SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30159.Seq
         (712 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0BHF0 Cluster: Chromosome undetermined scaffold_108, w...    36   1.3  
UniRef50_Q187Y3 Cluster: Putative membrane protein; n=2; Clostri...    35   2.3  
UniRef50_Q2NEB7 Cluster: Predicted membrane-associated Zn-depend...    33   6.9  

>UniRef50_A0BHF0 Cluster: Chromosome undetermined scaffold_108,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_108,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 340

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/41 (31%), Positives = 26/41 (63%)
 Frame = -2

Query: 618 IFRITLFRCTYVYYFYXIRSGVFXXLYFTYYIVPRIYTKHY 496
           + R+  + C  +Y+F+ +R+ V   LY+ +Y++   YTK+Y
Sbjct: 69  LVRLVTYNCC-LYFFHLVRNSVIIILYY-FYVIVAFYTKYY 107


>UniRef50_Q187Y3 Cluster: Putative membrane protein; n=2;
           Clostridium difficile|Rep: Putative membrane protein -
           Clostridium difficile (strain 630)
          Length = 226

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 210 CLVQYQFVEVINKTLKSDLNTKLELFTMYVFNLFFYLSL 94
           CL+ YQ V +  K LK + N  + L  +Y+F L+ YL+L
Sbjct: 15  CLI-YQIVVIKRKNLKVEKNVMIHLVWVYIFLLYIYLAL 52


>UniRef50_Q2NEB7 Cluster: Predicted membrane-associated Zn-dependent
           protease; n=1; Methanosphaera stadtmanae DSM 3091|Rep:
           Predicted membrane-associated Zn-dependent protease -
           Methanosphaera stadtmanae (strain DSM 3091)
          Length = 429

 Score = 33.1 bits (72), Expect = 6.9
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -2

Query: 243 QFELLLPSCHRCLVQYQFVEVINKTLKSDLN-TKLELFTMYVFNLFFYLSLVVIL 82
           ++   LP C RC +  +F  ++N     +LN   +E  T Y+ +LF  + +V+I+
Sbjct: 364 KYTKFLPGCIRCWISRRFNWILNFISHHELNDNTVEHITRYISSLFIVILVVLII 418


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 519,908,909
Number of Sequences: 1657284
Number of extensions: 8622551
Number of successful extensions: 17224
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 16336
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17143
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57024798702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -