SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0N2R6 Cluster: Signal recognition particle receptor be...   170   4e-41
UniRef50_UPI00015B56C7 Cluster: PREDICTED: similar to signal rec...    97   6e-19
UniRef50_UPI0000D571E3 Cluster: PREDICTED: similar to Signal rec...    95   1e-18
UniRef50_Q7Q513 Cluster: ENSANGP00000020947; n=2; Culicidae|Rep:...    88   3e-16
UniRef50_Q6IDG2 Cluster: RE55992p; n=4; Sophophora|Rep: RE55992p...    80   8e-14
UniRef50_A7REZ8 Cluster: Predicted protein; n=1; Nematostella ve...    74   4e-12
UniRef50_UPI0000E47BA2 Cluster: PREDICTED: hypothetical protein;...    73   9e-12
UniRef50_Q5BWC2 Cluster: SJCHGC01433 protein; n=2; Schistosoma j...    66   8e-10
UniRef50_Q9Y5M8 Cluster: Signal recognition particle receptor su...    64   3e-09
UniRef50_Q22CM5 Cluster: Small GTP-binding protein domain contai...    52   1e-05
UniRef50_Q22013 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_A2ETJ6 Cluster: Putative uncharacterized protein; n=1; ...    48   4e-04
UniRef50_Q00Z71 Cluster: Signal recognition particle receptor, b...    45   0.003
UniRef50_Q9FFK7 Cluster: Signal recognition particle receptor be...    41   0.032
UniRef50_A3FPT5 Cluster: Putative uncharacterized protein; n=1; ...    41   0.032
UniRef50_A7TH43 Cluster: Putative uncharacterized protein; n=1; ...    38   0.23 
UniRef50_Q5KMQ0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.40 
UniRef50_UPI000051A44B Cluster: PREDICTED: similar to K06A9.1b; ...    36   1.6  
UniRef50_Q03DJ8 Cluster: Glycosyltransferase; n=1; Pediococcus p...    36   1.6  
UniRef50_A7PCY0 Cluster: Chromosome chr17 scaffold_12, whole gen...    34   3.7  
UniRef50_A7LXC4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.9  
UniRef50_Q4DFN4 Cluster: Putative uncharacterized protein; n=3; ...    34   4.9  
UniRef50_Q8BGR6 Cluster: ADP-ribosylation factor-like protein 15...    34   4.9  
UniRef50_Q9NXU5 Cluster: ADP-ribosylation factor-like protein 15...    33   8.6  

>UniRef50_Q0N2R6 Cluster: Signal recognition particle receptor beta
           subunit; n=2; Endopterygota|Rep: Signal recognition
           particle receptor beta subunit - Bombyx mori (Silk moth)
          Length = 280

 Score =  170 bits (413), Expect = 4e-41
 Identities = 99/174 (56%), Positives = 107/174 (61%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIV 437
           TL FV LAYSQY QTFTSMKENIE  ITSNKTLKIVDLPG ERLRNKFF QH SSAKGIV
Sbjct: 61  TLLFVRLAYSQYRQTFTSMKENIEEYITSNKTLKIVDLPGQERLRNKFFEQHKSSAKGIV 120

Query: 438 FVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
           FVI SINI +EI DVA YLYTIL      G   P     NKQ QP  K +Q+ KG  EKE
Sbjct: 121 FVIDSINIQKEIRDVAEYLYTILCDPIIQGNTTPLLILCNKQDQPLAKGSQVIKGLLEKE 180

Query: 618 LI*FV*PNRIHWQSVDSSEGXIRGVPRERXXRFGFSXLRN*SRIPQSARPTPDD 779
           +           QSVD SEG       +    F FS +RN     + +  T DD
Sbjct: 181 INLVRVTKSNQLQSVDPSEGNTGSFLGKEGKDFEFSHIRNKVEFAECSANTNDD 234



 Score =  124 bits (298), Expect = 4e-27
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +1

Query: 79  MESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           MESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNSVLLMGLSDSG
Sbjct: 1   MESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNSVLLMGLSDSG 59


>UniRef50_UPI00015B56C7 Cluster: PREDICTED: similar to signal
           recognition particle receptor beta subunit; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to signal
           recognition particle receptor beta subunit - Nasonia
           vitripennis
          Length = 286

 Score = 96.7 bits (230), Expect = 6e-19
 Identities = 52/121 (42%), Positives = 74/121 (61%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIV 437
           TL +  L +++Y QT TS+KENI   +  N ++KIVD+PG ERLR K+F ++ +SAKG+V
Sbjct: 99  TLIYARLMHTKYVQTHTSVKENIGDALEYNSSVKIVDIPGHERLRYKYFDKYKNSAKGLV 158

Query: 438 FVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
           F+I S  I ++I D A YLYT+L   S     +P     NKQ     K + + K   EKE
Sbjct: 159 FIIDSSTIQKDIRDAAEYLYTLLSDPSL-SRNIPVLILCNKQDHTLAKGSNVIKTLLEKE 217

Query: 618 L 620
           +
Sbjct: 218 M 218



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 503 LVDPIIXGNTTPXLILWQQTGPALAKGSPVIQGLLGKGINLVRVTQSDPL 652
           L DP +  N  P LIL  +    LAKGS VI+ LL K +NL+RVT++  L
Sbjct: 181 LSDPSLSRNI-PVLILCNKQDHTLAKGSNVIKTLLEKEMNLLRVTKTSQL 229


>UniRef50_UPI0000D571E3 Cluster: PREDICTED: similar to Signal
           recognition particle receptor beta subunit (SR-beta)
           (Protein APMCF1); n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to Signal recognition particle
           receptor beta subunit (SR-beta) (Protein APMCF1) -
           Tribolium castaneum
          Length = 242

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 53/121 (43%), Positives = 67/121 (55%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIV 437
           TL F  L Y ++ QT TS+KENI   I +N  LKIVD+PG ERLRNKF  Q+    +GIV
Sbjct: 55  TLIFSQLVYEKFIQTHTSIKENIGTYIVNNNYLKIVDIPGHERLRNKFIEQYKELTRGIV 114

Query: 438 FVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
           FV+ S  I +++ D A +LY IL   +            NKQ Q   K +   K   EKE
Sbjct: 115 FVVDSSTIQQDVRDTAEFLYNILVDSTVVRNSPNLLILCNKQDQTLAKGSNAVKSILEKE 174

Query: 618 L 620
           L
Sbjct: 175 L 175



 Score = 39.5 bits (88), Expect = 0.099
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 503 LVDPIIXGNTTPXLILWQQTGPALAKGSPVIQGLLGKGINLVRVTQSDPLA 655
           LVD  +  N+   LIL  +    LAKGS  ++ +L K +N +RVT+S  LA
Sbjct: 137 LVDSTVVRNSPNLLILCNKQDQTLAKGSNAVKSILEKELNTLRVTKSHQLA 187



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +1

Query: 148 LLSLIVLAVTLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           L++++V+ VTL+ + ++ RR   RN +LL GL DSG
Sbjct: 18  LIAVLVIVVTLVLFVLYRRRKATRNCILLTGLCDSG 53


>UniRef50_Q7Q513 Cluster: ENSANGP00000020947; n=2; Culicidae|Rep:
           ENSANGP00000020947 - Anopheles gambiae str. PEST
          Length = 244

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 61/170 (35%), Positives = 88/170 (51%), Gaps = 2/170 (1%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSN-KTLKIVDLPGXERLRNKFFXQHXSSAKGI 434
           T  F  L      +TFTS+KEN+    T   + LK+VD+PG ERLR KFF ++ + AK I
Sbjct: 62  TYLFAHLCLGGARETFTSIKENVGSFKTERGRVLKMVDVPGNERLRGKFFDEYKNIAKAI 121

Query: 435 VFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEK 614
           V++I S+ + ++I DVA +LYTIL  ++   +++P     NKQ +   K     K   EK
Sbjct: 122 VYMIDSVTVQKDIRDVADFLYTILVDKA--TSKVPVVVLCNKQDETLAKTETAIKSMLEK 179

Query: 615 ELI*FV*PNRIHWQSVDSSEGXIRGVPRERXXRFGFSXLRN*SR-IPQSA 761
           E+       R   QSVD+S      + +     F F  L    R +P SA
Sbjct: 180 EINIVRQTRRSQLQSVDNSSSSDTFLGKSASVDFEFEQLGQRVRFVPCSA 229


>UniRef50_Q6IDG2 Cluster: RE55992p; n=4; Sophophora|Rep: RE55992p -
           Drosophila melanogaster (Fruit fly)
          Length = 268

 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (0%)
 Frame = +3

Query: 267 FVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVI 446
           F+ L + ++  TFTS+KEN+    T + + ++VD+PG  R+R+K    +   AKGIVFV+
Sbjct: 89  FMQLIHGKFPATFTSIKENVGDYRTGSASARLVDIPGHYRVRDKCLELYKHRAKGIVFVV 148

Query: 447 XSINIXEEIXDVAXYLYTILWIRSFXGTQ-LPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            S+   ++I DVA +LYTIL   S   TQ        NKQ Q   K AQ+ K   E EL
Sbjct: 149 DSVTAHKDIRDVADFLYTIL---SDSATQPCSVLVLCNKQDQTTAKSAQVIKSLLESEL 204


>UniRef50_A7REZ8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXIT----SNKTLKIVDLPGXERLRNKFFXQHXSSA 425
           TL F  L    +  T TSMKEN+         S K + +VDLPG +R+R++F  ++   A
Sbjct: 72  TLLFNRLLDGSHVMTHTSMKENVGSYKLKGKKSGKQVNMVDLPGHDRIRSQFLEKYKEQA 131

Query: 426 KGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGY 605
           + I+FV+ S+N   E+ DVA  +Y IL  ++     +P     NKQ     K A+  K  
Sbjct: 132 RAILFVVDSVNFPREVRDVAEQMYDILSHKTLMRAAVPILVVCNKQDFAMAKSARAIKAQ 191

Query: 606 SEKEL 620
            EKE+
Sbjct: 192 LEKEI 196


>UniRef50_UPI0000E47BA2 Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 262

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 47/163 (28%), Positives = 83/163 (50%), Gaps = 3/163 (1%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENI-EXXITSNKT--LKIVDLPGXERLRNKFFXQHXSSAK 428
           TL +  L + +  +++TS+KEN     +T  ++  L++VD+PG +R R +F+ +  + A+
Sbjct: 69  TLLYSRLVHKKAIESYTSIKENAGPYQVTGQRSMLLEVVDIPGNDRQRIQFWNRFKTQAR 128

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYS 608
           G+VF++ S +I +++ +VA +LYT+L   +      P     NKQ     K A++ +   
Sbjct: 129 GVVFLVDSSSIQKDVKEVAEFLYTLLSDSTTTNLNTPFVIACNKQDITMAKSARIIQILL 188

Query: 609 EKELI*FV*PNRIHWQSVDSSEGXIRGVPRERXXRFGFSXLRN 737
           EKE+            S D S G       ++   F FS L N
Sbjct: 189 EKEMTTLRVTRAATLSSTDGSSGDANTFLGKQGKDFDFSHLAN 231


>UniRef50_Q5BWC2 Cluster: SJCHGC01433 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC01433 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 225

 Score = 66.5 bits (155), Expect = 8e-10
 Identities = 36/121 (29%), Positives = 59/121 (48%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIV 437
           T  F  + Y     TFTS+ EN+       K   +VD+PG E++RN+   ++ +    +V
Sbjct: 44  TTLFSSIVYGNPSSTFTSLNENVSNVQIDKKNFVLVDVPGHEKVRNEIIQKYKTDTLALV 103

Query: 438 FVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
           FVI S ++  +I D++ +LY IL  + F   ++      NKQ     K   +     E+E
Sbjct: 104 FVIDSKSVQSDIKDISEFLYNILVDKIFIKNRVRLLIACNKQDATTAKGVGVVTHLLERE 163

Query: 618 L 620
           L
Sbjct: 164 L 164


>UniRef50_Q9Y5M8 Cluster: Signal recognition particle receptor
           subunit beta; n=115; Euteleostomi|Rep: Signal
           recognition particle receptor subunit beta - Homo
           sapiens (Human)
          Length = 271

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>UniRef50_Q22CM5 Cluster: Small GTP-binding protein domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Small GTP-binding protein domain containing
           protein - Tetrahymena thermophila SB210
          Length = 260

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 5/110 (4%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSM---KENIEXXITSNKTLKI--VDLPGXERLRNKFFXQHXSS 422
           T     LA  Q  QT +S+   + NIE     +++ KI  VD+PG    ++KF  +   +
Sbjct: 77  TALLYQLANGQTTQTCSSIDPTETNIEVKFNEDESKKISFVDVPGHNYTKHKFINE-LGA 135

Query: 423 AKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCGNKQXQP 572
           A+GI+F+I S N+     +   YLY I+  + F   ++P   C NK  QP
Sbjct: 136 ARGIIFLIDSSNL-NSYGNSVDYLYHIMIQKVFQDKEIPVLLCANKADQP 184


>UniRef50_Q22013 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 240

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +3

Query: 282 YSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAK--GIVFVIXSI 455
           Y    +T+TSM EN       +K  +I+D PG +RLR K    H  S     IVFV+ S 
Sbjct: 65  YPTTTKTYTSMVENKITLRIKDKEKEIIDYPGNDRLRQKLIENHLHSRSLLRIVFVVDSA 124

Query: 456 NIXEEIXDVAXYLYTI 503
              +   DVA   YT+
Sbjct: 125 AFSKNARDVAELFYTV 140


>UniRef50_A2ETJ6 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 230

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIV 437
           T  F  L   +   T TS  EN    I  N+ + ++D PG  R++ +        AK I+
Sbjct: 47  TKLFYHLTAHRIHPTVTSQTENRFSLIVKNRIINLIDEPGHARVKTQVLSS-IRDAKAII 105

Query: 438 FVIXSINIXEEIXDVAXYLYTIL 506
           FVI S  +  ++ D+A  LY +L
Sbjct: 106 FVIDSETVLSQMSDIANLLYDVL 128


>UniRef50_Q00Z71 Cluster: Signal recognition particle receptor, beta
           subunit; n=2; Ostreococcus|Rep: Signal recognition
           particle receptor, beta subunit - Ostreococcus tauri
          Length = 307

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 342 SNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSF 521
           + + ++++D+PG  +LR +        AK +VFV+ S+ +  E  +VA +L++IL   +F
Sbjct: 133 TKRKVRVIDVPGHPKLRREAMLW-LKQAKAVVFVVDSVTVANERKEVAQFLFSILSDENF 191

Query: 522 XGTQLPX*YCGNK 560
              +LP     NK
Sbjct: 192 QRRRLPLMLACNK 204


>UniRef50_Q9FFK7 Cluster: Signal recognition particle receptor beta
           subunit-like protein; n=5; Arabidopsis thaliana|Rep:
           Signal recognition particle receptor beta subunit-like
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 260

 Score = 41.1 bits (92), Expect = 0.032
 Identities = 26/91 (28%), Positives = 41/91 (45%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXG 527
           K + +VD+PG  RLR K   +    A  IVFV+ ++         + YLY IL   +   
Sbjct: 109 KPVHLVDVPGHSRLRPKL-EEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNANVVK 167

Query: 528 TQLPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            ++P   C NK  +      +  +   EKE+
Sbjct: 168 KKIPVLLCCNKTDKLTAHTKEFIRKQMEKEI 198


>UniRef50_A3FPT5 Cluster: Putative uncharacterized protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: Putative
           uncharacterized protein - Cryptosporidium parvum Iowa II
          Length = 191

 Score = 41.1 bits (92), Expect = 0.032
 Identities = 28/94 (29%), Positives = 48/94 (51%)
 Frame = +3

Query: 225 SIVNGPIRLWXTLXFVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFF 404
           S++ GP     T  F  +  ++  +T TS+   +   I  N+ L  VD+PG  R+ N F 
Sbjct: 53  SLIIGPSGSGKTTLFYKVKKNKTTRTTTSIVPGVTR-IKDNRYL--VDIPGNRRIINDFI 109

Query: 405 XQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTIL 506
            ++ +++  I+FVI S N      D A  L++I+
Sbjct: 110 LKYLNNSVSIIFVIDS-NDKSSFKDAAEILFSII 142


>UniRef50_A7TH43 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 271

 Score = 38.3 bits (85), Expect = 0.23
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 5/97 (5%)
 Frame = +3

Query: 231 VNGPIRLWXTLXFVXLAYSQYXQTFTSMKENI--EXXITSN-KTLKIVDLPGXERLRNKF 401
           + GP     T  F  L    +  T  S   N   +  ++S+ K++ +++ PG  +LR K 
Sbjct: 60  IAGPSNSGKTALFHWLTTETFKTTVISQFPNTCEDFKLSSDDKSVSLIEFPGNFKLRYKL 119

Query: 402 FX--QHXSSAKGIVFVIXSINIXEEIXDVAXYLYTIL 506
               ++ ++ KGIVF++ S    +++ + A +LY IL
Sbjct: 120 LDSLRNSTNIKGIVFLVDSTVDPKQLVETAEFLYQIL 156


>UniRef50_Q5KMQ0 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 353

 Score = 37.5 bits (83), Expect = 0.40
 Identities = 31/108 (28%), Positives = 49/108 (45%), Gaps = 7/108 (6%)
 Frame = +3

Query: 237 GPIRLWXTLXFVXLAYSQYXQTFTSM-KENIEXXITS------NKTLKIVDLPGXERLRN 395
           GP     T  F  L +  Y QT TS+   +      S       K ++++D+PG  RLR+
Sbjct: 94  GPSDGGKTSLFTKLIHDIYPQTHTSIVPSDTTFDFDSPYEDDQKKQIRLIDIPGHPRLRD 153

Query: 396 KFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLP 539
           +   ++ + + G+VFV+    I      VA  L  IL   S   ++LP
Sbjct: 154 E-VKKYIADSAGVVFVVDIQGIVRNASGVAEQLPPILTALSNISSRLP 200


>UniRef50_UPI000051A44B Cluster: PREDICTED: similar to K06A9.1b; n=2;
            Coelomata|Rep: PREDICTED: similar to K06A9.1b - Apis
            mellifera
          Length = 2422

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +2

Query: 515  IIXGNTTPXLILWQQTGPALAKGSPVIQGLLG 610
            II G T+P LIL  QTGP ++ G  + QG +G
Sbjct: 1484 IIKGQTSPGLILKGQTGPGISIGGSIDQGTIG 1515


>UniRef50_Q03DJ8 Cluster: Glycosyltransferase; n=1; Pediococcus
           pentosaceus ATCC 25745|Rep: Glycosyltransferase -
           Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)
          Length = 653

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +1

Query: 46  DLVSVKRKNSTMESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNS 225
           D+ SV ++ +     V+ +      I  +P+ ITLL+ I+L  T ++WW FSRR     +
Sbjct: 308 DIKSVIKQRTRWARGVI-QSCRNMHIFTNPK-ITLLNRIILINTWLYWWSFSRRLIYIAA 365

Query: 226 VLLMGL 243
            LL  L
Sbjct: 366 PLLYAL 371


>UniRef50_A7PCY0 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 259

 Score = 34.3 bits (75), Expect = 3.7
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXG 527
           + + +VD+PG   LR+K   ++   A G++F++  +        +A YL  IL   +   
Sbjct: 108 RLIHLVDVPGQSHLRSK-LDKYLPQAAGLIFLVDGLEFLRHCPAIAEYLLDILTNTTVVK 166

Query: 528 TQLPX*YCGNK 560
            ++P     NK
Sbjct: 167 RKIPVLIVCNK 177


>UniRef50_A7LXC4 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 1416

 Score = 33.9 bits (74), Expect = 4.9
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +1

Query: 130 DPRYITL-LSLIVLAVTL--IFWWIFSRRYTLRNSVLLMGLSDSGXLC 264
           D R +TL LSL+++ + L  I WW F++R  +RN V +  L     LC
Sbjct: 408 DSRQMTLVLSLVIVGLVLVVILWWFFNKRSKIRNQVDVERLQRILTLC 455


>UniRef50_Q4DFN4 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 309

 Score = 33.9 bits (74), Expect = 4.9
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 4/129 (3%)
 Frame = +3

Query: 342 SNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXD----VAXYLYTILW 509
           +N +  +VD PG  RLR+         A  +V V+ ++ I ++  +    +A  ++++  
Sbjct: 121 ANASQVVVDFPGHRRLRDSLL-SAVEEAMSVVVVVDAVTIQDDRQEGAQALAELIFSVFT 179

Query: 510 IRSFXGTQLPX*YCGNKQXQP*PKXAQLSKGYSEKELI*FV*PNRIHWQSVDSSEGXIRG 689
             +F G Q     C  K+ +     A+  +   E E+  FV   R   QS+DS     R 
Sbjct: 180 SSAFYGVQRVLVAC-TKRDELTSYSAKAVRKLLEAEITRFVTSRRGDLQSLDSILNSARV 238

Query: 690 VPRERXXRF 716
           V   +  +F
Sbjct: 239 VVGHKKSKF 247


>UniRef50_Q8BGR6 Cluster: ADP-ribosylation factor-like protein 15;
           n=27; Euteleostomi|Rep: ADP-ribosylation factor-like
           protein 15 - Mus musculus (Mouse)
          Length = 204

 Score = 33.9 bits (74), Expect = 4.9
 Identities = 22/91 (24%), Positives = 43/91 (47%)
 Frame = +3

Query: 345 NKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFX 524
           N  L + +L G + +R K++ ++   ++G++FV+ S +  +++      L++ L      
Sbjct: 75  NAVLNVKELGGADNIR-KYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQL- 132

Query: 525 GTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
              LP     N Q +P  +  Q  K Y E E
Sbjct: 133 -CTLPFLILANHQDKPAARSVQEIKKYFELE 162


>UniRef50_Q9NXU5 Cluster: ADP-ribosylation factor-like protein 15;
           n=6; Theria|Rep: ADP-ribosylation factor-like protein 15
           - Homo sapiens (Human)
          Length = 204

 Score = 33.1 bits (72), Expect = 8.6
 Identities = 22/91 (24%), Positives = 43/91 (47%)
 Frame = +3

Query: 345 NKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFX 524
           N  L + +L G + +R K++ ++   ++G++FV+ S +  +++      L++ L      
Sbjct: 75  NAILNVKELGGADNIR-KYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQL- 132

Query: 525 GTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
              LP     N Q +P  +  Q  K Y E E
Sbjct: 133 -CTLPFLILANHQDKPAARSVQEIKKYFELE 162


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 673,419,809
Number of Sequences: 1657284
Number of extensions: 11610350
Number of successful extensions: 25700
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 25030
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25677
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 70377768045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -