SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P15880 Cluster: 40S ribosomal protein S2; n=284; Eukary...   165   2e-39
UniRef50_UPI0000D9B7B9 Cluster: PREDICTED: similar to ribosomal ...   155   2e-36
UniRef50_O74892 Cluster: 40S ribosomal protein S2; n=5; Eukaryot...   144   2e-33
UniRef50_A4S964 Cluster: Cytosolic 80S ribosomal protein S2; Cyt...   129   9e-29
UniRef50_P25443 Cluster: 40S ribosomal protein S2; n=26; Eukaryo...   124   3e-27
UniRef50_UPI00005A5FBC Cluster: PREDICTED: similar to 40S riboso...   121   3e-26
UniRef50_O55213 Cluster: Ribosomal protein S2; n=11; Coelomata|R...   105   2e-21
UniRef50_Q8SRG6 Cluster: 40S RIBOSOMAL PROTEIN S2; n=1; Encephal...    99   1e-19
UniRef50_Q8TBR1 Cluster: MGC27348 protein; n=1; Homo sapiens|Rep...    93   7e-18
UniRef50_UPI00005A548A Cluster: PREDICTED: similar to 40S riboso...    90   7e-17
UniRef50_A0E2R7 Cluster: Chromosome undetermined scaffold_75, wh...    86   1e-15
UniRef50_UPI0000E20F35 Cluster: PREDICTED: similar to ribosomal ...    79   2e-13
UniRef50_Q9DC49 Cluster: Adult male lung cDNA, RIKEN full-length...    79   2e-13
UniRef50_UPI0000D62CF0 Cluster: UPI0000D62CF0 related cluster; n...    78   4e-13
UniRef50_Q16TN2 Cluster: Putative uncharacterized protein; n=1; ...    77   5e-13
UniRef50_UPI0000DC060C Cluster: UPI0000DC060C related cluster; n...    77   7e-13
UniRef50_Q673Q8 Cluster: Ribosomal protein S5; n=1; uncultured m...    73   8e-12
UniRef50_Q6LXD3 Cluster: 30S ribosomal protein S5P; n=6; Euryarc...    73   1e-11
UniRef50_Q6L1A7 Cluster: 30S ribosomal protein S5P; n=7; Archaea...    71   3e-11
UniRef50_UPI0000EB449D Cluster: UPI0000EB449D related cluster; n...    71   6e-11
UniRef50_UPI0000500CC2 Cluster: ribosomal protein S2; n=8; Euthe...    69   2e-10
UniRef50_A7D107 Cluster: Ribosomal protein S5; n=1; Halorubrum l...    67   5e-10
UniRef50_UPI0000DBFACC Cluster: UPI0000DBFACC related cluster; n...    66   2e-09
UniRef50_UPI0000D9ACAD Cluster: PREDICTED: similar to 40S riboso...    65   2e-09
UniRef50_P26815 Cluster: 30S ribosomal protein S5P; n=3; Halobac...    65   3e-09
UniRef50_Q6CKL2 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    64   4e-09
UniRef50_Q9UX87 Cluster: 30S ribosomal protein S5P; n=5; Sulfolo...    64   5e-09
UniRef50_Q8U017 Cluster: 30S ribosomal protein S5P; n=34; Archae...    63   1e-08
UniRef50_UPI0000DC004A Cluster: UPI0000DC004A related cluster; n...    62   2e-08
UniRef50_Q7XYL2 Cluster: Ribosomal protein rpS5; n=1; Bigelowiel...    59   1e-07
UniRef50_A7DRN6 Cluster: Ribosomal protein S5; n=1; Candidatus N...    58   3e-07
UniRef50_Q3LVZ1 Cluster: Ribosomal protein S2; n=1; Bigelowiella...    56   1e-06
UniRef50_O15579 Cluster: Ribosomal protein S2; n=1; Entamoeba hi...    55   3e-06
UniRef50_A0RUE7 Cluster: 30S ribosomal protein S5P; n=1; Cenarch...    55   3e-06
UniRef50_UPI0000DC0CDD Cluster: RBM27_MOUSE Isoform 2 of Q5SFM8 ...    54   4e-06
UniRef50_P59123 Cluster: 30S ribosomal protein S5; n=22; Bacteri...    54   5e-06
UniRef50_UPI000057EB46 Cluster: UPI000057EB46 related cluster; n...    53   1e-05
UniRef50_Q7Y258 Cluster: Ribosomal protein S5 precursor; n=1; Ch...    52   2e-05
UniRef50_Q6YR05 Cluster: 30S ribosomal protein S5; n=22; Bacteri...    52   3e-05
UniRef50_Q6F1X7 Cluster: 30S ribosomal protein S5; n=32; Bacteri...    51   4e-05
UniRef50_Q9PQP3 Cluster: 30S ribosomal protein S5; n=2; Firmicut...    50   7e-05
UniRef50_Q9RSL1 Cluster: 30S ribosomal protein S5; n=2; Deinococ...    50   9e-05
UniRef50_UPI0000D9EF8A Cluster: PREDICTED: similar to 40S riboso...    49   2e-04
UniRef50_Q9X1J2 Cluster: 30S ribosomal protein S5; n=6; Bacteria...    49   2e-04
UniRef50_A7QPU4 Cluster: Chromosome chr10 scaffold_138, whole ge...    48   3e-04
UniRef50_Q8RIH3 Cluster: 30S ribosomal protein S5; n=3; Fusobact...    48   3e-04
UniRef50_Q8EUD0 Cluster: 30S ribosomal protein S5; n=3; Mycoplas...    48   4e-04
UniRef50_Q74MD4 Cluster: 30S ribosomal protein S5P; n=1; Nanoarc...    48   5e-04
UniRef50_P93014 Cluster: 30S ribosomal protein S5, chloroplast p...    48   5e-04
UniRef50_P59122 Cluster: 30S ribosomal protein S5; n=40; Bacteri...    46   0.001
UniRef50_A0T0Y9 Cluster: Chloroplast 30S ribosomal protein S5; n...    46   0.001
UniRef50_Q92QF3 Cluster: 30S ribosomal protein S5; n=203; cellul...    45   0.003
UniRef50_Q7NEG9 Cluster: 30S ribosomal protein S5; n=34; cellula...    45   0.003
UniRef50_Q5NQ48 Cluster: 30S ribosomal protein S5; n=155; cellul...    44   0.004
UniRef50_P66575 Cluster: 30S ribosomal protein S5; n=128; Bacter...    44   0.006
UniRef50_O67563 Cluster: 30S ribosomal protein S5; n=5; Bacteria...    44   0.006
UniRef50_Q9XD19 Cluster: 30S ribosomal protein S5; n=17; Bacteri...    43   0.010
UniRef50_P73304 Cluster: 30S ribosomal protein S5; n=30; cellula...    42   0.031
UniRef50_Q6AP53 Cluster: 30S ribosomal protein S5; n=8; Bacteria...    41   0.041
UniRef50_Q5L704 Cluster: 30S ribosomal protein S5; n=7; Chlamydi...    40   0.071
UniRef50_UPI000056598D Cluster: UPI000056598D related cluster; n...    39   0.22 
UniRef50_A6PPX8 Cluster: Ribosomal protein S5; n=4; Bacteria|Rep...    39   0.22 
UniRef50_O15578 Cluster: Ribosomal protein S2; n=1; Entamoeba hi...    39   0.22 
UniRef50_A7CZB7 Cluster: Ribosomal protein S5; n=1; Opitutaceae ...    38   0.50 
UniRef50_Q6KI38 Cluster: 30S ribosomal protein S5; n=9; Firmicut...    38   0.50 
UniRef50_Q4EF76 Cluster: Putative uncharacterized protein; n=1; ...    37   0.66 
UniRef50_Q82X75 Cluster: 30S ribosomal protein S5; n=11; Bacteri...    36   1.2  
UniRef50_Q25815 Cluster: Rps5 protein; n=1; Plasmodium falciparu...    35   2.7  
UniRef50_Q5FFR5 Cluster: 30S ribosomal protein S5; n=5; canis gr...    35   2.7  
UniRef50_P33759 Cluster: 37S ribosomal protein S5, mitochondrial...    35   3.5  

>UniRef50_P15880 Cluster: 40S ribosomal protein S2; n=284;
           Eukaryota|Rep: 40S ribosomal protein S2 - Homo sapiens
           (Human)
          Length = 293

 Score =  165 bits (400), Expect = 2e-39
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>UniRef50_UPI0000D9B7B9 Cluster: PREDICTED: similar to ribosomal
           protein S2; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to ribosomal protein S2 - Macaca mulatta
          Length = 272

 Score =  155 bits (375), Expect = 2e-36
 Identities = 79/108 (73%), Positives = 84/108 (77%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQT AGQ TRFKAFV IGD 
Sbjct: 14  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTCAGQHTRFKAFVPIGDY 73

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GL VKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 74  NGHVGLSVKCSKEVATAIRGAIILAKLSIVPVCRGYWGNKIGKPHTVP 121



 Score = 39.5 bits (88), Expect = 0.12
 Identities = 38/144 (26%), Positives = 59/144 (40%), Gaps = 4/144 (2%)
 Frame = +2

Query: 182 VPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSCLYRNKHV 352
           +PVTKLG L+ + KI  LE IYLF    K S  +   + +S +  +++ +       K  
Sbjct: 1   MPVTKLGHLINDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPV----QKQT 56

Query: 353 PDSAHVS-RHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVTR*ES 529
               H   +  +P+      +      +++        + L      PV R Y   +   
Sbjct: 57  CAGQHTRFKAFVPIGDYNGHVGLSVKCSKEVATAIRGAIILAKLSIVPVCRGYWGNKIGK 116

Query: 530 HTTVPCKVXGQXWFPKQFRLIPAP 601
             TVPCKV G+        LIPAP
Sbjct: 117 PHTVPCKVTGRC-SSVLVHLIPAP 139


>UniRef50_O74892 Cluster: 40S ribosomal protein S2; n=5;
           Eukaryota|Rep: 40S ribosomal protein S2 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 253

 Score =  144 bits (350), Expect = 2e-33
 Identities = 67/110 (60%), Positives = 87/110 (79%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE++I+D+FL P LNDEV+K++PVQKQTRAGQRTRFKAFV IGD+
Sbjct: 48  KIKSIEEIYLYSLPIKEYQIVDYFL-PRLNDEVMKVVPVQKQTRAGQRTRFKAFVVIGDS 106

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRPLQ 549
           +GH+GLG+KC+KEVATAIRGAII+ KLS++   +   G  +G PH  P++
Sbjct: 107 DGHVGLGIKCAKEVATAIRGAIIMGKLSIMPIRRGYWGTALGDPHTVPVK 156



 Score = 51.2 bits (117), Expect = 4e-05
 Identities = 20/31 (64%), Positives = 27/31 (87%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLF 253
           ++++KEWVPVTKLGRLV+ GKI  +E IYL+
Sbjct: 28  RDEEKEWVPVTKLGRLVKAGKIKSIEEIYLY 58


>UniRef50_A4S964 Cluster: Cytosolic 80S ribosomal protein S2;
           Cytosolic 40S small ribosomal subunit protein S2; n=12;
           Eukaryota|Rep: Cytosolic 80S ribosomal protein S2;
           Cytosolic 40S small ribosomal subunit protein S2 -
           Ostreococcus lucimarinus CCE9901
          Length = 273

 Score =  129 bits (312), Expect = 9e-29
 Identities = 61/103 (59%), Positives = 80/103 (77%), Gaps = 1/103 (0%)
 Frame = +1

Query: 238 EHLLVF-LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIG 414
           EH+ +F LPIKE +I++ F+G  L DEV+KI PVQKQT AGQR RFKAFV +GD NGHIG
Sbjct: 69  EHIFLFSLPIKEHQIVEHFIGGELKDEVMKICPVQKQTTAGQRMRFKAFVVVGDCNGHIG 128

Query: 415 LGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           LGVK  KEVA +I+G++ILAKL+++   +   G+K+G+PH  P
Sbjct: 129 LGVKACKEVAHSIQGSMILAKLNIVPVRRGYWGSKLGEPHTIP 171



 Score = 50.4 bits (115), Expect = 7e-05
 Identities = 39/146 (26%), Positives = 62/146 (42%)
 Frame = +2

Query: 164 EDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSLISSSARP*MMRFLRSCLYRN 343
           +D+  WVP TKLGRLV++GKI  LE I+LF    K  + +            ++ C  + 
Sbjct: 45  DDKDVWVPCTKLGRLVQQGKIKSLEHIFLFSLPIKEHQIVEHFIGGELKDEVMKICPVQK 104

Query: 344 KHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVTR* 523
           +         +  + +      +     A ++     +  + L      PVRR Y  ++ 
Sbjct: 105 QTTAGQRMRFKAFVVVGDCNGHIGLGVKACKEVAHSIQGSMILAKLNIVPVRRGYWGSKL 164

Query: 524 ESHTTVPCKVXGQXWFPKQFRLIPAP 601
               T+P KV G+       RLIPAP
Sbjct: 165 GEPHTIPTKVHGKCG-SVHVRLIPAP 189


>UniRef50_P25443 Cluster: 40S ribosomal protein S2; n=26;
           Eukaryota|Rep: 40S ribosomal protein S2 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 254

 Score =  124 bits (300), Expect = 3e-27
 Identities = 61/100 (61%), Positives = 75/100 (75%)
 Frame = +1

Query: 238 EHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGL 417
           E  L  LP+KEF+IID  L P L DEV+ I PVQKQTRAGQRTRFKA V +GD+NGH+GL
Sbjct: 55  EIFLHSLPVKEFQIIDTLL-PGLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGL 113

Query: 418 GVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHN 537
           G+K +KEVA AIR  II+AKLSV+   +   G  +G+PH+
Sbjct: 114 GIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHS 153



 Score = 43.6 bits (98), Expect = 0.008
 Identities = 18/28 (64%), Positives = 23/28 (82%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYL 250
           ++K WVPVTKLGRLV+ GKI  +E I+L
Sbjct: 31  EEKGWVPVTKLGRLVKAGKITTIEEIFL 58


>UniRef50_UPI00005A5FBC Cluster: PREDICTED: similar to 40S ribosomal
           protein S2; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to 40S ribosomal protein S2 - Canis familiaris
          Length = 237

 Score =  121 bits (291), Expect = 3e-26
 Identities = 61/78 (78%), Positives = 65/78 (83%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           DEVLKIMPVQKQT AGQRTRF AFVAIGD NGH GLGVKCSKEVATAIR AIILAKLS++
Sbjct: 48  DEVLKIMPVQKQTCAGQRTRFTAFVAIGDYNGHFGLGVKCSKEVATAIREAIILAKLSIV 107

Query: 490 TSPKKLRGNKIGKPHNRP 543
              +   GNKIGKP+  P
Sbjct: 108 PLRQGYWGNKIGKPNTVP 125


>UniRef50_O55213 Cluster: Ribosomal protein S2; n=11; Coelomata|Rep:
           Ribosomal protein S2 - Rattus norvegicus (Rat)
          Length = 121

 Score =  105 bits (251), Expect = 2e-21
 Identities = 52/66 (78%), Positives = 54/66 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 49  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 108

Query: 400 NGHIGL 417
           NGH+GL
Sbjct: 109 NGHVGL 114



 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 23/38 (60%), Positives = 27/38 (71%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNS 274
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S
Sbjct: 29  KAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKES 66


>UniRef50_Q8SRG6 Cluster: 40S RIBOSOMAL PROTEIN S2; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S2 -
           Encephalitozoon cuniculi
          Length = 242

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 49/91 (53%), Positives = 60/91 (65%)
 Frame = +1

Query: 262 IKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEV 441
           I+E EI+D   G S+ +EVL I  VQKQTRAGQ+TR KA V +GD  GH+G+G K SKE 
Sbjct: 49  IREPEIVDLLCGNSIKEEVLSIKSVQKQTRAGQKTRIKAVVVVGDRKGHVGIGTKASKEA 108

Query: 442 ATAIRGAIILAKLSVLTSPKKLRGNKIGKPH 534
           A+AIRGAI  AK ++      L     GKPH
Sbjct: 109 ASAIRGAIARAKCAIRPVRLGLWDGAQGKPH 139



 Score = 35.9 bits (79), Expect = 1.5
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLF 253
           ++++ EW+P T +GRLV+  KI  LE I+ F
Sbjct: 15  RKEESEWIPKTAVGRLVKMLKITSLEQIFKF 45


>UniRef50_Q8TBR1 Cluster: MGC27348 protein; n=1; Homo sapiens|Rep:
           MGC27348 protein - Homo sapiens (Human)
          Length = 172

 Score = 93.5 bits (222), Expect = 7e-18
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPV+K+TRAGQRTRFKAFVAI D 
Sbjct: 2   KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDY 61

Query: 400 NGHIG 414
           NG+ G
Sbjct: 62  NGYAG 66


>UniRef50_UPI00005A548A Cluster: PREDICTED: similar to 40S ribosomal
           protein S2; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to 40S ribosomal protein S2 - Canis familiaris
          Length = 213

 Score = 90.2 bits (214), Expect = 7e-17
 Identities = 42/61 (68%), Positives = 49/61 (80%)
 Frame = +1

Query: 361 RTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNR 540
           + RFKAFVAIGD+NG +G GVKCSKE ATAIRGA+ILAKLS+L  P+   GN+I KPH  
Sbjct: 61  KIRFKAFVAIGDDNGQVGPGVKCSKEAATAIRGAVILAKLSILPVPRGYWGNEIRKPHTV 120

Query: 541 P 543
           P
Sbjct: 121 P 121



 Score = 33.5 bits (73), Expect = 8.2
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKI 226
           + KEW+PVT LGRLV++ KI
Sbjct: 43  EDKEWIPVTGLGRLVKDMKI 62


>UniRef50_A0E2R7 Cluster: Chromosome undetermined scaffold_75, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_75,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 327

 Score = 86.2 bits (204), Expect = 1e-15
 Identities = 48/103 (46%), Positives = 68/103 (66%), Gaps = 2/103 (1%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           +PIKE++I+D FL  +L +E L I PVQKQT AGQ+TRFKA+V +GD++ HIGLG K +K
Sbjct: 90  IPIKEYQIVDHFL-KTLKEEPLAIGPVQKQTCAGQKTRFKAYVVVGDSHQHIGLGWKSAK 148

Query: 436 EVATAIRGAIILAKLSVL--TSPKKLRGNKIGKPHNRPLQSXR 558
           EV  AI+    L +      +S K++ G +     + P+QS R
Sbjct: 149 EVQGAIQELCNLNQCQTQFDSSQKRILGKQDRLTTHSPMQSDR 191



 Score = 44.0 bits (99), Expect = 0.006
 Identities = 18/28 (64%), Positives = 24/28 (85%)
 Frame = +2

Query: 170 QKEWVPVTKLGRLVREGKIDKLESIYLF 253
           ++EWVP+TKLGRLV+ GKI  LE+I+ F
Sbjct: 61  EQEWVPLTKLGRLVKGGKIKSLETIFQF 88


>UniRef50_UPI0000E20F35 Cluster: PREDICTED: similar to ribosomal
           protein S2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to ribosomal protein S2 - Pan troglodytes
          Length = 223

 Score = 79.0 bits (186), Expect = 2e-13
 Identities = 44/109 (40%), Positives = 61/109 (55%)
 Frame = +1

Query: 160 QGRPERVGSCHQTRPSCSRRKNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQ 339
           QG    +       P     K +  + +L   LPIKEFE+ DF LG  L D+VLK+M VQ
Sbjct: 116 QGLAPELSKAASESPQVKDMKMKSLKVYLFS-LPIKEFEVTDFLLGVPLKDKVLKLMFVQ 174

Query: 340 KQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSV 486
           KQ +AG+R RFK  V I D N ++ LGV+  KE+  A+    +L+ + V
Sbjct: 175 KQPKAGRRIRFKVIVTIRDCNDNVSLGVEWPKELLIAVCRTNVLSIILV 223


>UniRef50_Q9DC49 Cluster: Adult male lung cDNA, RIKEN full-length
           enriched library, clone:1200003H09 product:ribosomal
           protein S2, full insert sequence; n=13; Eutheria|Rep:
           Adult male lung cDNA, RIKEN full-length enriched
           library, clone:1200003H09 product:ribosomal protein S2,
           full insert sequence - Mus musculus (Mouse)
          Length = 235

 Score = 79.0 bits (186), Expect = 2e-13
 Identities = 40/52 (76%), Positives = 41/52 (78%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFK 375
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFK
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFK 125



 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 23/38 (60%), Positives = 27/38 (71%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNS 274
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S
Sbjct: 54  KAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKES 91


>UniRef50_UPI0000D62CF0 Cluster: UPI0000D62CF0 related cluster; n=1;
           Mus musculus|Rep: UPI0000D62CF0 UniRef100 entry - Mus
           musculus
          Length = 215

 Score = 77.8 bits (183), Expect = 4e-13
 Identities = 45/93 (48%), Positives = 58/93 (62%)
 Frame = +1

Query: 253 FLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCS 432
           +LP+KEFEI DFFL  SL D+VLKI+P+ +  R  Q TRF +F  I +  GH G+GVKCS
Sbjct: 17  YLPVKEFEINDFFLEASLKDKVLKIIPLSR-FRNDQWTRFNSFDTI-NYGGHNGIGVKCS 74

Query: 433 KEVATAIRGAIILAKLSVLTSPKKLRGNKIGKP 531
           K+V TA+ G    +       P+   GN I KP
Sbjct: 75  KKVGTAV-GLSSWSSFLSSCLPRDYCGNNIRKP 106


>UniRef50_Q16TN2 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 181

 Score = 77.4 bits (182), Expect = 5e-13
 Identities = 43/96 (44%), Positives = 61/96 (63%)
 Frame = -2

Query: 549 LQGTVVWLSYLVTP*LLRTG*N*QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLE 370
           L G  V  + LVTP       N QL +D+S ++G G FLAAL  QT++ V V +G++ LE
Sbjct: 19  LAGHGVGFTDLVTPVASTHRNNGQLGQDDSPTDGGGHFLAALDAQTDVAVAVTDGDEGLE 78

Query: 369 TCALSGTCLFLYRHDLKNLIIQGRAEEEINDLEFFD 262
              L+GT L L  HDL++ ++Q  A+EEI+DLE F+
Sbjct: 79  ARTLTGTGLLLDGHDLQHFVLQRAAQEEIDDLELFN 114


>UniRef50_UPI0000DC060C Cluster: UPI0000DC060C related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC060C UniRef100 entry -
           Rattus norvegicus
          Length = 206

 Score = 77.0 bits (181), Expect = 7e-13
 Identities = 49/99 (49%), Positives = 59/99 (59%)
 Frame = +1

Query: 238 EHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGL 417
           E  L  LPIKE EIID FLG +L DEVLK +P QK TR GQ   +KA    GD NGH+  
Sbjct: 68  EIYLFSLPIKETEIIDIFLGAALKDEVLKSLPEQKGTRVGQ--YYKA----GDYNGHVIT 121

Query: 418 GVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPH 534
           G+    EVA  I+  IIL KL ++   +   G+K  KPH
Sbjct: 122 GL---DEVANTIQRVIILTKLPIVPVWRGYCGSKTSKPH 157


>UniRef50_Q673Q8 Cluster: Ribosomal protein S5; n=1; uncultured
           marine group II euryarchaeote DeepAnt-JyKC7|Rep:
           Ribosomal protein S5 - uncultured marine group II
           euryarchaeote DeepAnt-JyKC7
          Length = 202

 Score = 73.3 bits (172), Expect = 8e-12
 Identities = 39/93 (41%), Positives = 60/93 (64%)
 Frame = +1

Query: 238 EHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGL 417
           E L   LPI+E EI+D  L P L+D+VL +  +Q+ T +G+R RF     +G+++G++GL
Sbjct: 12  EALATGLPIREVEIVDALL-PGLDDDVLAVNMIQRMTDSGRRVRFNVLCVVGNSDGYVGL 70

Query: 418 GVKCSKEVATAIRGAIILAKLSVLTSPKKLRGN 516
            +   KEVA+ IR AI  AKL+++     +RGN
Sbjct: 71  AICKGKEVASTIRKAIDKAKLNMI---PVMRGN 100


>UniRef50_Q6LXD3 Cluster: 30S ribosomal protein S5P; n=6;
           Euryarchaeota|Rep: 30S ribosomal protein S5P -
           Methanococcus maripaludis
          Length = 225

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 36/78 (46%), Positives = 55/78 (70%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+ E EI+D  L P L ++VL +  VQ+  ++G+R R++A V +G+ NG++G+G+  SK
Sbjct: 42  LPLLEPEIVDALL-PDLEEQVLDVKLVQRMHKSGRRARYRATVVVGNKNGYVGVGMGKSK 100

Query: 436 EVATAIRGAIILAKLSVL 489
           EV  AIR AI  AKLS++
Sbjct: 101 EVGPAIRKAIAHAKLSLI 118


>UniRef50_Q6L1A7 Cluster: 30S ribosomal protein S5P; n=7;
           Archaea|Rep: 30S ribosomal protein S5P - Picrophilus
           torridus
          Length = 221

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++I+D+ + P L DEV+ I   Q+ T +G+R  +     +G+ NG++G+G   +K
Sbjct: 31  LPLKEYQIVDYLI-PDLKDEVINIERAQRMTDSGRRMNYSITAVVGNGNGYVGVGRGKAK 89

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNK--IGKPHNRP 543
           E A AI+ AI  AKL+++   +     +   GKPH  P
Sbjct: 90  EAAPAIKKAIDNAKLNIIEIKRGCGSWECGCGKPHTLP 127


>UniRef50_UPI0000EB449D Cluster: UPI0000EB449D related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB449D UniRef100
           entry - Canis familiaris
          Length = 196

 Score = 70.5 bits (165), Expect = 6e-11
 Identities = 40/84 (47%), Positives = 52/84 (61%)
 Frame = +1

Query: 283 DFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGA 462
           D  L  ++  + ++I   +K+T AGQ+TRFKAFV   D NGH+ L      EVATAIRGA
Sbjct: 1   DMSLLAAVKGKGIRIKSYKKKTHAGQQTRFKAFVVFRDYNGHVSL------EVATAIRGA 54

Query: 463 IILAKLSVLTSPKKLRGNKIGKPH 534
           IIL + S+  +     GNKI KPH
Sbjct: 55  IILDRSSIAIAWGGWSGNKIAKPH 78


>UniRef50_UPI0000500CC2 Cluster: ribosomal protein S2; n=8;
           Eutheria|Rep: ribosomal protein S2 - Rattus norvegicus
          Length = 233

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 36/52 (69%), Positives = 38/52 (73%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFK 375
           K +   E  L  LPIK  EIIDFFLG SL +EVLK MPVQKQTRAGQ TRFK
Sbjct: 74  KIKSLEEIYLFSLPIKGSEIIDFFLGASLKNEVLKTMPVQKQTRAGQWTRFK 125



 Score = 46.8 bits (106), Expect = 8e-04
 Identities = 21/38 (55%), Positives = 25/38 (65%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNS 274
           K + KEW+P TKLG LV++ KI  LE IYLF    K S
Sbjct: 54  KAEDKEWIPFTKLGHLVKDMKIKSLEEIYLFSLPIKGS 91


>UniRef50_A7D107 Cluster: Ribosomal protein S5; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Ribosomal protein S5 -
           Halorubrum lacusprofundi ATCC 49239
          Length = 265

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE EI+D  L P L DEVL I  VQ+ T +G+R +F+  VA+G+ +G++G       
Sbjct: 84  LPLKEAEIVDQLL-PGLEDEVLDINMVQRMTDSGRRVKFRCVVAVGNRDGYLGYAQARDD 142

Query: 436 EVATAIRGAIILAKLSVL 489
           +V  AI+ AI +AKL+++
Sbjct: 143 QVGGAIQKAIDVAKLNII 160


>UniRef50_UPI0000DBFACC Cluster: UPI0000DBFACC related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DBFACC UniRef100 entry -
           Rattus norvegicus
          Length = 172

 Score = 65.7 bits (153), Expect = 2e-09
 Identities = 28/48 (58%), Positives = 35/48 (72%)
 Frame = +1

Query: 337 QKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKL 480
           QKQT+ GQ+ R K F   GD NGH+GLG+KCSKEVATA +G  +  +L
Sbjct: 1   QKQTQTGQKNRLKTFCCYGDYNGHVGLGIKCSKEVATAFQGLWVKMQL 48


>UniRef50_UPI0000D9ACAD Cluster: PREDICTED: similar to 40S ribosomal
           protein S2; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to 40S ribosomal protein S2 - Macaca mulatta
          Length = 170

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/71 (49%), Positives = 45/71 (63%)
 Frame = +1

Query: 259 PIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 438
           PIKEFE+ DF L   L D+VLK+M V+KQ  AG+  RFK  V I   N ++ LGV+  KE
Sbjct: 14  PIKEFEVTDFLLEVPLKDKVLKLMFVKKQPEAGRWIRFKVIVTIRYCNDNVSLGVERPKE 73

Query: 439 VATAIRGAIIL 471
           +  A+   IIL
Sbjct: 74  LLIAVCRTIIL 84


>UniRef50_P26815 Cluster: 30S ribosomal protein S5P; n=3;
           Halobacteriaceae|Rep: 30S ribosomal protein S5P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 212

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE E++D  + P L DEVL I  VQ+ T +G+R +F+  VA+G+ +G IG       
Sbjct: 33  LPLKESEVVDQLV-PDLEDEVLDINMVQRMTDSGRRVKFRCVVAVGNRDGLIGYAEGRDD 91

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNK--IGKPHNRPLQS 552
           +V  AI+ AI +AKL+++   +     +   G+PH   L++
Sbjct: 92  QVGGAIQKAIDIAKLNIIDVSRGCGSWECGCGRPHTVALRT 132


>UniRef50_Q6CKL2 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome F of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 262

 Score = 64.5 bits (150), Expect = 4e-09
 Identities = 33/76 (43%), Positives = 52/76 (68%)
 Frame = -2

Query: 486 N*QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLII 307
           N QL  D++ S+G+ +FL+ L+TQT++TV V N +  LE+ +L+ + L L R D+ N I+
Sbjct: 121 NGQLGDDDTGSDGTSNFLSGLNTQTDVTVGVTNDDDSLESGSLTSSGLLLDRLDVHNFIL 180

Query: 306 QGRAEEEINDLEFFDW 259
           Q   ++ +NDLEF DW
Sbjct: 181 QVW-QQLVNDLEFLDW 195


>UniRef50_Q9UX87 Cluster: 30S ribosomal protein S5P; n=5;
           Sulfolobaceae|Rep: 30S ribosomal protein S5P -
           Sulfolobus solfataricus
          Length = 214

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LPI E EI+D  L P L  EV+ I  VQKQT AG+ +R+K  V +G+ +G++ +G   +K
Sbjct: 39  LPITEPEIVDVLL-PKLKYEVVDIKVVQKQTDAGEISRYKVLVIMGNMDGYVSIGTGKAK 97

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNK--IGKPHNRPLQ 549
           ++  AI+ AI  AK++++   +     +   G+PH+ P +
Sbjct: 98  QLRVAIQKAIRDAKMNIIPVRRGCGSWQCTCGEPHSLPFK 137


>UniRef50_Q8U017 Cluster: 30S ribosomal protein S5P; n=34;
           Archaea|Rep: 30S ribosomal protein S5P - Pyrococcus
           furiosus
          Length = 236

 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 36/80 (45%), Positives = 50/80 (62%), Gaps = 4/80 (5%)
 Frame = +1

Query: 262 IKEFEIIDFFLGPSLN----DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKC 429
           IKE EIID  L P +N     EVL I    + T +G+R RF+   A+G+ +G++GLG+  
Sbjct: 44  IKEPEIIDVLL-PEVNARENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGH 102

Query: 430 SKEVATAIRGAIILAKLSVL 489
            KEV  AIR AI  AKL+++
Sbjct: 103 GKEVGIAIRKAINYAKLNII 122



 Score = 34.7 bits (76), Expect = 3.5
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +2

Query: 176 EWVPVTKLGRLVREGKIDKLESIYLFFYQSK 268
           EW P TKLG +V+EG+I  +  I+   YQ K
Sbjct: 15  EWEPKTKLGMMVKEGQITDIHEIFRRGYQIK 45


>UniRef50_UPI0000DC004A Cluster: UPI0000DC004A related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC004A UniRef100 entry -
           Rattus norvegicus
          Length = 173

 Score = 62.5 bits (145), Expect = 2e-08
 Identities = 44/96 (45%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +1

Query: 259 PIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 438
           P    +II+FFLG  L DEVL+ M  Q      QRTR K F  +   +    L V CSKE
Sbjct: 46  PFSSSDIIEFFLGEHLKDEVLRTMLAQ-----NQRTRIKVFFFLTIRSPMTTL-VNCSKE 99

Query: 439 VATAIRGAIILAKLSVLTSPKK-LRGNKIGKPHNRP 543
           V TA + AI L  LS L S +   +GNKIG PH  P
Sbjct: 100 VGTAAQRAITL--LSFLFSTQTGYKGNKIGNPHTIP 133


>UniRef50_Q7XYL2 Cluster: Ribosomal protein rpS5; n=1; Bigelowiella
           natans|Rep: Ribosomal protein rpS5 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 219

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 27/68 (39%), Positives = 41/68 (60%)
 Frame = +1

Query: 295 GPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILA 474
           GP   ++VL++  + K  + G+   F+A VA+GD NG IGLG   +KEV  A+  A + A
Sbjct: 68  GPRFEEKVLQVRRITKVVKGGKNMGFRALVAVGDKNGKIGLGCASAKEVMVAVEKASMEA 127

Query: 475 KLSVLTSP 498
           K + +T P
Sbjct: 128 KKTAITVP 135


>UniRef50_A7DRN6 Cluster: Ribosomal protein S5; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein S5
           - Candidatus Nitrosopumilus maritimus SCM1
          Length = 238

 Score = 58.4 bits (135), Expect = 3e-07
 Identities = 35/77 (45%), Positives = 46/77 (59%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           L I+E  II   L P L  EV+ +  +QK T  GQ TRFKA VA G+ NG++G+G   SK
Sbjct: 72  LRIQEAGIIKKLL-PDLKSEVVDVGIIQKMTSNGQSTRFKAIVATGNENGYLGIGQGKSK 130

Query: 436 EVATAIRGAIILAKLSV 486
           ++  AI  A   A L+V
Sbjct: 131 QMRIAIEKATNAAYLNV 147


>UniRef50_Q3LVZ1 Cluster: Ribosomal protein S2; n=1; Bigelowiella
           natans|Rep: Ribosomal protein S2 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 266

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 33/110 (30%), Positives = 61/110 (55%), Gaps = 5/110 (4%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEF-----EIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFV 384
           KN Q    +L +L +K       ++++   G SL  +V++ + V + T++G++ + K  V
Sbjct: 75  KNFQINLKILDYLFLKRIFFHNNKLVNILFGKSLKYKVIQNLMVSRLTKSGRQYKKKVAV 134

Query: 385 AIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPH 534
            +GD +GH+GLGVK S +    I+ A+  AKL++    +     + GKP+
Sbjct: 135 LVGDLDGHVGLGVKSSMDSKAGIKAALRKAKLAITKIRRGYWEIEEGKPN 184


>UniRef50_O15579 Cluster: Ribosomal protein S2; n=1; Entamoeba
           histolytica|Rep: Ribosomal protein S2 - Entamoeba
           histolytica
          Length = 136

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 28/54 (51%), Positives = 36/54 (66%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGL 417
           + IKE++I+D  L   L +EV+ I  VQKQT  G+  R KA VAIGD+NGH  L
Sbjct: 60  IKIKEYQIVDHLLS-RLKEEVMTIDQVQKQTSRGKEPRLKASVAIGDHNGHRAL 112



 Score = 34.3 bits (75), Expect = 4.7
 Identities = 13/23 (56%), Positives = 19/23 (82%)
 Frame = +2

Query: 185 PVTKLGRLVREGKIDKLESIYLF 253
           PVTKLGRLV++GK+  ++ I+ F
Sbjct: 36  PVTKLGRLVKDGKVKSIDQIFEF 58


>UniRef50_A0RUE7 Cluster: 30S ribosomal protein S5P; n=1;
           Cenarchaeum symbiosum|Rep: 30S ribosomal protein S5P -
           Cenarchaeum symbiosum
          Length = 219

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 33/75 (44%), Positives = 45/75 (60%)
 Frame = +1

Query: 262 IKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEV 441
           I+E  II   L P L  EV+ +  +QK T  GQ TRFKA VA G+ NG++G+G   +K++
Sbjct: 55  IQESGIIKKLL-PDLKTEVVDVGIIQKMTSNGQSTRFKAIVAAGNENGYLGIGQGKAKQM 113

Query: 442 ATAIRGAIILAKLSV 486
             AI  A   A L+V
Sbjct: 114 RIAIEKANNQALLNV 128


>UniRef50_UPI0000DC0CDD Cluster: RBM27_MOUSE Isoform 2 of Q5SFM8 -
           Mus musculus (Mouse); n=3; Murinae|Rep: RBM27_MOUSE
           Isoform 2 of Q5SFM8 - Mus musculus (Mouse) - Rattus
           norvegicus
          Length = 266

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 34/63 (53%), Positives = 39/63 (61%)
 Frame = +1

Query: 265 KEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 444
           K+  II FFL  SL DE   IMPVQ QT    R  FK FV+I D + H+ L  KCSK+ A
Sbjct: 88  KKSMIIGFFLRTSLRDE---IMPVQTQTWLPSRP-FKDFVSIRDYSSHVDLDDKCSKKTA 143

Query: 445 TAI 453
           TAI
Sbjct: 144 TAI 146


>UniRef50_P59123 Cluster: 30S ribosomal protein S5; n=22;
           Bacteria|Rep: 30S ribosomal protein S5 - Oceanobacillus
           iheyensis
          Length = 167

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 25/65 (38%), Positives = 40/65 (61%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLS 483
           L + V+ +  V K  + G+R RF A V +GD NGH+G G   ++EV  AI+ A+  AK +
Sbjct: 12  LEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIKKAVDDAKKN 71

Query: 484 VLTSP 498
           +++ P
Sbjct: 72  LISVP 76


>UniRef50_UPI000057EB46 Cluster: UPI000057EB46 related cluster; n=1;
           Bos taurus|Rep: UPI000057EB46 UniRef100 entry - Bos
           Taurus
          Length = 258

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 41/99 (41%), Positives = 53/99 (53%), Gaps = 3/99 (3%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIM---PVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVK 426
           + IK  E I FF   S N   L      P+ KQT   Q+TRFKA V +G + GH+ LG+K
Sbjct: 67  MKIKSLEEIYFFSLLSRNLRSLTFSWEHPLIKQTCTDQQTRFKASVTVG-SYGHVSLGIK 125

Query: 427 CSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
            S EV      AIILAKLS++       G ++ +PH  P
Sbjct: 126 YSMEV------AIILAKLSIIPVETATGGKRL-EPHMVP 157



 Score = 48.0 bits (109), Expect = 4e-04
 Identities = 23/45 (51%), Positives = 29/45 (64%)
 Frame = +2

Query: 170 QKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSLISSSARP 304
           + +W+P+TKLG LV+E KI  LE IY F   S+N RSL  S   P
Sbjct: 51  EDKWLPITKLGCLVKEMKIKSLEEIYFFSLLSRNLRSLTFSWEHP 95


>UniRef50_Q7Y258 Cluster: Ribosomal protein S5 precursor; n=1;
           Chlamydomonas reinhardtii|Rep: Ribosomal protein S5
           precursor - Chlamydomonas reinhardtii
          Length = 673

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +1

Query: 283 DFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGA 462
           DF  G +  + ++++  V K  + G+   F+    IG+ NG +G+G +  +EVATA++ A
Sbjct: 506 DFDDGENWQERIIELSRVTKVVKGGKLMGFRCTAIIGNGNGLVGVGCQAGREVATAVKRA 565

Query: 463 IILAKLSVLTSP 498
           ++ AK SV+  P
Sbjct: 566 LVDAKKSVVRVP 577


>UniRef50_Q6YR05 Cluster: 30S ribosomal protein S5; n=22;
           Bacteria|Rep: 30S ribosomal protein S5 - Onion yellows
           phytoplasma
          Length = 171

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 25/67 (37%), Positives = 37/67 (55%)
 Frame = +1

Query: 298 PSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAK 477
           P L ++V+KI  + K  + G R RF A V +GD  G IG     +KE+  AI+ A+  AK
Sbjct: 13  PLLEEKVVKINRITKVVKGGARFRFSALVVVGDKKGQIGFATAKAKEIVEAIKKALEKAK 72

Query: 478 LSVLTSP 498
             ++  P
Sbjct: 73  KQLVRIP 79


>UniRef50_Q6F1X7 Cluster: 30S ribosomal protein S5; n=32;
           Bacteria|Rep: 30S ribosomal protein S5 - Mesoplasma
           florum (Acholeplasma florum)
          Length = 206

 Score = 51.2 bits (117), Expect = 4e-05
 Identities = 30/82 (36%), Positives = 44/82 (53%)
 Frame = +1

Query: 289 FLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAII 468
           F      ++V+ I  V K T+ G+  RF A V +GD  G +GLG   + EV  AI+ A+ 
Sbjct: 38  FQKDDFEEKVVTIRRVTKVTKGGRHFRFAAVVVVGDKKGQVGLGTGKANEVPEAIKKAVK 97

Query: 469 LAKLSVLTSPKKLRGNKIGKPH 534
            AK +++  P  LRG  +  PH
Sbjct: 98  EAKKNLIRVP--LRGTTV--PH 115


>UniRef50_Q9PQP3 Cluster: 30S ribosomal protein S5; n=2;
           Firmicutes|Rep: 30S ribosomal protein S5 - Ureaplasma
           parvum (Ureaplasma urealyticum biotype 1)
          Length = 203

 Score = 50.4 bits (115), Expect = 7e-05
 Identities = 26/72 (36%), Positives = 41/72 (56%)
 Frame = +1

Query: 301 SLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKL 480
           +  + V+KI  + K T+ G+  RF A V IGD NG +G G+  S EV  AI+ AI  A  
Sbjct: 48  NFEERVVKIKRISKTTKGGRMMRFSALVVIGDKNGTVGFGMGKSIEVPDAIKKAIKNANN 107

Query: 481 SVLTSPKKLRGN 516
           +++   +  +G+
Sbjct: 108 NLIKVKQTKKGS 119


>UniRef50_Q9RSL1 Cluster: 30S ribosomal protein S5; n=2;
           Deinococcus|Rep: 30S ribosomal protein S5 - Deinococcus
           radiodurans
          Length = 196

 Score = 50.0 bits (114), Expect = 9e-05
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           +++L +    K  + G+R RF A V +GD NG +G+G+  +KEV  AI  A  +A+ +++
Sbjct: 19  EKMLFVNRTSKTYQGGRRFRFAALVILGDRNGRVGMGIGKAKEVPVAIEKAKAVARKNMI 78

Query: 490 TSP 498
           T P
Sbjct: 79  TVP 81


>UniRef50_UPI0000D9EF8A Cluster: PREDICTED: similar to 40S ribosomal
           protein S2; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to 40S ribosomal protein S2 - Macaca mulatta
          Length = 181

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/31 (67%), Positives = 25/31 (80%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLF 253
           K + KEW+PVTKLGRLV++ KI  LE IYLF
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLF 84


>UniRef50_Q9X1J2 Cluster: 30S ribosomal protein S5; n=6;
           Bacteria|Rep: 30S ribosomal protein S5 - Thermotoga
           maritima
          Length = 178

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/63 (33%), Positives = 38/63 (60%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           +++++I    K T+ G+   F+    +G+ NG +GLG+  ++EV  AIR AI  AK +++
Sbjct: 17  EKIIEIRRTSKVTKGGKNLSFRVVAIVGNKNGKVGLGIGKAREVPEAIRKAISAAKRNIV 76

Query: 490 TSP 498
             P
Sbjct: 77  EVP 79


>UniRef50_A7QPU4 Cluster: Chromosome chr10 scaffold_138, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome chr10 scaffold_138, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 340

 Score = 48.4 bits (110), Expect = 3e-04
 Identities = 20/63 (31%), Positives = 39/63 (61%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V+++  V K  + G++  F+A V +GD  G +G+GV  +KEV  A++ +   A+ +++
Sbjct: 186 ERVVQVRRVTKVVKGGKQLHFRAVVVVGDKQGQVGVGVGKAKEVIAAVQKSATNARRNII 245

Query: 490 TSP 498
           T P
Sbjct: 246 TVP 248


>UniRef50_Q8RIH3 Cluster: 30S ribosomal protein S5; n=3;
           Fusobacterium nucleatum|Rep: 30S ribosomal protein S5 -
           Fusobacterium nucleatum subsp. nucleatum
          Length = 164

 Score = 48.4 bits (110), Expect = 3e-04
 Identities = 29/75 (38%), Positives = 41/75 (54%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           +++LKI  V K T+ G+   F    A+GD  G IGLG+  +  V  AIR AI  AK +++
Sbjct: 11  EKLLKISRVSKTTKGGRTISFSVLAAVGDGEGKIGLGLGKANGVPDAIRKAIAAAKKNIV 70

Query: 490 TSPKKLRGNKIGKPH 534
                L+ N I  PH
Sbjct: 71  KI--SLKNNTI--PH 81


>UniRef50_Q8EUD0 Cluster: 30S ribosomal protein S5; n=3;
           Mycoplasma|Rep: 30S ribosomal protein S5 - Mycoplasma
           penetrans
          Length = 234

 Score = 48.0 bits (109), Expect = 4e-04
 Identities = 22/58 (37%), Positives = 34/58 (58%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAK 477
           L ++++ +  + K T+ G+  RF A   IGD  G++G G+  S EV  AIR A+  AK
Sbjct: 78  LEEKIVGVKKISKTTKGGRNMRFSALAVIGDRKGNVGFGLGKSIEVPVAIRKALKSAK 135


>UniRef50_Q74MD4 Cluster: 30S ribosomal protein S5P; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S5P -
           Nanoarchaeum equitans
          Length = 231

 Score = 47.6 bits (108), Expect = 5e-04
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = +1

Query: 337 QKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGN 516
           QK+T  G +TR++    +GD +GH+G+G+  S ++  A   AI  AKL+++   +     
Sbjct: 72  QKKTAEGNKTRYEVIAIVGDKDGHVGVGLGRSSDLLIAREKAINRAKLNIIKVARGCGSW 131

Query: 517 K--IGKPHNRPLQ 549
           +   G PH+ P Q
Sbjct: 132 ECACGAPHSIPYQ 144



 Score = 37.1 bits (82), Expect = 0.66
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +2

Query: 173 KEWVPVTKLGRLVREGKIDKLESI 244
           +EW P TKLGRLV+EGKI  ++ I
Sbjct: 5   EEWQPKTKLGRLVKEGKITNIDEI 28


>UniRef50_P93014 Cluster: 30S ribosomal protein S5, chloroplast
           precursor; n=12; cellular organisms|Rep: 30S ribosomal
           protein S5, chloroplast precursor - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 303

 Score = 47.6 bits (108), Expect = 5e-04
 Identities = 19/63 (30%), Positives = 40/63 (63%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V+++  V K  + G++ +F+A V +GD  G++G+G   +KEV  A++ + I A+ +++
Sbjct: 149 ERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKEVVAAVQKSAIDARRNIV 208

Query: 490 TSP 498
             P
Sbjct: 209 QVP 211


>UniRef50_P59122 Cluster: 30S ribosomal protein S5; n=40;
           Bacteria|Rep: 30S ribosomal protein S5 - Bifidobacterium
           longum
          Length = 233

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 27/73 (36%), Positives = 39/73 (53%)
 Frame = +1

Query: 295 GPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILA 474
           G  L D V+ I  V K  + G+   F A V +GD NG +G+G   S+EV  AI    + A
Sbjct: 42  GDELLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDA 101

Query: 475 KLSVLTSPKKLRG 513
           K  + + P ++RG
Sbjct: 102 KKHMFSVP-RVRG 113


>UniRef50_A0T0Y9 Cluster: Chloroplast 30S ribosomal protein S5; n=3;
           cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S5 - Thalassiosira pseudonana (Marine diatom)
          Length = 179

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGA 462
           + ++KI  V K T+ G++  F+A V IGD NG +G+GV  +++V  A + A
Sbjct: 28  ERLIKISRVTKVTKGGKKLSFRAVVVIGDENGKVGVGVGKAEDVVNAFKKA 78


>UniRef50_Q92QF3 Cluster: 30S ribosomal protein S5; n=203; cellular
           organisms|Rep: 30S ribosomal protein S5 - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 189

 Score = 45.2 bits (102), Expect = 0.003
 Identities = 26/70 (37%), Positives = 38/70 (54%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           D+++ I  V K  + G+R  F A V +GD  G +G G   ++EV  AIR A   AK  ++
Sbjct: 24  DKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRDLI 83

Query: 490 TSPKKLRGNK 519
             P  LRG +
Sbjct: 84  FVP--LRGGR 91


>UniRef50_Q7NEG9 Cluster: 30S ribosomal protein S5; n=34; cellular
           organisms|Rep: 30S ribosomal protein S5 - Gloeobacter
           violaceus
          Length = 223

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V++I  V K  + G++  F+A + +GD NG +G+GV  + +V  A++  +  A+ +++
Sbjct: 68  ERVVQIRRVTKVVKGGKKLSFRAVIVVGDGNGRVGVGVGKANDVIGAVKKGVSDARKALI 127

Query: 490 TSPKKLRGNKIGK-PHNRPLQSXRAXV 567
             P     NKI   PH     S  A V
Sbjct: 128 RVPL----NKINSIPHPMSGSSGAANV 150


>UniRef50_Q5NQ48 Cluster: 30S ribosomal protein S5; n=155; cellular
           organisms|Rep: 30S ribosomal protein S5 - Zymomonas
           mobilis
          Length = 233

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +1

Query: 295 GPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILA 474
           G  L ++++ I  V K  + G+R  F A V +GD  G +G G   ++EV  AI  A   A
Sbjct: 56  GEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRVGFGHGKAREVPEAISKATAAA 115

Query: 475 KLSVLTSP 498
           K +++  P
Sbjct: 116 KKTMIRVP 123


>UniRef50_P66575 Cluster: 30S ribosomal protein S5; n=128;
           Bacteria|Rep: 30S ribosomal protein S5 - Mycobacterium
           bovis
          Length = 220

 Score = 44.0 bits (99), Expect = 0.006
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V+ I  V K  + G+R  F A V +GD NG +G+G   +KEV  AI   +  A+ S  
Sbjct: 44  ERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEARKSFF 103

Query: 490 TSPKKLRGNKIGKP 531
             P  L G  I  P
Sbjct: 104 RVP--LIGGTITHP 115


>UniRef50_O67563 Cluster: 30S ribosomal protein S5; n=5;
           Bacteria|Rep: 30S ribosomal protein S5 - Aquifex
           aeolicus
          Length = 208

 Score = 44.0 bits (99), Expect = 0.006
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLS 483
           L + ++      + T+ G+R  F   V +GD  GH+G G   +KEV  AI   I  AK +
Sbjct: 28  LEERLIYANRTARVTKGGRRFSFSTLVVVGDRKGHVGFGHGKAKEVTLAIAKGIEKAKKN 87

Query: 484 VLTSP 498
           V+  P
Sbjct: 88  VIRVP 92


>UniRef50_Q9XD19 Cluster: 30S ribosomal protein S5; n=17;
           Bacteria|Rep: 30S ribosomal protein S5 - Leptospira
           interrogans
          Length = 187

 Score = 43.2 bits (97), Expect = 0.010
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAK 477
           +++V+KI  V K  + G+R  F A   +GD  G +G+G   + EV  AIR +I  AK
Sbjct: 31  SEKVVKIDRVAKVVKGGRRFSFNALSVVGDQRGKVGIGFGKANEVPDAIRKSIESAK 87


>UniRef50_P73304 Cluster: 30S ribosomal protein S5; n=30; cellular
           organisms|Rep: 30S ribosomal protein S5 - Synechocystis
           sp. (strain PCC 6803)
          Length = 173

 Score = 41.5 bits (93), Expect = 0.031
 Identities = 18/63 (28%), Positives = 35/63 (55%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V++I  V K  + G++  F+A V +G+  G +G+GV  + +V  A+R  +   K  ++
Sbjct: 19  ERVIQIRRVSKVVKGGKKLSFRAIVVVGNETGQVGVGVGKAGDVIGAVRKGVADGKKQLI 78

Query: 490 TSP 498
             P
Sbjct: 79  EVP 81


>UniRef50_Q6AP53 Cluster: 30S ribosomal protein S5; n=8;
           Bacteria|Rep: 30S ribosomal protein S5 - Desulfotalea
           psychrophila
          Length = 171

 Score = 41.1 bits (92), Expect = 0.041
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAK 477
           L ++++ I  V K  + G+R  F A V +GD NG +G G+  + +V  AIR  +  A+
Sbjct: 16  LIEKIVFINRVAKVVKGGRRFSFSAIVVVGDGNGKVGYGLGKANQVPEAIRKGVERAR 73


>UniRef50_Q5L704 Cluster: 30S ribosomal protein S5; n=7;
           Chlamydiaceae|Rep: 30S ribosomal protein S5 -
           Chlamydophila abortus
          Length = 165

 Score = 40.3 bits (90), Expect = 0.071
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLS 483
           L ++VL +    K  + G++  F A + +GD  G +G G   + E+  AIR     A+ +
Sbjct: 13  LEEKVLVVNRCSKVVKGGRKFSFSALILVGDGKGRLGYGFAKANELTDAIRKGGEAARKN 72

Query: 484 VLTSPKKLRGNKIGKPH 534
           ++T  + L G+ I  PH
Sbjct: 73  LITI-ESLEGDSI--PH 86


>UniRef50_UPI000056598D Cluster: UPI000056598D related cluster; n=1;
           Mus musculus|Rep: UPI000056598D UniRef100 entry - Mus
           musculus
          Length = 239

 Score = 38.7 bits (86), Expect = 0.22
 Identities = 39/114 (34%), Positives = 50/114 (43%), Gaps = 4/114 (3%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L   P K    I  F G SL D+++    +  +  + QRT+          
Sbjct: 48  KIKSQEEVCLFCCPSKSLFTITDFPGESLKDDLMMASGLGSRLLSSQRTK---------- 97

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKL--RGNKIGK--PHNRPLQ 549
            GH GL   CS EVATAI+   +L   S L SP  L   GN  GK  P   P+Q
Sbjct: 98  -GHSGLSSMCSGEVATAIQ---VLGITSYLGSPWPLCREGNMTGKSLPSVCPMQ 147


>UniRef50_A6PPX8 Cluster: Ribosomal protein S5; n=4; Bacteria|Rep:
           Ribosomal protein S5 - Victivallis vadensis ATCC BAA-548
          Length = 181

 Score = 38.7 bits (86), Expect = 0.22
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSV 486
           ++ V+ I    K  + G+   F A V +GD  G +G G   + EV+ AIR     A+ ++
Sbjct: 16  DESVISINRSAKVVKGGKNFSFGALVVVGDRKGRVGYGYGKANEVSDAIRKGGEAARRNL 75

Query: 487 LTSP 498
           +T P
Sbjct: 76  VTVP 79


>UniRef50_O15578 Cluster: Ribosomal protein S2; n=1; Entamoeba
           histolytica|Rep: Ribosomal protein S2 - Entamoeba
           histolytica
          Length = 88

 Score = 38.7 bits (86), Expect = 0.22
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +2

Query: 179 WVPVTKLGRLVREGKIDKLESIYLF 253
           W PVTKLGRLV++GK+  ++ I+ F
Sbjct: 35  WTPVTKLGRLVKDGKVKSIDQIFEF 59


>UniRef50_A7CZB7 Cluster: Ribosomal protein S5; n=1; Opitutaceae
           bacterium TAV2|Rep: Ribosomal protein S5 - Opitutaceae
           bacterium TAV2
          Length = 231

 Score = 37.5 bits (83), Expect = 0.50
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIR 456
           L ++V+ I    K  + G+R  F A   +GD NG +G+G   + EV  AI+
Sbjct: 71  LVEKVVFINRCAKVVKGGRRFSFSALAVVGDKNGKVGIGYGKANEVPDAIK 121


>UniRef50_Q6KI38 Cluster: 30S ribosomal protein S5; n=9;
           Firmicutes|Rep: 30S ribosomal protein S5 - Mycoplasma
           mobile
          Length = 243

 Score = 37.5 bits (83), Expect = 0.50
 Identities = 19/63 (30%), Positives = 34/63 (53%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           ++++ I  V    + G+R  F A V +GD  G +G G   + EV  AI+ A+  A+ +++
Sbjct: 91  EKIVNIARVTNVVKGGRRFSFAAVVVVGDKKGRVGYGHGKALEVPDAIKKAVKDAQNNLI 150

Query: 490 TSP 498
             P
Sbjct: 151 RVP 153


>UniRef50_Q4EF76 Cluster: Putative uncharacterized protein; n=1;
           Listeria monocytogenes str. 4b H7858|Rep: Putative
           uncharacterized protein - Listeria monocytogenes str. 4b
           H7858
          Length = 77

 Score = 37.1 bits (82), Expect = 0.66
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = -2

Query: 465 NSASNGSGDFLAALHTQTNMTVVVANGNKCLET 367
           NS ++   +FL    T+TNMT+ V+N NKC ET
Sbjct: 25  NSFTDSIWNFLRFTSTETNMTIFVSNNNKCCET 57


>UniRef50_Q82X75 Cluster: 30S ribosomal protein S5; n=11;
           Bacteria|Rep: 30S ribosomal protein S5 - Nitrosomonas
           europaea
          Length = 177

 Score = 36.3 bits (80), Expect = 1.2
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +1

Query: 304 LNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAI 465
           L ++++ +  V K  + G+   F A   +GD  G +G+G   S+EV  A++ A+
Sbjct: 21  LKEKMVSVNRVTKVVKGGRILGFAALTVVGDGKGSVGMGKGKSREVPLAVQKAM 74


>UniRef50_Q25815 Cluster: Rps5 protein; n=1; Plasmodium
           falciparum|Rep: Rps5 protein - Plasmodium falciparum
          Length = 239

 Score = 35.1 bits (77), Expect = 2.7
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +1

Query: 292 LGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIIL 471
           L  ++ +++++I  +    + G+  R+K  + +G+  G IGLGV  SK +   I  AII 
Sbjct: 94  LNNNIIEKIIEIKKISYTIKKGRIRRYKIVLVLGNKQGWIGLGV--SKNI--NINKAIIS 149

Query: 472 AKLSVLTS 495
           AK+  L +
Sbjct: 150 AKIKALNN 157


>UniRef50_Q5FFR5 Cluster: 30S ribosomal protein S5; n=5; canis
           group|Rep: 30S ribosomal protein S5 - Ehrlichia
           ruminantium (strain Gardel)
          Length = 174

 Score = 35.1 bits (77), Expect = 2.7
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +1

Query: 316 VLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           ++ +  V K  + G+R  F   V IGD  G +G G+    EV+ A   A+  A+ +++
Sbjct: 20  IVSVRRVAKVVKGGRRFSFSVLVVIGDEKGKVGCGIGKHLEVSEAKVKAVNAARKNMI 77


>UniRef50_P33759 Cluster: 37S ribosomal protein S5, mitochondrial
           precursor; n=6; Saccharomycetales|Rep: 37S ribosomal
           protein S5, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 307

 Score = 34.7 bits (76), Expect = 3.5
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 289 FLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAI 453
           ++   L  + L +  V  QT  G+   F A V +GD NG +GLG  K  +E++ AI
Sbjct: 139 YITRKLTMKPLVMKRVSNQTGKGKIASFYALVVVGDKNGMVGLGEGKSREEMSKAI 194


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 827,758,357
Number of Sequences: 1657284
Number of extensions: 15866881
Number of successful extensions: 38183
Number of sequences better than 10.0: 70
Number of HSP's better than 10.0 without gapping: 35655
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37924
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 88998789286
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -