SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E4A8D7 Cluster: PREDICTED: similar to Pck1 prote...   139   8e-32
UniRef50_A2ETS2 Cluster: Phosphoenol pyruvate carboxykinase, put...   134   3e-30
UniRef50_Q16822 Cluster: Phosphoenolpyruvate carboxykinase [GTP]...   130   6e-29
UniRef50_Q8FM16 Cluster: Phosphoenolpyruvate carboxykinase [GTP]...   117   5e-25
UniRef50_Q3WGE1 Cluster: Phosphoenolpyruvate carboxykinase; n=1;...   107   3e-22
UniRef50_A7HGY6 Cluster: Phosphoenolpyruvate carboxykinase; n=16...   104   3e-21
UniRef50_Q9HLV2 Cluster: Phosphoenolpyruvate carboxykinase [GTP]...    92   2e-17
UniRef50_UPI000038E5C0 Cluster: hypothetical protein Faci_030001...    68   4e-10
UniRef50_A1S0E8 Cluster: Phosphoenolpyruvate carboxykinase; n=2;...    67   5e-10
UniRef50_Q8U410 Cluster: Phosphoenolpyruvate carboxykinase [GTP]...    60   8e-08
UniRef50_A0UCG9 Cluster: Putative uncharacterized protein; n=6; ...    54   5e-06
UniRef50_Q9TYQ8 Cluster: Putative uncharacterized protein; n=2; ...    54   7e-06
UniRef50_A0HEP6 Cluster: Putative uncharacterized protein; n=2; ...    53   1e-05
UniRef50_Q4J9S8 Cluster: Phosphoenolpyruvate carboxykinase [GTP]...    52   2e-05
UniRef50_A1SQ84 Cluster: Phosphoenolpyruvate carboxykinase; n=2;...    49   1e-04
UniRef50_A1IAX6 Cluster: Phosphoenolpyruvate carboxykinase; n=2;...    41   0.038
UniRef50_UPI0000ECA795 Cluster: UPI0000ECA795 related cluster; n...    40   0.087
UniRef50_Q7R205 Cluster: GLP_163_12370_10406; n=2; Giardia intes...    40   0.11 
UniRef50_A7ES19 Cluster: Predicted protein; n=1; Sclerotinia scl...    36   1.4  
UniRef50_Q4PCB9 Cluster: Putative uncharacterized protein; n=1; ...    36   1.9  
UniRef50_A0UPS6 Cluster: Putative uncharacterized protein precur...    33   7.5  
UniRef50_Q7RIW2 Cluster: Putative uncharacterized protein PY0350...    33   7.5  
UniRef50_A6DFE7 Cluster: Putative uncharacterized protein; n=1; ...    33   10.0 

>UniRef50_UPI0000E4A8D7 Cluster: PREDICTED: similar to Pck1 protein;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Pck1 protein - Strongylocentrotus purpuratus
          Length = 667

 Score =  139 bits (337), Expect = 8e-32
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 6/128 (4%)
 Frame = +3

Query: 252 EVLEILRQDEQFVRCLHAVGSGG------TPGWPCDPKNTIILHKPAENEIVXXXXXXXX 413
           EVL+ L + E FV+CLH+VG         T  WPC+P+ TI+ H P   EI         
Sbjct: 206 EVLDTLGEGE-FVKCLHSVGQPMPLKEPLTNNWPCNPERTIVSHIPDRREICSFGSGYGG 264

Query: 414 XXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMT 593
                KKCFALR+ S IA+ EGWLAEHMLI+G+TNPQG+K+YIAAAFPSACGKTNLAM+ 
Sbjct: 265 NSLLGKKCFALRIASRIAKDEGWLAEHMLILGLTNPQGEKKYIAAAFPSACGKTNLAMLN 324

Query: 594 PNTGPGTK 617
           P T PG K
Sbjct: 325 P-TIPGWK 331



 Score =  128 bits (308), Expect = 3e-28
 Identities = 60/99 (60%), Positives = 70/99 (70%)
 Frame = +3

Query: 321 TPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKCFALRLGSVIARREGWLAEHML 500
           T  WPC+P+ TI+ H P   EI              KKCFALR+ S IA+ EGWLAEHML
Sbjct: 409 TNNWPCNPERTIVSHIPDRREICSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHML 468

Query: 501 IVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           I+G+TNPQG+K+YIAAAFPSACGKTNLAM+ P T PG K
Sbjct: 469 ILGLTNPQGEKKYIAAAFPSACGKTNLAMLNP-TIPGWK 506



 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+++TDSPYVV SMRVMTR+G
Sbjct: 163 GRTMYVIPFSMGPIGSPLSKIGIQLTDSPYVVASMRVMTRMG 204



 Score = 33.1 bits (72), Expect = 10.0
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKF 655
           PG+K  CVGDDIA MKF
Sbjct: 328 PGWKAECVGDDIAWMKF 344



 Score = 33.1 bits (72), Expect = 10.0
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKF 655
           PG+K  CVGDDIA MKF
Sbjct: 503 PGWKAECVGDDIAWMKF 519


>UniRef50_A2ETS2 Cluster: Phosphoenol pyruvate carboxykinase,
           putative; n=1; Trichomonas vaginalis G3|Rep: Phosphoenol
           pyruvate carboxykinase, putative - Trichomonas vaginalis
           G3
          Length = 394

 Score =  134 bits (324), Expect = 3e-30
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 5/121 (4%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGGTPG-----WPCDPKNTIILHKPAENEIVXXXXXXXX 413
           ++VLE + ++  F+ C+H+VG     G     WPCDP+NT I H P E  I         
Sbjct: 156 TKVLECIGENGDFIPCVHSVGYPLKDGRQDVAWPCDPENTYITHYPEEQAIWSYGSGYGG 215

Query: 414 XXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMT 593
                KKCFALR+GS +AR+EGWLAEHMLI+G+ NP+GKK ++ AAFPSACGKTN AM+ 
Sbjct: 216 NALLGKKCFALRIGSNLARKEGWLAEHMLILGVKNPEGKKTFVTAAFPSACGKTNFAMLI 275

Query: 594 P 596
           P
Sbjct: 276 P 276



 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 33/45 (73%), Positives = 39/45 (86%)
 Frame = +1

Query: 121 DGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGAK 255
           +GRTMYVIPFSMGP+GS + K GVEI+DSPYVV SMR+MTR+  K
Sbjct: 113 EGRTMYVIPFSMGPIGSSIGKNGVEISDSPYVVVSMRIMTRVSTK 157


>UniRef50_Q16822 Cluster: Phosphoenolpyruvate carboxykinase [GTP],
           mitochondrial precursor; n=571; cellular organisms|Rep:
           Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
           precursor - Homo sapiens (Human)
          Length = 640

 Score =  130 bits (313), Expect = 6e-29
 Identities = 67/120 (55%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG----GTP--GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D  FV+CLH+VG      G P   WPC+P+ T+I H P + EI+             KKC
Sbjct: 204 DGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKC 263

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +AR EGWLAEHMLI+GIT+P GKK   AAAFPSACGKTNLAMM P   PG K
Sbjct: 264 FALRIASRLARDEGWLAEHMLILGITSPAGKKALCAAAFPSACGKTNLAMMRPAL-PGWK 322



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 34/42 (80%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PFSMGPVGSPLS+IGV++TDS YVV SMR+MTR+G
Sbjct: 154 GRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLG 195



 Score = 36.7 bits (81), Expect = 0.81
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M+F       R  +  +NGFFG
Sbjct: 319 PGWKVECVGDDIAWMRF-DSEGRLRA-INPENGFFG 352


>UniRef50_Q8FM16 Cluster: Phosphoenolpyruvate carboxykinase [GTP];
           n=116; Bacteria|Rep: Phosphoenolpyruvate carboxykinase
           [GTP] - Corynebacterium efficiens
          Length = 612

 Score =  117 bits (281), Expect = 5e-25
 Identities = 62/127 (48%), Positives = 80/127 (62%), Gaps = 5/127 (3%)
 Frame = +3

Query: 252 EVLEILRQDEQFVRCLHAVGSGGTPG-----WPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           + L+ + ++  FVRCLH+VG+    G     WPC+     I   P   EI          
Sbjct: 166 DALDKIGENGSFVRCLHSVGAPLEEGQEDVAWPCNDTK-YITQFPETKEIWSYGSGYGGN 224

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKC+ALR+ SV+AR EGW+AEHMLI+ +TNP+G+  +IAAAFPSACGKTNLAM+TP
Sbjct: 225 AILAKKCYALRIASVMAREEGWMAEHMLILKLTNPEGQAYHIAAAFPSACGKTNLAMITP 284

Query: 597 NTGPGTK 617
            T PG K
Sbjct: 285 -TIPGWK 290



 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 28/42 (66%), Positives = 35/42 (83%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PF MGP+  P  K+GV++TDS YVV SMR+MTR+G
Sbjct: 123 GRTMYVVPFCMGPITDPEPKLGVQLTDSAYVVMSMRIMTRMG 164



 Score = 33.9 bits (74), Expect = 5.7
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+K   VGDDIA +KFR     +   +  +NGFFG
Sbjct: 287 PGWKAEVVGDDIAWLKFREDGHLYA--VNPENGFFG 320


>UniRef50_Q3WGE1 Cluster: Phosphoenolpyruvate carboxykinase; n=1;
           Frankia sp. EAN1pec|Rep: Phosphoenolpyruvate
           carboxykinase - Frankia sp. EAN1pec
          Length = 573

 Score =  107 bits (258), Expect = 3e-22
 Identities = 60/125 (48%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = +3

Query: 258 LEILRQDEQFVRCLHAVGSGGTP-----GWPCDPKNTIILHKPAENEIVXXXXXXXXXXX 422
           L+ L QD  FV  +H+VG+   P      WPC+    I+ H P   EI            
Sbjct: 267 LDQLGQDGFFVPAVHSVGAPRQPEQPDVAWPCNATKYIV-HFPETREIWSYGSGYGGNAL 325

Query: 423 XXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNT 602
             KK +ALR+ SV+AR +GWLAEHMLI+ +T P G   YIAA FPSACGKTNLAM+ P T
Sbjct: 326 LGKKYYALRIASVMARDDGWLAEHMLILKLTGPDGNTHYIAAGFPSACGKTNLAMLVP-T 384

Query: 603 GPGTK 617
            PG K
Sbjct: 385 IPGWK 389



 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 31/42 (73%), Positives = 36/42 (85%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PF MG +GSP+S +GVEITDS YV  SMRVMTR+G
Sbjct: 222 GRTMYVVPFCMGSLGSPISALGVEITDSAYVAVSMRVMTRMG 263


>UniRef50_A7HGY6 Cluster: Phosphoenolpyruvate carboxykinase; n=16;
           cellular organisms|Rep: Phosphoenolpyruvate
           carboxykinase - Anaeromyxobacter sp. Fw109-5
          Length = 595

 Score =  104 bits (250), Expect = 3e-21
 Identities = 55/113 (48%), Positives = 66/113 (58%)
 Frame = +3

Query: 258 LEILRQDEQFVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           L+ L Q  +F R LH+V          DP    I H P +N I              KKC
Sbjct: 162 LDRLGQSNEFNRGLHSVRDS-------DPDKRFICHFPQDNTIWSVGSGYGGNALLGKKC 214

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
            ALR+ S +AR EGWLAEHMLI+   +PQG+K+Y+AAAFPSACGKTN AMM P
Sbjct: 215 LALRIASYLARNEGWLAEHMLILEAESPQGEKQYVAAAFPSACGKTNFAMMIP 267



 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 26/42 (61%), Positives = 33/42 (78%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+P+ MGP  SP SK+G E+TDS YV  +M +MTR+G
Sbjct: 117 GRTMYVVPYIMGPAASPFSKVGFELTDSVYVALNMGIMTRMG 158


>UniRef50_Q9HLV2 Cluster: Phosphoenolpyruvate carboxykinase [GTP];
           n=3; Thermoplasma|Rep: Phosphoenolpyruvate carboxykinase
           [GTP] - Thermoplasma acidophilum
          Length = 588

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 6/112 (5%)
 Frame = +3

Query: 279 EQFVRCLHAVGSGGTPGWPCDPKNTIILHKP------AENEIVXXXXXXXXXXXXXKKCF 440
           E+FV+ +HA G+        DP N  I+H P       + +I+             KKC 
Sbjct: 166 EKFVKGVHATGT-------LDPGNKFIIHIPWDKPEGVDADILSVNTNYGGNALLSKKCH 218

Query: 441 ALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
           ALR+ SV AR+EGWLAEHML++ + +P G+K YI  AFPSA GKTNLAM+ P
Sbjct: 219 ALRIASVRARKEGWLAEHMLLLEVEDPHGRKVYITGAFPSASGKTNLAMINP 270



 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 21/42 (50%), Positives = 33/42 (78%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           G+TM+VIP+++GP+ S  +  G+EITDS YVV ++  +TR+G
Sbjct: 116 GKTMFVIPYALGPLNSRFTDYGIEITDSRYVVLNLHYITRMG 157


>UniRef50_UPI000038E5C0 Cluster: hypothetical protein Faci_03000127;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03000127 - Ferroplasma acidarmanus fer1
          Length = 598

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 1/121 (0%)
 Frame = +3

Query: 252 EVLEILRQDEQFVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXK 431
           E +  +    ++V  +H  G+        D  N  I H   E+ I+             K
Sbjct: 172 EAINRIENTGKYVVAIHVTGT-------LDKNNRYIAHFTDEDLIISVNTAYGGNALLTK 224

Query: 432 KCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM-TPNTGP 608
           K +ALR+ SV AR    +AEHM+ + +T+P G+K  I+ AFPSA GKTNL+M+ TP    
Sbjct: 225 KGYALRIASVHARDNSRMAEHMMALEVTSPSGRKYGISGAFPSASGKTNLSMIRTPTDMA 284

Query: 609 G 611
           G
Sbjct: 285 G 285



 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 19/41 (46%), Positives = 32/41 (78%)
 Frame = +1

Query: 127 RTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           +TMY++PF +GP GS  S+ G++ITD+PYVV ++  ++ +G
Sbjct: 130 KTMYIVPFILGPAGSKYSEAGIQITDNPYVVINLIKISLVG 170


>UniRef50_A1S0E8 Cluster: Phosphoenolpyruvate carboxykinase; n=2;
           Thermoprotei|Rep: Phosphoenolpyruvate carboxykinase -
           Thermofilum pendens (strain Hrk 5)
          Length = 636

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 37/106 (34%), Positives = 51/106 (48%)
 Frame = +3

Query: 273 QDEQFVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKCFALRL 452
           +D +++  +H+ G     GW  +     I +   EN  V              K  ALRL
Sbjct: 189 EDVEYMLFVHSAGERDERGWSKNTDKRRI-YIDVENSTVYSVNTQYAGNTVGLKKLALRL 247

Query: 453 GSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM 590
                 +EGWLAEHM IVG+    G+  Y A AFP+ CGKT+ AM+
Sbjct: 248 AVYKGYKEGWLAEHMFIVGLKGRGGRLTYFAGAFPAGCGKTSTAMI 293



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/40 (45%), Positives = 25/40 (62%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTR 243
           GR  +V  +  GP GSP S  GV++TDS YV +S  ++ R
Sbjct: 139 GREAFVSFYLYGPRGSPFSLYGVQVTDSAYVTHSEELLYR 178


>UniRef50_Q8U410 Cluster: Phosphoenolpyruvate carboxykinase [GTP];
           n=6; cellular organisms|Rep: Phosphoenolpyruvate
           carboxykinase [GTP] - Pyrococcus furiosus
          Length = 624

 Score = 60.1 bits (139), Expect = 8e-08
 Identities = 26/53 (49%), Positives = 34/53 (64%)
 Frame = +3

Query: 432 KCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMM 590
           K  A RL    A REGWL+EHM ++ +  P G+K Y   A+PS CGKT+ AM+
Sbjct: 230 KKLAFRLTIQRAVREGWLSEHMFLMRVNGPNGRKTYFTGAYPSMCGKTSTAMI 282


>UniRef50_A0UCG9 Cluster: Putative uncharacterized protein; n=6;
           Burkholderiaceae|Rep: Putative uncharacterized protein -
           Burkholderia multivorans ATCC 17616
          Length = 793

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = -3

Query: 626 RXLLCTRASVWRHHGKVRFPAS*RKSGSDVALLTLRVGYADDKHMFGQPSFATSDH*SQT 447
           R L    A     H +VR  A  R+ G DV LL  R  + +D+H+ G+P+   +      
Sbjct: 335 RDLPAVEALRRNQHREVRLAACGRERGRDVILLAGRRRHTEDQHVLGEPALIAAHRRCDP 394

Query: 446 *SEALLAQQTIAAVSTAVAYDLVLSRLVEYDGVL-RVAGP 330
             +ALLA+Q IAAV+ A A D  L+RL E   VL R+A P
Sbjct: 395 QRKALLAEQRIAAVARAEAPD--LARLGEMHDVLDRIARP 432



 Score = 37.1 bits (82), Expect = 0.61
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = -2

Query: 261 LELRSNSSHDSHRINHVRRIRDFYADLRERRSHRTHREWYHVHCA 127
           + + S++ HD H    VR I    AD+R+RR+ R HRE + +  A
Sbjct: 461 VHVASHARHDPHVHRDVRAIGQLDADMRDRRAERAHRERHDIERA 505


>UniRef50_Q9TYQ8 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 624

 Score = 53.6 bits (123), Expect = 7e-06
 Identities = 22/41 (53%), Positives = 31/41 (75%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRI 246
           GRTMYV+PFSMG +GS  + +GV+ITD P +V ++R   R+
Sbjct: 179 GRTMYVVPFSMGTIGSRRAVVGVQITDDPVLVLNLRTTFRV 219



 Score = 35.5 bits (78), Expect = 1.9
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 7/99 (7%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGG-------TPGWPCDPKNTIILHKPAENEIVXXXXXX 407
           S + + +     F+RC+H +G          TP     P  + ++ K  + E V      
Sbjct: 221 SNIWDHIAATTNFLRCVHTIGMPRPIIRKIVTPSPVETPVGSFLVLKHDDQE-VWAHGHS 279

Query: 408 XXXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQ 524
                   K F++   S +  ++GWLAE   I+ ITNP+
Sbjct: 280 FGRTPRYGKTFSVHAASWLGAKQGWLAESAAILAITNPK 318


>UniRef50_A0HEP6 Cluster: Putative uncharacterized protein; n=2;
           Comamonadaceae|Rep: Putative uncharacterized protein -
           Comamonas testosteroni KF-1
          Length = 688

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 29/68 (42%), Positives = 38/68 (55%)
 Frame = -3

Query: 587 HGKVRFPAS*RKSGSDVALLTLRVGYADDKHMFGQPSFATSDH*SQT*SEALLAQQTIAA 408
           HG++   A   + GS V LL   VG A D+H+ GQP+   +        +ALLAQQ IAA
Sbjct: 384 HGEIGLAAGRGEGGSHVVLLAFGVGDAQDQHVLGQPALVAAHGGGDAQRKALLAQQRIAA 443

Query: 407 VSTAVAYD 384
           V+ AV  D
Sbjct: 444 VARAVGPD 451


>UniRef50_Q4J9S8 Cluster: Phosphoenolpyruvate carboxykinase [GTP];
           n=4; Sulfolobaceae|Rep: Phosphoenolpyruvate
           carboxykinase [GTP] - Sulfolobus acidocaldarius
          Length = 604

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 2/124 (1%)
 Frame = +3

Query: 225 YASHD*N--WSEVLEILRQDEQFVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXX 398
           Y  H  N  +    E    D+ F++ +H+ G         D K   I+    EN +    
Sbjct: 154 YVIHSENILYRNAFEDFYGDKPFLKFIHSKGQ-------LDIKKRRIMIDVKENTVYSVN 206

Query: 399 XXXXXXXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTN 578
                     KK  ALRL    A  EGWL+EHM IVG    +G   Y  A+FPS  GKT+
Sbjct: 207 TTYAGNSVGLKK-LALRLTVTKAVNEGWLSEHMAIVGFEGNRG-THYFTASFPSGSGKTS 264

Query: 579 LAMM 590
            +M+
Sbjct: 265 TSML 268



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/40 (50%), Positives = 28/40 (70%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTR 243
           GR MYV  +S+GP  S  S + V+ITDSPYV++S  ++ R
Sbjct: 125 GREMYVGFYSLGPRNSKFSILAVQITDSPYVIHSENILYR 164


>UniRef50_A1SQ84 Cluster: Phosphoenolpyruvate carboxykinase; n=2;
           Nocardioides sp. JS614|Rep: Phosphoenolpyruvate
           carboxykinase - Nocardioides sp. (strain BAA-499 /
           JS614)
          Length = 617

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 34/102 (33%), Positives = 44/102 (43%), Gaps = 1/102 (0%)
 Frame = +3

Query: 285 FVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKCFALRLGSVI 464
           FVR +H  G     G          +    E  I+             K    LR GS  
Sbjct: 173 FVRAVHVTGDLEHLGQGTAEDLRYFVTVADERTILHFGSSYGGNALLGKIAHGLRQGSYD 232

Query: 465 ARREGWLAEHMLIVGITNPQ-GKKRYIAAAFPSACGKTNLAM 587
             + G+L E  +++GIT+ Q G+K  I   FPSA GKTNLAM
Sbjct: 233 GWKNGFLVEQFMLLGITDKQTGRKYNICGGFPSASGKTNLAM 274



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKI--GVEITDSPYVVYSMRVMTRIG 249
           G+TMYVIP+ M P GSPL +   GV++TD+  VV  M  M R+G
Sbjct: 119 GKTMYVIPYLMAPAGSPLDRFAAGVQLTDNRNVVLQMIRMARVG 162


>UniRef50_A1IAX6 Cluster: Phosphoenolpyruvate carboxykinase; n=2;
           Desulfobacterales|Rep: Phosphoenolpyruvate carboxykinase
           - Candidatus Desulfococcus oleovorans Hxd3
          Length = 649

 Score = 41.1 bits (92), Expect = 0.038
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = +3

Query: 456 SVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAM 587
           +V   R   LAEHM I G+  P  ++ +   A PS CGKT  AM
Sbjct: 253 AVYEHRGEQLAEHMFITGMQGPGNRQTWCVGAAPSGCGKTTTAM 296



 Score = 37.1 bits (82), Expect = 0.61
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTR 243
           G+T+ V  +S GPVG+P S   +E + S YV++S  ++ R
Sbjct: 143 GKTLIVGFYSRGPVGAPASNPAIEASTSAYVLHSAEILYR 182


>UniRef50_UPI0000ECA795 Cluster: UPI0000ECA795 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECA795 UniRef100 entry -
           Gallus gallus
          Length = 117

 Score = 39.9 bits (89), Expect = 0.087
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = -2

Query: 756 GLXXXLPXDXTWXQLPKNPFFRXKWPRKYAVLXRNFIKAMSSPTXSTLYPG-QCLASSWQ 580
           G+   +    T  Q P   FF  ++P+K +    N  +  S     ++YP   C AS WQ
Sbjct: 24  GMQMSVTDTSTGGQTPNRTFFLLRYPKKISKQVSNSTRPTSQQFRLSIYPPYTCKASFWQ 83

Query: 579 GSFSRKLKEKRQRCSASYLEG 517
            S  ++LK  R     S LEG
Sbjct: 84  QSLEKQLKSDR-LAKGSPLEG 103


>UniRef50_Q7R205 Cluster: GLP_163_12370_10406; n=2; Giardia
           intestinalis|Rep: GLP_163_12370_10406 - Giardia lamblia
           ATCC 50803
          Length = 654

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 32/109 (29%), Positives = 43/109 (39%), Gaps = 5/109 (4%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSGGTPGWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKCFALRLG 455
           +  F    H+VG   +   P D     I   P E+ +              KK  ALRL 
Sbjct: 179 NRSFYAFYHSVGRTDSANRPVDIDKRRIYINPVEHLVYTINNSYAGNALACKK-LALRLA 237

Query: 456 SVIARR---EGWLAEHMLIVGITNP--QGKKRYIAAAFPSACGKTNLAM 587
              +     +  L EHM +    NP     K  +  AFPSACGKT+ +M
Sbjct: 238 IYDSNHHPEKNNLTEHMFLSTFANPCIPNDKLNVCGAFPSACGKTSTSM 286



 Score = 37.5 bits (83), Expect = 0.46
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 4/67 (5%)
 Frame = +1

Query: 121 DGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG-AKF*KFYVKTSS---S 288
           +G+ M +  + +GPV    SK  V+ TDS Y+++S  V+ R G A+    ++K +S   S
Sbjct: 122 EGKQMLIAFYCLGPVNCSFSKTAVQFTDSWYILHSENVLYRNGFAQMVNRHMKETSANRS 181

Query: 289 FVVFTQS 309
           F  F  S
Sbjct: 182 FYAFYHS 188


>UniRef50_A7ES19 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 210

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = -2

Query: 594 ASSWQGSFSRKLKEKRQRCSASYLEGWLCRR*AYVRPA-ILRDERSLIPDVERSTSCPTN 418
           +SS +       +  R RC A     W+  +   +R   +++DER  I  V      P +
Sbjct: 111 SSSRENKLGSAYRYCRNRCEACTGSSWISEKPTPIRRGKMVKDERGRIAPVYCDEG-PID 169

Query: 417 YCRRIHCRSLRSRSQPACGV*WCS*GRRANPEC 319
             RRI   S+R+ S  ACG      GRR   EC
Sbjct: 170 LGRRIAWESIRTVSLNACGTSSEWNGRRGRTEC 202


>UniRef50_Q4PCB9 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1673

 Score = 35.5 bits (78), Expect = 1.9
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = -2

Query: 630  PTXSTLYPGQCLASSWQGSFSRKLKEKRQRCSASYLEGWLCRR*AYVRPAILR-DERSLI 454
            P+   L+  + +   W G   + L+E R + S  +L   +      + P I   DER++ 
Sbjct: 1203 PSAEMLFEHEWMQQVWSGH--KDLRELRPQDSVPFLRR-ISADARRLDPRIFEEDERAVQ 1259

Query: 453  PDVERSTSCPTNYCRRIHCRSLRSRSQPA 367
            P +ERSTS P    +R    +LR+ + PA
Sbjct: 1260 PAMERSTSSPAPTLQRPGLEALRANTSPA 1288


>UniRef50_A0UPS6 Cluster: Putative uncharacterized protein
           precursor; n=2; Burkholderia cepacia complex|Rep:
           Putative uncharacterized protein precursor -
           Burkholderia multivorans ATCC 17616
          Length = 575

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = -2

Query: 318 HRSRLREDNERTARLDVEFLELRSNSSHDSHRI-NHVRRIRDFYADLRERRSHRTHREWY 142
           H  R+R   ++  R      E+ ++ +HD H   +  RR R   AD+R R  H  HRE  
Sbjct: 126 HPERVRRAEDQRQRGGRADPEVHADRAHDHHEFADEARRARQ--ADVRHREQHGKHREAR 183

Query: 141 H 139
           H
Sbjct: 184 H 184


>UniRef50_Q7RIW2 Cluster: Putative uncharacterized protein PY03504;
           n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY03504 - Plasmodium yoelii yoelii
          Length = 1088

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 22/63 (34%), Positives = 31/63 (49%)
 Frame = +3

Query: 30  LKYKVK*NEMKMTNLKN*VINWDETKWNGMRWTHNVRDTILDGSCGISSLEDRRRNHGFA 209
           L ++ K N +K  N KN VI ++E K N +  +H     I          +DR RN+GF 
Sbjct: 182 LNHEKKKNYLKKIN-KNNVIEFEEQKQNALLESHMDFKNICPNKLDYQKRDDRIRNNGFW 240

Query: 210 LRG 218
           L G
Sbjct: 241 LCG 243


>UniRef50_A6DFE7 Cluster: Putative uncharacterized protein; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Putative
           uncharacterized protein - Lentisphaera araneosa HTCC2155
          Length = 181

 Score = 33.1 bits (72), Expect = 10.0
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -2

Query: 687 KWPRKYAVLXRNFIKAMSSPTXSTLYPGQCLASSWQGSFSRKLKEKRQRCSASY 526
           +W ++Y  L RN+I+A+S      +   Q L    QG    K   K   CS +Y
Sbjct: 101 RWEKQYYELMRNYIRAISHSVDIIIDHLQILVLQKQGMDHPKTSRKNYNCSLNY 154


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 861,030,684
Number of Sequences: 1657284
Number of extensions: 17010263
Number of successful extensions: 43607
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 41598
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43566
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 81981722200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -