SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...   100   4e-20
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...   100   4e-20
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...   100   4e-20
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...   100   4e-20
UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1; ...    91   5e-17
UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ...    73   1e-11
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    70   9e-11
UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:...    66   8e-10
UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba...    54   5e-06
UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ...    53   1e-05
UniRef50_P62593 Cluster: Beta-lactamase TEM precursor; n=261; ro...    48   2e-04
UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba...    44   0.004
UniRef50_Q1UYY9 Cluster: Putative uncharacterized protein; n=1; ...    41   0.036
UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp...    41   0.048
UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria...    40   0.11 
UniRef50_Q9R4I2 Cluster: Beta-lactamase; n=5; Gammaproteobacteri...    36   1.0  
UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la...    36   1.4  
UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre...    36   1.8  
UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler...    34   4.2  
UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre...    34   5.5  
UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted ...    33   7.3  
UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j...    33   9.6  

>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score =  100 bits (240), Expect = 4e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 69  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score =  100 bits (240), Expect = 4e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 23  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score =  100 bits (240), Expect = 4e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 27  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 71


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score =  100 bits (240), Expect = 4e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 9   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53


>UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 99

 Score = 90.6 bits (215), Expect = 5e-17
 Identities = 44/78 (56%), Positives = 46/78 (58%)
 Frame = +3

Query: 606 VRWHFSGKCARNPYLFIFLNTFKYVXRS*DNNPDKCFNNIEKGRV*VFNISVAPYSLFAA 785
           VRWHFSGKCARNPYLFIFLNTFKYV              ++K           PYSLF  
Sbjct: 22  VRWHFSGKCARNPYLFIFLNTFKYVSAHETITLINASIILKKEEYEYSTFPCRPYSLFCG 81

Query: 786 FXLSCFCSPRKRGESKRC 839
              SCFCSPR  GESKRC
Sbjct: 82  ILPSCFCSPRNAGESKRC 99


>UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp.
           SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS
          Length = 73

 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 33/33 (100%), Positives = 33/33 (100%)
 Frame = -2

Query: 495 LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL 397
           LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL
Sbjct: 40  LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL 72



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 2   DAPCSGALSAAGVVVTRSVTAT 23


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 2/53 (3%)
 Frame = +2

Query: 2   PSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNS--CAXEWRMA 154
           PSFYNVVTGKTLALPNLIALQHIPLSPAGVI++  A    P+    + +WRMA
Sbjct: 7   PSFYNVVTGKTLALPNLIALQHIPLSPAGVISEE-ARTDRPSQQLRSLKWRMA 58


>UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:
           Beta-galactosidase - Yersinia pseudotuberculosis
          Length = 1066

 Score = 66.5 bits (155), Expect = 8e-10
 Identities = 27/41 (65%), Positives = 32/41 (78%)
 Frame = +1

Query: 7   VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 129
           +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q
Sbjct: 18  ILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQ 58


>UniRef50_P06219 Cluster: Beta-galactosidase; n=11;
           Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella
           pneumoniae
          Length = 1034

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 24/43 (55%), Positives = 28/43 (65%)
 Frame = +1

Query: 7   VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           VL R DW N  +T LNRL AHP FASWR+   AR + PS + R
Sbjct: 17  VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRR 59


>UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1;
           Enterobacter sakazakii ATCC BAA-894|Rep: Putative
           uncharacterized protein - Enterobacter sakazakii ATCC
           BAA-894
          Length = 1043

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 123
           A +L R DW+NP +T +NRL +H P   WR+++ AR   PS
Sbjct: 19  ATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPS 59


>UniRef50_P62593 Cluster: Beta-lactamase TEM precursor; n=261;
           root|Rep: Beta-lactamase TEM precursor - Escherichia
           coli
          Length = 286

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = +1

Query: 766 LIPFLRHFXFPVFAHPENVVKVKDAEDSFG 855
           LIPF   F  PVFAHPE +VKVKDAED  G
Sbjct: 10  LIPFFAAFCLPVFAHPETLVKVKDAEDQLG 39


>UniRef50_P81650 Cluster: Beta-galactosidase; n=26;
           Gammaproteobacteria|Rep: Beta-galactosidase -
           Pseudoalteromonas haloplanktis (Alteromonas
           haloplanktis)
          Length = 1039

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +1

Query: 7   VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 129
           ++ RRDWENP   Q+N++ AH P   ++  E+AR +  SQ+
Sbjct: 7   IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK 47


>UniRef50_Q1UYY9 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Pelagibacter ubique HTCC1002|Rep: Putative
           uncharacterized protein - Candidatus Pelagibacter ubique
           HTCC1002
          Length = 26

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = -1

Query: 847 NLQHLLLSPRFLGEQKQEXQNAAKRE 770
           +LQHLLLSP FLGEQKQE +   KRE
Sbjct: 1   DLQHLLLSPAFLGEQKQEGKMPQKRE 26


>UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia
           spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia
           spumigena CCY 9414
          Length = 72

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 85  WRNSEEARTDRPSQQLR 135
           WRNSEEARTDRPSQQLR
Sbjct: 47  WRNSEEARTDRPSQQLR 63


>UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8;
           Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp.
           PE36
          Length = 45

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/29 (75%), Positives = 23/29 (79%)
 Frame = -2

Query: 156 FAIRHSXAQLLGRAIGAGLFAITPAGERG 70
           FAI+   AQLLGRAIGAGLFAITP  E G
Sbjct: 12  FAIQ--AAQLLGRAIGAGLFAITPEFELG 38


>UniRef50_Q9R4I2 Cluster: Beta-lactamase; n=5;
           Gammaproteobacteria|Rep: Beta-lactamase - Shigella
           flexneri
          Length = 52

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +1

Query: 799 VFAHPENVVKVKDAEDSFG 855
           VFAHPE +VKVKDAED  G
Sbjct: 1   VFAHPETLVKVKDAEDQLG 19


>UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus
          lactis|Rep: Beta-galactosidase - Lactococcus lactis
          subsp. lactis (Streptococcus lactis)
          Length = 998

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +1

Query: 7  VLQRRDWENPGVTQLNRLAAHPP 75
          VL+R+DWENP V+  NRL  H P
Sbjct: 9  VLERKDWENPVVSNWNRLPMHTP 31


>UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel;
           n=1; Clostridium cellulolyticum H10|Rep: Glycoside
           hydrolase family 2, TIM barrel - Clostridium
           cellulolyticum H10
          Length = 1033

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 12/29 (41%), Positives = 20/29 (68%)
 Frame = +1

Query: 19  RDWENPGVTQLNRLAAHPPFASWRNSEEA 105
           R+WEN  +TQ+NR   H P+ ++ + E+A
Sbjct: 3   REWENQYITQINRYPMHSPYGAYESVEQA 31


>UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio
           cholerae|Rep: Beta-galactosidase - Vibrio cholerae
          Length = 56

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 7   VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 114
           +L  +DW+NP + + +    H P  S+R  +EAR D
Sbjct: 7   ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLD 42


>UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel
           precursor; n=1; Pseudoalteromonas atlantica T6c|Rep:
           Glycoside hydrolase family 2, TIM barrel precursor -
           Pseudoalteromonas atlantica (strain T6c / BAA-1087)
          Length = 1079

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +1

Query: 16  RRDWENPGVTQLNRLAAHPPFASWRNSEEART 111
           + DWENP V Q+NRL A     S+   E+A T
Sbjct: 31  KNDWENPDVIQINRLPARATSYSFDTPEQALT 62


>UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted
           coiled coil regions; n=2; Cryptosporidium|Rep:
           Uncharacterized protein with predicted coiled coil
           regions - Cryptosporidium parvum Iowa II
          Length = 825

 Score = 33.5 bits (73), Expect = 7.3
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +1

Query: 244 SLINKRI--DRDRVECCSSLEQESTIKERGLQRQRAKNRL 357
           SL N+ I  +RD V  C S+ Q+S IKER L+ ++ K +L
Sbjct: 119 SLSNQNIKSERDNVSKCLSIRQQSLIKERELRLEKTKLKL 158


>UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09076 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 109

 Score = 33.1 bits (72), Expect = 9.6
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 126
           A  L+RR+ +NPG  QLN L A P F     +++A  +R S+
Sbjct: 57  AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSK 98


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 859,694,380
Number of Sequences: 1657284
Number of extensions: 17257151
Number of successful extensions: 39772
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 38451
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39763
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79112361923
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -