AM G   F+ + + R  ++
Sbjct: 11  CFDLDGTITQTELLPLIAAEIGLERDMAALTKAAMEGQTAFEPSFRHRCQLL 62


>UniRef50_Q4Q0J5 Cluster: Putative uncharacterized protein; n=4;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 717

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 3/90 (3%)
 Frame = -2

Query: 431 SSLFFKASWNVILPPIASAVSLLTSS---PFPQNLASSSMPSSCMTVESTSKQTQSAVLN 261
           SSL   A+ N   P  +SAV+ +  S   P PQ++    + S   TV++ +    S  L+
Sbjct: 363 SSLTLSANRNGGPPSRSSAVASMMQSKVLPTPQDVVLQGLLSLDSTVKTKTHALVSRQLD 422

Query: 260 NSGQSVGATSR*STPVRASSTSRTAGCFSN 171
                +      S P+ +SSTS  AGC SN
Sbjct: 423 RLESYLRIKCGWSVPLSSSSTSAEAGCGSN 452


>UniRef50_A2ECQ1 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 1551

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -1

Query: 840  NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
            N G PP P  P+  G  P +S+ P+PG  P  G+
Sbjct: 1262 NSGMPPMPGMPTLPGQSPPSSMPPMPGVPPPTGS 1295


>UniRef50_Q4J7Y7 Cluster: Conserved Archaeal protein; n=5;
           Sulfolobaceae|Rep: Conserved Archaeal protein -
           Sulfolobus acidocaldarius
          Length = 772

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -2

Query: 443 GLMMSSLFFK-ASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQS 273
           G+M++  FFK   W + LP + S+ S  +SS    + +SS+  SS  +  S++  T S
Sbjct: 706 GVMVNLTFFKPVPWIITLPTLTSSASTTSSSTSSMSTSSSTTASSTTSTTSSTTTTTS 763


>UniRef50_A0RUI6 Cluster: Phosphoserine phosphatase; n=2;
           Crenarchaeota|Rep: Phosphoserine phosphatase -
           Cenarchaeum symbiosum
          Length = 216

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 16/54 (29%), Positives = 31/54 (57%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           V FDV+  +   E +  LA+   K DE+  +T + + G + ++E L+ R++ +R
Sbjct: 3   VIFDVEGVLFDAEYLPILAEKLNKEDEIWEITRKGIRGAIDWEEGLRTRVEALR 56


>UniRef50_O42970 Cluster: Uncharacterized serine-rich protein
           C1E8.05 precursor; n=1; Schizosaccharomyces pombe|Rep:
           Uncharacterized serine-rich protein C1E8.05 precursor -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 317

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 31/108 (28%), Positives = 56/108 (51%)
 Frame = -2

Query: 494 VSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPS 315
           +S +G  S  S+    +G   SS +F  S +   P  +S+ S  +SSP   +  SSS   
Sbjct: 121 LSYSGTISSTSIAPSMIGTRTSSSYFITS-SSSTP--SSSSSSSSSSPSSSSSKSSSSSK 177

Query: 314 SCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSN 171
           S  +  S+SK + S+  ++S +S  ++S  S    + S+S+++  FS+
Sbjct: 178 SSSSSSSSSKSSSSS--SSSSKSSSSSSSSSKSSASPSSSKSSSKFSS 223



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 20/69 (28%), Positives = 40/69 (57%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
           +S+P   + +SSS PSS  +  S+S ++ S+  ++S  S  ++S   +   +SS+S+++ 
Sbjct: 151 SSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKSSA 210

Query: 182 CFSNCKEPS 156
             S+ K  S
Sbjct: 211 SPSSSKSSS 219


>UniRef50_P53189 Cluster: Probable family 17 glucosidase SCW11
           precursor; n=2; Saccharomyces cerevisiae|Rep: Probable
           family 17 glucosidase SCW11 precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 542

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
           TS    ++  S++ P+S  T  STS  T S+  +++  S  +++  ST    SST  TA 
Sbjct: 205 TSIASQESTESTNTPTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSTQETAA 264

Query: 182 CFS 174
             S
Sbjct: 265 TTS 267


>UniRef50_Q5LKP2 Cluster: HAD-superfamily hydrolase, subfamily IB;
           n=1; Silicibacter pomeroyi|Rep: HAD-superfamily
           hydrolase, subfamily IB - Silicibacter pomeroyi
          Length = 223

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAG 665
           L++EL   GV    VSG F +++ P+A+ L++   NI A  L+   +G Y G
Sbjct: 99  LLRELSADGVEPVFVSGSFDAVLRPIADHLSV--TNILAAPLELRADGCYTG 148


>UniRef50_Q8IFX6 Cluster: Putative uncharacterized protein; n=5;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 2232

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STP 216
           L P  S +S LTS P P +  SS   S+  T      Q+ S++ +++  +  ++    T 
Sbjct: 689 LSPSTSGMSTLTSEPSPSSTQSSGAQSTLTTPSPNPSQSTSSLESSTSGATTSSGSAGTT 748

Query: 215 VRASSTSRTAGCFSNCKEPS 156
           + + S S + G       P+
Sbjct: 749 MTSPSQSSSVGSSQGSTSPA 768



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = -2

Query: 380  SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
            S V+  T+SP     ASS+ PSS  T+ STS  T  + ++ S  +  A+S+  + V   S
Sbjct: 1500 STVASSTASP----AASSTAPSSTGTMSSTSSGTVGSTISESSTTASASSQTGSTVTMGS 1555

Query: 200  TSRTAG 183
            +S T+G
Sbjct: 1556 SS-TSG 1560



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = -2

Query: 383  ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
            +SA S + SS      ASS+ PSS  T+ STS  T  + ++ S  +   TS   + V   
Sbjct: 1745 SSAGSTVVSST-ASPAASSTAPSSTGTMSSTSSGTVGSTMSQSSTAASTTSHTGSTVTLG 1803

Query: 203  STSRTAGCFSNCKEPS 156
            S+S ++   S  +  S
Sbjct: 1804 SSSTSSNQMSTSQGSS 1819


>UniRef50_Q4X874 Cluster: Pc-fam-2 protein, putative; n=1;
           Plasmodium chabaudi|Rep: Pc-fam-2 protein, putative -
           Plasmodium chabaudi
          Length = 668

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = -1

Query: 837 QGXPPKPMKPSAGGXKPRASVAPVP 763
           QG P KP KP   G KP A +APVP
Sbjct: 194 QGQPGKPGKPGQPGPKPPAQLAPVP 218


>UniRef50_Q1JSA7 Cluster: Putative uncharacterized protein; n=1;
            Toxoplasma gondii|Rep: Putative uncharacterized protein -
            Toxoplasma gondii
          Length = 2639

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 23/71 (32%), Positives = 35/71 (49%)
 Frame = -2

Query: 371  SLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSR 192
            S+   S  P + ASSS PSS  +  S S    S+  ++S  S  ++S  S+   +SS+S 
Sbjct: 1454 SVCKHSSSPSSSASSSSPSSSASSSSPSSSASSSSPSSSASSSSSSSSSSSSSSSSSSSP 1513

Query: 191  TAGCFSNCKEP 159
            +   FS    P
Sbjct: 1514 SFSAFSASPVP 1524


>UniRef50_A7F3R4 Cluster: Predicted protein; n=2;
           Sclerotiniaceae|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 1097

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = -2

Query: 353 PFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFS 174
           P P  +  +  PS C TV  +S  T SAV  +S  S   TS  + P+ +S ++    C +
Sbjct: 43  PLPVTITVTVPPSYCPTVPPSSSATSSAVATSSVGSESITS--TAPIFSSQSTSIPACAA 100

Query: 173 N 171
           N
Sbjct: 101 N 101



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            P +S VS L SS    +  +SS+     T+ S ++ + S+ L +S   + +++  +TP  
Sbjct: 820  PSSSQVSNLPSSSVEPSSVASSVVQESSTISSIAQPSSSSALTSSEPPISSSAASTTPQL 879

Query: 209  ASSTSRTAGCFSN 171
             SST  ++   S+
Sbjct: 880  PSSTPFSSSAASS 892


>UniRef50_A7DSI4 Cluster: Phosphoserine phosphatase SerB; n=1;
           Candidatus Nitrosopumilus maritimus SCM1|Rep:
           Phosphoserine phosphatase SerB - Candidatus
           Nitrosopumilus maritimus SCM1
          Length = 238

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 15/54 (27%), Positives = 31/54 (57%)
 Frame = +1

Query: 280 VCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALKKRLDIIR 441
           V FDV+  +  +E +  LA+   K DE+  +T + + G + ++E L+ R+  ++
Sbjct: 25  VIFDVEGVLYDEEYLPILAEKLNKQDEIWAITKQGIQGKINWEEGLRTRVAALK 78


>UniRef50_P46591 Cluster: Hyphally-regulated protein precursor; n=3;
           Candida albicans|Rep: Hyphally-regulated protein
           precursor - Candida albicans (Yeast)
          Length = 937

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 26/96 (27%), Positives = 47/96 (48%)
 Frame = -2

Query: 449 TLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSA 270
           T  +  SS    A+ + ++   +SAV  LTSS       SS + SS   +ES+S   ++ 
Sbjct: 345 TSSIETSSYSSAATESSVVSESSSAVDSLTSSSLSSKSESSDVVSSTTNIESSSTAIETT 404

Query: 269 VLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKE 162
           + + S    G++S   +   +SST+ T+   ++  E
Sbjct: 405 MNSESSTDAGSSS--ISQSESSSTAITSSSETSSSE 438


>UniRef50_P06800 Cluster: Leukocyte common antigen precursor; n=13;
           Eutheria|Rep: Leukocyte common antigen precursor - Mus
           musculus (Mouse)
          Length = 1291

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = -2

Query: 404 NVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNN 258
           NV    I+S  SL T +P    LAS+  PS+  T+ +T+KQT +A+  N
Sbjct: 161 NVSTTDISSGASLTTLTPSTLGLASTDPPST--TIATTTKQTCAAMFGN 207


>UniRef50_UPI0000F1D401 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Danio rerio|Rep: PREDICTED: hypothetical
           protein, partial - Danio rerio
          Length = 1059

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = -2

Query: 386 IASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNN--SGQSVGATSR*STPV 213
           ++SA ++ +++       SS+  SS  TV ST+  + + V +   S  +VG+T+  S+P 
Sbjct: 385 VSSATTVASTAVSSPTTVSSTAVSSATTVASTAVSSPTTVSSTALSSATVGSTTAASSPT 444

Query: 212 RASSTS 195
            ASST+
Sbjct: 445 TASSTA 450


>UniRef50_UPI0000ECCA49 Cluster: CDNA FLJ16464 fis, clone
           BRHIP2012360.; n=5; Tetrapoda|Rep: CDNA FLJ16464 fis,
           clone BRHIP2012360. - Gallus gallus
          Length = 538

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P+ +A S +TS    +++  S   S C+ ++STS  + S V   S ++ G +S     ++
Sbjct: 465 PVMAAASCVTSVQMSESVGLSLTASPCLHLQSTSTDS-SVVPVQSTKNSGVSSSVMADLQ 523

Query: 209 ASSTSRTAGCFS 174
            SST R    FS
Sbjct: 524 LSSTDRKGTFFS 535


>UniRef50_Q62E20 Cluster: Dyp-type peroxidase family protein; n=27;
           Proteobacteria|Rep: Dyp-type peroxidase family protein -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 396

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = -1

Query: 870 AGXLSLXSSXNQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSP 712
           AG   L S   +G  P+  +   GG  PR + A    RS GA TRA+    +P
Sbjct: 5   AGRSGLTSRSARGAAPRARRHRVGGRAPRWAEANATRRSRGACTRAVARTCAP 57


>UniRef50_Q2RGV3 Cluster: Spore germination B3 GerAC like; n=1;
           Moorella thermoacetica ATCC 39073|Rep: Spore germination
           B3 GerAC like - Moorella thermoacetica (strain ATCC
           39073)
          Length = 474

 Score = 33.9 bits (74), Expect = 5.6
 Identities = 19/44 (43%), Positives = 21/44 (47%)
 Frame = +2

Query: 662 WLR*KRANIEIWWXXFSGETTEXIARVPAPGDRPGTGATDARGL 793
           WL  K AN  +W     GE TE +  VP P    GTG   A GL
Sbjct: 252 WLDEKEANGLMW---LRGEVTEGVVTVPLPAGATGTGQGTAGGL 292


>UniRef50_UPI00004D5DA1 Cluster: YLP motif containing protein 1
           (Nuclear protein ZAP3) (ZAP113).; n=1; Xenopus
           tropicalis|Rep: YLP motif containing protein 1 (Nuclear
           protein ZAP3) (ZAP113). - Xenopus tropicalis
          Length = 1352

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%)
 Frame = -1

Query: 885 P*RTKAGXLSLXSSXNQGXPPKPMKPSAGGX----KPRASVAPVPGRSPGAGT 739
           P + +AG          G PP P +P AG      +PRA   P PG+   +GT
Sbjct: 580 PGQPRAGAPPAPGQPRAGAPPAPGQPRAGAPPAPGQPRAGAPPAPGQPRASGT 632


>UniRef50_Q2JB76 Cluster: HAD-superfamily subfamily IB, PSPase-like;
           n=1; Frankia sp. CcI3|Rep: HAD-superfamily subfamily IB,
           PSPase-like - Frankia sp. (strain CcI3)
          Length = 226

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERL 599
           R+++ L   G I+ LVSG F + ++P+AE L
Sbjct: 97  RVLRRLQAAGTIIVLVSGSFSACLDPIAEHL 127


>UniRef50_Q3VW96 Cluster: Radical SAM; n=2; Chlorobiaceae|Rep:
           Radical SAM - Prosthecochloris aestuarii DSM 271
          Length = 488

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 4/84 (4%)
 Frame = +1

Query: 244 TDCPELFRTADC-VCFDV---DSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQE 411
           T CP L     C  CF+    D T+++DE I  LA+F  +  + + LT    GG  T   
Sbjct: 108 TICPTLACNFACPYCFEHSQNDETIMRDETIAALAEFIKQHHDARTLTVSWYGGEATLAF 167

Query: 412 ALKKRLDIIRPNVGQIREFIEKFP 483
            + +RL          +EFIE +P
Sbjct: 168 DIIERL---------TKEFIELYP 182


>UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel
           domain precursor; n=1; Stenotrophomonas maltophilia
           R551-3|Rep: Outer membrane autotransporter barrel domain
           precursor - Stenotrophomonas maltophilia R551-3
          Length = 1009

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 8/64 (12%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGT--------RAIXSVVSPLNXXHQISMLARF 673
           P  P  P AGG  P     P PG  P  GT         A  +VV PL     ++ L  F
Sbjct: 657 PAVPDVPVAGGSLPGIGTPPTPGARPAEGTVVPLYRVETATYAVVPPLLRETSLASLGTF 716

Query: 672 HRSQ 661
           H  Q
Sbjct: 717 HERQ 720


>UniRef50_Q559J2 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 1126

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 20/88 (22%), Positives = 45/88 (51%)
 Frame = -2

Query: 452 PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQS 273
           P + L  +S +  + +  +LP +++  S  +SS    + +SSS  SS  +  S+S  + S
Sbjct: 348 PIVELKKTSSWMSSFFTKVLPSLSTNTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 407

Query: 272 AVLNNSGQSVGATSR*STPVRASSTSRT 189
           +  ++S  ++   +  ST   ++ ++ T
Sbjct: 408 SSSSSSSSNIATMTSASTTTTSTISAAT 435


>UniRef50_Q6VBJ3 Cluster: Epa4p; n=6; Fungi/Metazoa group|Rep: Epa4p
           - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 1416

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SSP P + +SSS  SS  +  S S  + S+  ++S  S  ++S  S+   +S
Sbjct: 365 SSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 424

Query: 203 STSRTA 186
           S+S ++
Sbjct: 425 SSSSSS 430



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 22/76 (28%), Positives = 40/76 (52%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SSP P + +SSS  SS  +  S+S  + S+  ++S  S   +   S+   +S
Sbjct: 383 SSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSS 442

Query: 203 STSRTAGCFSNCKEPS 156
           S+S ++   S+    S
Sbjct: 443 SSSSSSSSSSSSSSSS 458



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 21/71 (29%), Positives = 40/71 (56%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SS    + +SSS PS   +  S+S  + S+  ++S  S  ++S  S+P  +S
Sbjct: 410 SSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSS 469

Query: 203 STSRTAGCFSN 171
           S+S ++   S+
Sbjct: 470 SSSSSSSSSSS 480



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 21/63 (33%), Positives = 36/63 (57%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SSP P + +SSS  SS  +  S+S  + S+  ++S  S  ++S  S+   +S
Sbjct: 421 SSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSS 480

Query: 203 STS 195
           S S
Sbjct: 481 SPS 483


>UniRef50_Q6FTA2 Cluster: Similar to sp|P20840 Saccharomyces
           cerevisiae YJR004c SAG1 alpha- agglutinin; n=1; Candida
           glabrata|Rep: Similar to sp|P20840 Saccharomyces
           cerevisiae YJR004c SAG1 alpha- agglutinin - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 763

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
           S++S+ +SS    + +SSS  SS  +  STS  + S+  +++  S  ++S  ST    SS
Sbjct: 432 SSISITSSSSSSSSSSSSSSSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSS 491

Query: 200 TSRTAGCFSNCKEPS 156
            S T+   S+    S
Sbjct: 492 ISITSSSSSSSSSSS 506


>UniRef50_Q6CD44 Cluster: Similar to DEHA0F04158g Debaryomyces
           hansenii IPF 8785.1; n=1; Yarrowia lipolytica|Rep:
           Similar to DEHA0F04158g Debaryomyces hansenii IPF 8785.1
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 612

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 23/65 (35%), Positives = 33/65 (50%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP  S+    +S PF  + +SSS PSS     S+S  + S+  ++S  S   TS  S P 
Sbjct: 195 PPTTSSEPSTSSIPFASSSSSSSPPSS-----SSSSSSSSSSSSSSSSSSATTSSSSIPS 249

Query: 212 RASST 198
             +ST
Sbjct: 250 STTST 254


>UniRef50_A5DD47 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 1750

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = -2

Query: 416 KASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVES---TSKQTQSAVLNNSGQS 246
           +AS N      AS+ +  +S+P   + ASSS+P+S     S   +S Q  S+V  +S  +
Sbjct: 653 QASSNAASSSAASSNAASSSAPASSSAASSSVPASSSAASSGATSSSQASSSVPASSSVA 712

Query: 245 VGATSR*STPVRASSTSRTAGCFSNCKEPS 156
             + +  S PV +   S  A   S+    S
Sbjct: 713 SSSVASSSAPVSSGQASSNAPSSSSAASSS 742



 Score = 33.1 bits (72), Expect = 9.7
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P++S+    +S+P   + ASSS  SS     S++  +  A  N +  S  +++  S+   
Sbjct: 615 PVSSSAPASSSAPASSSAASSSQASSSAPASSSAASSSQASSNAASSSAASSNAASSSAP 674

Query: 209 ASSTSRTA 186
           ASS++ ++
Sbjct: 675 ASSSAASS 682


>UniRef50_P02836 Cluster: Segmentation polarity homeobox protein
           engrailed; n=9; Drosophila|Rep: Segmentation polarity
           homeobox protein engrailed - Drosophila melanogaster
           (Fruit fly)
          Length = 552

 Score = 33.5 bits (73), Expect = 7.4
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS  S ++S+      +SSS  S C +  S+   + S+ L  SG  V A+S    P+
Sbjct: 329 PPPASNASTISSTSSVAT-SSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPI 387

Query: 212 -RASSTSRTAGCFSN 171
              S+ SR +G  S+
Sbjct: 388 PPPSAVSRDSGMESS 402


>UniRef50_UPI0000F2CA5F Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 345

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = -1

Query: 825 PKPMKPSAGGX-KPRASVAPVPGRSPGAG-TRAIXSVVSPL 709
           P+P  PS+GG   P ++  P P  SPGAG T A  + ++PL
Sbjct: 268 PQPCLPSSGGNPSPTSATTPQPPPSPGAGVTAARCAPLTPL 308


>UniRef50_UPI0000EBC2F4 Cluster: PREDICTED: similar to
           down-regulated in colon cancer 1 isoform 2; n=2; Bos
           taurus|Rep: PREDICTED: similar to down-regulated in
           colon cancer 1 isoform 2 - Bos taurus
          Length = 591

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 5/84 (5%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST-P 216
           P + S  +  T++  P   ++S+  ++  TV ST   T      N+  S   +   ST P
Sbjct: 181 PTVTSTPTSTTATTTPTVTSTSNTATTTSTVTSTPTSTTEKTTPNTATSTPTSPAGSTIP 240

Query: 215 VRAS----STSRTAGCFSNCKEPS 156
             AS    ST RT G  + CKE S
Sbjct: 241 ANASNMSTSTIRTPGPSTPCKEDS 264


>UniRef50_A6Q7Z2 Cluster: Phosphoserine phosphatase; n=8;
           Epsilonproteobacteria|Rep: Phosphoserine phosphatase -
           Sulfurovum sp. (strain NBC37-1)
          Length = 207

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNI 605
           +V+ L E+G  V   SGGFR+  +P  ERL I
Sbjct: 81  VVRGLKEKGYTVVCFSGGFRNATKPACERLGI 112


>UniRef50_Q98SA9 Cluster: Putative uncharacterized protein orf301;
           n=1; Guillardia theta|Rep: Putative uncharacterized
           protein orf301 - Guillardia theta (Cryptomonas phi)
          Length = 301

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
 Frame = +3

Query: 561 GFRSLIEPVAERLNIPTINIFANRLKFYF---NGEYAGFDENEPTSRSG 698
           G R LI  +AERL I +  +   RLK      N +Y GF  NE T+ SG
Sbjct: 235 GIRLLIT-IAERLQISSYGVLVRRLKLILDEVNPKYYGFKFNELTNNSG 282


>UniRef50_A3ABE8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. japonica (Rice)
          Length = 263

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PPI+S++SL+ S+P P      + P   +TV + S  + S+  ++S  S   ++  S PV
Sbjct: 4   PPISSSLSLMASNPIPS--PPVAKPGRPLTVAACSNSSSSS-SSSSPSSTSCSAAWSLPV 60

Query: 212 RASSTSR 192
             S+  R
Sbjct: 61  ATSAGRR 67


>UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1;
           Acanthamoeba castellanii|Rep: Myosin I heavy chain
           kinase - Acanthamoeba castellanii (Amoeba)
          Length = 753

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 18/51 (35%), Positives = 25/51 (49%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQISMLAR 676
           PP+P  P AGG  P A+ AP P R P    R + S   PL     + ++ +
Sbjct: 429 PPRPQPPKAGGAPPPAA-APQPAR-PQVNIRDLISQGDPLTIFKDMEIIGQ 477


>UniRef50_Q4Z3X9 Cluster: Pb-reticulocyte binding protein; n=2;
           Plasmodium (Vinckeia)|Rep: Pb-reticulocyte binding
           protein - Plasmodium berghei
          Length = 1913

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +3

Query: 513 VKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENE 680
           +KEL +R  I+     G  SL   ++++  I  +N F    + + + +Y G +ENE
Sbjct: 152 IKELQKRSNIIEEYQKGLESLKYVLSDKNFITILNEFRYNCQLFIDADYRGIEENE 207


>UniRef50_Q49BJ0 Cluster: Rhino; n=4; obscura group|Rep: Rhino -
           Drosophila miranda (Fruit fly)
          Length = 330

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           + PP +  V   TSS F  + +SSS  SS  +  S S  + S+  ++S  S  ATS  ST
Sbjct: 115 VTPPKSQRVLSATSSSFSSSSSSSSSSSSSSSTSSYSSSSSSS--SSSSSSTSATSSQST 172


>UniRef50_Q26882 Cluster: Surface coat glycoprotein TES-120; n=1;
           Toxocara canis|Rep: Surface coat glycoprotein TES-120 -
           Toxocara canis (Canine roundworm)
          Length = 176

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = -2

Query: 377 AVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS-- 204
           AV +  ++P   + +SSS PS+  +  STS  + S   +++  S  + S  S+P   S  
Sbjct: 10  AVLICVATPQMMSSSSSSSPSTSSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSS 69

Query: 203 --STSRTAGCFSNCKEPS 156
             STS  AG  S    P+
Sbjct: 70  SASTSSMAGSTSTAAGPT 87


>UniRef50_Q17BE7 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 953

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP+ S   +  + P P      S PSS ++++STSKQT+        +S   ++  S P 
Sbjct: 335 PPVYSQSPVPPNLPPPITPTKLSQPSSTLSIDSTSKQTKEQSPKPRQKSPPLSTPPSPPT 394

Query: 212 RASSTS 195
             +S S
Sbjct: 395 NGTSVS 400


>UniRef50_Q172W8 Cluster: Sin3a-associated protein sap130; n=2; Aedes
            aegypti|Rep: Sin3a-associated protein sap130 - Aedes
            aegypti (Yellowfever mosquito)
          Length = 1335

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = -2

Query: 383  ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
            A+A+    ++   Q L +    S+  T ES S+   SAV +++ QS GAT   S+ V   
Sbjct: 1112 AAAIVESIAAQQQQLLQAKQSGSALTTAESNSRSAASAVKHDTQQSQGATGIASSVVTVP 1171

Query: 203  STSRTAGCFSNCKEP 159
            +    A   +N ++P
Sbjct: 1172 AKDAPATSIANSRKP 1186


>UniRef50_Q16R75 Cluster: Condensin, XCAP-G'-subunit, putative; n=2;
            Culicidae|Rep: Condensin, XCAP-G'-subunit, putative -
            Aedes aegypti (Yellowfever mosquito)
          Length = 1524

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = -2

Query: 365  LTSSPFPQNLASSSMPSS-CMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
            +TSSP P  L++SS+ SS   TV S  +  + AV   SG+S  AT   STP R
Sbjct: 1465 ITSSP-PATLSASSIASSDSSTVTSPVRPKRVAVTPLSGESAIATRSTSTPTR 1516


>UniRef50_A7AQ91 Cluster: GCC2 and GCC3 domain containing protein;
           n=1; Babesia bovis|Rep: GCC2 and GCC3 domain containing
           protein - Babesia bovis
          Length = 2472

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 5/39 (12%)
 Frame = -2

Query: 449 TLGLMMSSLFFKASWNVILPPIASAVSLLT-----SSPF 348
           TLG +  SLF + SWN+  PPIA  +S +T     SSPF
Sbjct: 339 TLGSLTQSLFIR-SWNITAPPIAIILSKITDGEGCSSPF 376


>UniRef50_A4IJ82 Cluster: LD40879p; n=6; Drosophila
           melanogaster|Rep: LD40879p - Drosophila melanogaster
           (Fruit fly)
          Length = 1378

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVG----ATSR*STPVRASSTS 195
           T + F  N  S++  SSC    +TS   ++ + NNS  S G    A++  S   R  S S
Sbjct: 168 TITSFNSNSNSNNSSSSCKNYNTTSNSNKNNIDNNSSNSSGQIMLASASASASARKRSRS 227

Query: 194 RTAGCFSNCKEPS 156
            + G  SN K  S
Sbjct: 228 TSNGSKSNNKTAS 240


>UniRef50_Q2USG1 Cluster: Predicted protein; n=1; Aspergillus
           oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 178

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = -1

Query: 876 TKAGXLSLXSSXNQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAG 742
           TK G  S  ++  +  PPK  K +AG    + S+ P+P     AG
Sbjct: 45  TKRGKKSTATNGEKASPPKKAKGAAGSSPSKKSIGPIPTSFEAAG 89


>UniRef50_A5DG98 Cluster: Predicted protein; n=1; Pichia
           guilliermondii|Rep: Predicted protein - Pichia
           guilliermondii (Yeast) (Candida guilliermondii)
          Length = 1279

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNL-ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRA 207
           +S+ S   SS  P++  ASSS   S  T+ES+S    S++ +NS  S   + R S+ V +
Sbjct: 605 SSSESSSASSSAPESSSASSSAAESSSTIESSSTIESSSLSSNSASSEFPSIRLSSAVLS 664

Query: 206 SSTS 195
           SS+S
Sbjct: 665 SSSS 668


>UniRef50_P87179 Cluster: Cell wall integrity and stress response
           component 1 precursor; n=3; Schizosaccharomyces
           pombe|Rep: Cell wall integrity and stress response
           component 1 precursor - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 374

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 25/76 (32%), Positives = 41/76 (53%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+VS  TSS      +SSS PSS  T  +TS  + S+  ++S  S  ++S  S+   +S
Sbjct: 129 SSSVSSTTSS------SSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 203 STSRTAGCFSNCKEPS 156
           S+S ++   S+    S
Sbjct: 183 SSSSSSSSSSSSSSSS 198


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 829,640,735
Number of Sequences: 1657284
Number of extensions: 16616041
Number of successful extensions: 60966
Number of sequences better than 10.0: 170
Number of HSP's better than 10.0 without gapping: 53978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60399
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79932179145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -