SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D55AA9 Cluster: PREDICTED: similar to CG2101-PA;...   148   2e-34
UniRef50_UPI00015B62D8 Cluster: PREDICTED: similar to ENSANGP000...   144   3e-33
UniRef50_Q9VZX6 Cluster: CG2101-PA; n=4; Diptera|Rep: CG2101-PA ...   134   2e-30
UniRef50_UPI0000DB6BBE Cluster: PREDICTED: similar to mitochondr...   120   4e-26
UniRef50_P82673-2 Cluster: Isoform 2 of P82673 ; n=2; Homo sapie...   116   1e-24
UniRef50_P82673 Cluster: 28S ribosomal protein S35, mitochondria...   116   1e-24
UniRef50_Q5DHD4 Cluster: SJCHGC06510 protein; n=1; Schistosoma j...   105   1e-21
UniRef50_UPI0000E4794D Cluster: PREDICTED: similar to MRPS35 pro...   102   1e-20
UniRef50_Q9NEI6 Cluster: Putative uncharacterized protein; n=2; ...    97   4e-19
UniRef50_A7T1L7 Cluster: Predicted protein; n=3; Nematostella ve...    75   3e-12
UniRef50_UPI00006A1656 Cluster: 28S ribosomal protein S35, mitoc...    65   2e-09
UniRef50_Q4T8M3 Cluster: Chromosome 13 SCAF7769, whole genome sh...    61   3e-08
UniRef50_UPI000023E58E Cluster: hypothetical protein FG09958.1; ...    40   0.11 
UniRef50_Q54WN8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.76 
UniRef50_UPI0000F33AA0 Cluster: 28S ribosomal protein S35, mitoc...    36   1.0  
UniRef50_Q6ZDM0 Cluster: Putative D13F protein, MybSt1; n=2; Ory...    36   1.7  
UniRef50_P98174 Cluster: FYVE, RhoGEF and PH domain-containing p...    36   1.7  
UniRef50_Q7PYL4 Cluster: ENSANGP00000007859; n=2; Culicidae|Rep:...    35   2.3  
UniRef50_O74340 Cluster: U3 snoRNP-associated protein Sof1; n=2;...    35   2.3  
UniRef50_A5K3R8 Cluster: Putative uncharacterized protein; n=1; ...    34   5.3  
UniRef50_Q2BKD4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_A0EFM7 Cluster: Chromosome undetermined scaffold_93, wh...    33   7.1  
UniRef50_Q5AI30 Cluster: Likely mitochondrial ribosomal protein ...    33   7.1  
UniRef50_Q03976 Cluster: 37S ribosomal protein S24, mitochondria...    33   7.1  
UniRef50_Q9NRR4 Cluster: Ribonuclease 3; n=59; Eumetazoa|Rep: Ri...    33   7.1  
UniRef50_UPI0000DB730E Cluster: PREDICTED: similar to CG32809-PD...    33   9.3  
UniRef50_A6RT79 Cluster: Putative uncharacterized protein; n=2; ...    33   9.3  

>UniRef50_UPI0000D55AA9 Cluster: PREDICTED: similar to CG2101-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2101-PA - Tribolium castaneum
          Length = 320

 Score =  148 bits (359), Expect = 2e-34
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+WGNVWPGP++FHP++VPLPIRQGY P G AP GK ANAELMKIPNFLHLTPPVIK Q
Sbjct: 70  DQDWGNVWPGPRSFHPATVPLPIRQGYTPTGVAP-GKYANAELMKIPNFLHLTPPVIKRQ 128

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK+FCT WP  L+S+E  E+  P
Sbjct: 129 CEALKKFCTPWPKALDSDEKCERFFP 154



 Score = 86.2 bits (204), Expect = 9e-16
 Identities = 51/124 (41%), Positives = 72/124 (58%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K    +PLE+ SSDYCH+SP+IR+PLAR+V ++ +L  L L+  A DKF RLVG+RYD +
Sbjct: 148 KCERFFPLEVASSDYCHSSPTIRDPLARIVSVKFKLGVLGLEGRAKDKFLRLVGERYDEQ 207

Query: 673 TDLVTIHSGFVVQLKYKTLDYVHLFX*LACTMSRGNFEDLGEGEDPRTTWGIMAXDNNAS 852
           TD+VTI +     LK +  DY  ++   A      N E   E +       +   +NNAS
Sbjct: 208 TDIVTIVTD-RCPLKKQNYDYA-MYLITALYHESLNVEPWEELKS-EADMEVYIWENNAS 264

Query: 853 KRGL 864
           K  +
Sbjct: 265 KTSI 268



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query: 120 ADSALKKGEEEEEFRVLDILK-KRDKMQRRVVKRTDVQPDRIDRM 251
           A S   + + EEEFRVL++   K   +QRR V++ ++QP R  +M
Sbjct: 23  AYSTSSEPQREEEFRVLNLKHVKGQTVQRRSVRKAEIQPPRTTQM 67


>UniRef50_UPI00015B62D8 Cluster: PREDICTED: similar to
           ENSANGP00000012813; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012813 - Nasonia
           vitripennis
          Length = 229

 Score =  144 bits (348), Expect = 3e-33
 Identities = 62/92 (67%), Positives = 70/92 (76%)
 Frame = +2

Query: 239 DRQDGPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTP 418
           ++Q   +Q+W +VWPG +TFHP+SVPLPIRQGY  K Q PPGK  NAELMKIPNFLHLTP
Sbjct: 30  EKQMPTDQDWPSVWPGQRTFHPASVPLPIRQGYPLKRQGPPGKYGNAELMKIPNFLHLTP 89

Query: 419 PVIKSQCEALKQFCTEWPNLLNSEESIEKHIP 514
           P IK  CEALKQFCTEWP  L  +E   KH P
Sbjct: 90  PAIKRHCEALKQFCTEWPAGLEKDEDCAKHFP 121


>UniRef50_Q9VZX6 Cluster: CG2101-PA; n=4; Diptera|Rep: CG2101-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 326

 Score =  134 bits (325), Expect = 2e-30
 Identities = 54/86 (62%), Positives = 68/86 (79%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W  VWPGP++FHP+SVPLP+RQG+  +G A P K ANAELMKIPNFLHLTPP I+ Q
Sbjct: 75  DQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQ 134

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEA+K+FCT WP  L +E   ++H P
Sbjct: 135 CEAIKKFCTPWPKGLETEAKWQRHFP 160



 Score = 87.4 bits (207), Expect = 4e-16
 Identities = 51/157 (32%), Positives = 82/157 (52%)
 Frame = +1

Query: 292 NFPPVFGAITDTSGLRTKGSSTAR*KSECRINENTKFPSLNTTSYQEPV*SLKTILYGMA 471
           +F P    +    G   +G++     +   + +   F  L   + ++   ++K       
Sbjct: 87  SFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWP 146

Query: 472 ESTQL*GKYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLV 651
           +  +   K++  +PLE+ ++DYC + P+IRNP AR V + ++L+DLK D HA DKF RLV
Sbjct: 147 KGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARDKFLRLV 206

Query: 652 GDRYDPKTDLVTIHSGFVVQLKYKTLDYVHLFX*LAC 762
           GDRY+  TDLVT  +    Q K +  DY  L+   AC
Sbjct: 207 GDRYNKDTDLVTFVTDRCPQ-KKQNYDYA-LYLLTAC 241



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 144 EEEEEFRVLDILKKRDKMQRR-VVKRTDVQPDRIDRMA 254
           E++EEFRVL +   + +MQ+R  V+R  + P R  RMA
Sbjct: 36  EDDEEFRVLSLRTVKQQMQKRQQVRRDPITPPRTGRMA 73


>UniRef50_UPI0000DB6BBE Cluster: PREDICTED: similar to mitochondrial
           ribosomal protein S35 CG2101-PA; n=1; Apis
           mellifera|Rep: PREDICTED: similar to mitochondrial
           ribosomal protein S35 CG2101-PA - Apis mellifera
          Length = 323

 Score =  120 bits (290), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 61/86 (70%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           N+NW  +WP  +TFHP  VPLP++QGY       P K  NAELMKIPNFLHLTPP++K  
Sbjct: 63  NKNWEKIWPTARTFHPDIVPLPLQQGYKNTKGLHPNKYGNAELMKIPNFLHLTPPIVKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           C A+K+FCTEWP  L ++E+  K+ P
Sbjct: 123 CRAIKKFCTEWPKNLETDEACVKYFP 148



 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 42/77 (54%), Positives = 61/77 (79%)
 Frame = +1

Query: 508 YPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVT 687
           +P+EIISSDYC++SP+IR PLAR+V L+V+L+ L LD HA DK  RL+G+RY+P+TD++T
Sbjct: 147 FPIEIISSDYCYSSPTIREPLARIVSLKVKLSSLHLDAHAKDKILRLLGNRYNPQTDIIT 206

Query: 688 IHSGFVVQLKYKTLDYV 738
           I +     ++ + LDYV
Sbjct: 207 I-TADRCPVRKQNLDYV 222


>UniRef50_P82673-2 Cluster: Isoform 2 of P82673 ; n=2; Homo
           sapiens|Rep: Isoform 2 of P82673 - Homo sapiens (Human)
          Length = 287

 Score =  116 bits (278), Expect = 1e-24
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRV 594
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRV 175


>UniRef50_P82673 Cluster: 28S ribosomal protein S35, mitochondrial
           precursor; n=20; Euteleostomi|Rep: 28S ribosomal protein
           S35, mitochondrial precursor - Homo sapiens (Human)
          Length = 323

 Score =  116 bits (278), Expect = 1e-24
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 201

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 202 TDVLTI 207


>UniRef50_Q5DHD4 Cluster: SJCHGC06510 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06510 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 388

 Score =  105 bits (253), Expect = 1e-21
 Identities = 48/88 (54%), Positives = 59/88 (67%), Gaps = 4/88 (4%)
 Frame = +2

Query: 263 NWGNVWPGPKTFHPSSVPLPIRQGY----VPKGQAPPGKKANAELMKIPNFLHLTPPVIK 430
           +W N+WP   +FH S VP  +RQG+    V     PP K AN ELMKIPNF HLTP  IK
Sbjct: 69  DWTNIWPAAASFHHSVVPFQVRQGHCKNLVENEGVPPVKYANTELMKIPNFFHLTPLHIK 128

Query: 431 SQCEALKQFCTEWPNLLNSEESIEKHIP 514
             C+AL++FCT WP+ L+S E+IEKH P
Sbjct: 129 KHCDALRKFCTLWPSGLDSNETIEKHYP 156



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/47 (46%), Positives = 33/47 (70%)
 Frame = +1

Query: 508 YPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRL 648
           YP+ I++  Y   S +IR+P +RVV L+++LA+L LD+HA  K  RL
Sbjct: 155 YPVSIVNRSYVFTSSNIRDPRSRVVTLQIRLANLCLDEHAKRKLLRL 201


>UniRef50_UPI0000E4794D Cluster: PREDICTED: similar to MRPS35
           protein, partial; n=3; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to MRPS35 protein,
           partial - Strongylocentrotus purpuratus
          Length = 305

 Score =  102 bits (245), Expect = 1e-20
 Identities = 43/86 (50%), Positives = 56/86 (65%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q W  V+P   +F  S+VPLP+R GY  +   PP K  N EL+KIPNFLHLTPP IK  
Sbjct: 35  DQEWAGVYPTAASFKWSAVPLPLRMGYPVRRGIPPHKFGNLELIKIPNFLHLTPPAIKKH 94

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           C ALK+ C++WP  L ++   E+H P
Sbjct: 95  CAALKELCSDWPEGLETDADCERHFP 120



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 39/98 (39%), Positives = 58/98 (59%)
 Frame = +1

Query: 442 SLKTILYGMAESTQL*GKYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDK 621
           +LK +     E  +        +PLE + SDY     S+R+P +R V ++V+L++L LDK
Sbjct: 97  ALKELCSDWPEGLETDADCERHFPLETVESDYTFVGSSLRHPQSREVTVKVKLSELSLDK 156

Query: 622 HATDKFKRLVGDRYDPKTDLVTIHSGFVVQLKYKTLDY 735
           HA  K+ +LVGDRYD +TD++TI S     LK +  DY
Sbjct: 157 HARWKYIQLVGDRYDKETDIITI-SADRCPLKKQNYDY 193


>UniRef50_Q9NEI6 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 365

 Score = 97.5 bits (232), Expect = 4e-19
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 3/97 (3%)
 Frame = +2

Query: 233 R*DRQDGPNQNWGNVWPGPKTFHPSSVPLPIRQGYVP--KGQAPPGKKANAELMKIPNFL 406
           R +  D   Q W +VWP  +TF  S VPLP+R G  P  + +AP  K+ N EL+KIPNFL
Sbjct: 94  RSEEMDPEAQKWCDVWPAARTFASSVVPLPVRMGTRPNVEKRAPFKKEGNLELVKIPNFL 153

Query: 407 HLTPPVIKSQCEALKQFCTEW-PNLLNSEESIEKHIP 514
           HLTPP I+  C+A+K+FCT + P LL++  +  +H+P
Sbjct: 154 HLTPPAIQQHCQAIKKFCTPFPPELLSNPSATCQHLP 190



 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 45/77 (58%)
 Frame = +1

Query: 511 PLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTI 690
           P+ I  S Y H   SIR+  +RVV +++ +A+LKL ++  +K  RL  +RYD KT  +TI
Sbjct: 190 PISIEYSTYIHQGTSIRDIRSRVVTMKIHVAELKLSENQMEKLIRLAANRYDEKTGKMTI 249

Query: 691 HSGFVVQLKYKTLDYVH 741
            +      + + LDY H
Sbjct: 250 ITD-RCHTRQQNLDYAH 265


>UniRef50_A7T1L7 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 313

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 3/77 (3%)
 Frame = +2

Query: 263 NWGNVWPGPKTFHPSSVPLPIRQGYVPKGQA---PPGKKANAELMKIPNFLHLTPPVIKS 433
           +W +V+ GP+T++P+ +P+ +R G     +    P    AN ELMKIPNF HL+PP I+ 
Sbjct: 90  DWPSVFSGPQTYNPAIIPVFLRMGRRKHNRLDNFPQRTMANLELMKIPNFFHLSPPAIER 149

Query: 434 QCEALKQFCTEWPNLLN 484
            C+ALK  C  WP  L+
Sbjct: 150 HCQALKPLCKPWPKDLD 166



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 28/60 (46%), Positives = 39/60 (65%)
 Frame = +1

Query: 511 PLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTI 690
           PL +I+ +Y  A PS+ +P ++ V L+V L DL LD HA  K   LVG+RY+P  D +TI
Sbjct: 171 PLRVITRNYLFAGPSLHHPGSKKVKLQVFLKDLILDDHARTKLIELVGERYNPVDDSLTI 230


>UniRef50_UPI00006A1656 Cluster: 28S ribosomal protein S35,
           mitochondrial precursor (S35mt) (MRP-S35) (Mitochondrial
           ribosomal protein S28) (MRP-S28).; n=1; Xenopus
           tropicalis|Rep: 28S ribosomal protein S35, mitochondrial
           precursor (S35mt) (MRP-S35) (Mitochondrial ribosomal
           protein S28) (MRP-S28). - Xenopus tropicalis
          Length = 326

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/63 (46%), Positives = 41/63 (65%)
 Frame = +1

Query: 508 YPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVT 687
           +P+   + DY  A PS+RNP ARVV ++V+L+ L LD H+  K  +L G RYD  TD +T
Sbjct: 154 FPINFQTLDYVSAGPSLRNPKARVVSMQVKLSSLNLDDHSRKKLIKLAGPRYDSTTDTLT 213

Query: 688 IHS 696
           + S
Sbjct: 214 LRS 216



 Score = 37.5 bits (83), Expect = 0.43
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 2/89 (2%)
 Frame = +2

Query: 254 PNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAE--LMKIPNFLHLTPPVI 427
           P+Q+W +V+P    F PS+ P  +   +  K       + +    L     FL L     
Sbjct: 69  PDQDWCSVYPTAAPFKPSAYPGLVY--FCKKNVVRNFNQLDMTFYLSLYLKFLFLIDSRG 126

Query: 428 KSQCEALKQFCTEWPNLLNSEESIEKHIP 514
                 +  FCT+WP+ L+S+E  EK+ P
Sbjct: 127 NRVVAHMANFCTQWPSALSSDELCEKNFP 155


>UniRef50_Q4T8M3 Cluster: Chromosome 13 SCAF7769, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 13 SCAF7769, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 267

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 24/46 (52%), Positives = 33/46 (71%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKI 394
           +Q+W  V+P   +F P++VPLP+R GY  KG  PPGKK N EL+K+
Sbjct: 74  DQDWTAVYPSAASFRPNAVPLPVRMGYPVKGGVPPGKKGNLELIKV 119



 Score = 41.1 bits (92), Expect = 0.035
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +1

Query: 583 ILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHSGFVVQLKYKTLDY 735
           +++V+L+ L LD HA  K  +LVG+RY   TD++TI +     L+ + LD+
Sbjct: 116 LIKVKLSSLNLDDHARKKMIKLVGERYSKDTDVLTIKAD-RCPLRQQNLDH 165


>UniRef50_UPI000023E58E Cluster: hypothetical protein FG09958.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG09958.1 - Gibberella zeae PH-1
          Length = 387

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 17/45 (37%), Positives = 29/45 (64%)
 Frame = +1

Query: 562 NPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           +P  + V+++    DLKL    TDK K+L G RY+P+T+++ + S
Sbjct: 217 HPAEKKVVVQFAPDDLKLTPVQTDKLKKLSGSRYNPETEIIKMSS 261


>UniRef50_Q54WN8 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1233

 Score = 36.7 bits (81), Expect = 0.76
 Identities = 18/63 (28%), Positives = 32/63 (50%)
 Frame = +1

Query: 502  EAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDL 681
            + YP E ISS          + + R  +L+V ++   L K   D+  +L  +RYDP+  +
Sbjct: 1077 KTYPFEFISSHNTTDQTIEDSWVNRKAVLKVNISAFNLSKTVQDRLAQLTANRYDPQKKV 1136

Query: 682  VTI 690
            +T+
Sbjct: 1137 LTL 1139


>UniRef50_UPI0000F33AA0 Cluster: 28S ribosomal protein S35,
           mitochondrial precursor (Mitochondrial ribosomal protein
           S28) (MRP-S28).; n=1; Bos taurus|Rep: 28S ribosomal
           protein S35, mitochondrial precursor (Mitochondrial
           ribosomal protein S28) (MRP-S28). - Bos Taurus
          Length = 87

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 15/21 (71%), Positives = 17/21 (80%)
 Frame = +2

Query: 368 KANAELMKIPNFLHLTPPVIK 430
           + N EL+KIPNFLHLTP  IK
Sbjct: 1   EGNLELLKIPNFLHLTPVAIK 21


>UniRef50_Q6ZDM0 Cluster: Putative D13F protein, MybSt1; n=2; Oryza
           sativa|Rep: Putative D13F protein, MybSt1 - Oryza sativa
           subsp. japonica (Rice)
          Length = 383

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +2

Query: 287 PKTFHPSSVPLPIRQGYVPKGQAPPGK-KANAELMKIPNFLHLTPPV 424
           P  + P+ VP+P   GYVP   APPG  +A  E++K P  +H  PPV
Sbjct: 280 PPYYPPAFVPMPY-YGYVPVFYAPPGAVQAQHEVVK-PVAVHSKPPV 324


>UniRef50_P98174 Cluster: FYVE, RhoGEF and PH domain-containing
           protein 1; n=24; Euteleostomi|Rep: FYVE, RhoGEF and PH
           domain-containing protein 1 - Homo sapiens (Human)
          Length = 961

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           PGP T  PS  P P+++   PK Q PP K +  ++ ++P  L   PP
Sbjct: 137 PGPPTETPSQRPSPLKRAPGPKPQVPP-KPSYLQMPRMPPPLEPIPP 182


>UniRef50_Q7PYL4 Cluster: ENSANGP00000007859; n=2; Culicidae|Rep:
           ENSANGP00000007859 - Anopheles gambiae str. PEST
          Length = 722

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           GP  ++G V P P   H    P P   G VP G  PPG       M +     +TPP
Sbjct: 610 GPMGHYGEVHPHPDAHHGYGPPPPTAGGSVPPGGMPPGPGGPPPTM-VTATATVTPP 665


>UniRef50_O74340 Cluster: U3 snoRNP-associated protein Sof1; n=2;
           Ascomycota|Rep: U3 snoRNP-associated protein Sof1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 436

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +3

Query: 87  NVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDK--MQRRVVKRTDVQPDRIDRMAQT 260
           NV+LWR  ++S  ++++   EE   + LD L++R K   + R + R    P  + + A+ 
Sbjct: 339 NVRLWRARASSR-ASIRSTREENRLKYLDSLRERYKHIPEIRRIARHRHLPTNVKKAAEI 397

Query: 261 RTGGMCGLVRKLSTRLRCHYRYVRATYQRVKHRQV 365
           +   +  L R+    +R H +     Y++ + R V
Sbjct: 398 KREEINSLKRR-EENIRRHSKKGAVPYEKERERHV 431


>UniRef50_A5K3R8 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 836

 Score = 33.9 bits (74), Expect = 5.3
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)
 Frame = +2

Query: 239 DRQDGPNQNWGNVWPGPKTFHPSSVPL--PIRQGYVPKGQAP 358
           DR + PN ++     G K+  P++ P   P+  GY+PKG AP
Sbjct: 274 DRMNQPNSSFQYEGEGTKSTPPNNKPTKEPLNNGYLPKGAAP 315


>UniRef50_Q2BKD4 Cluster: Putative uncharacterized protein; n=1;
           Neptuniibacter caesariensis|Rep: Putative
           uncharacterized protein - Neptuniibacter caesariensis
          Length = 189

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +2

Query: 326 RQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQCEALKQFCTEWPNLLNSEESIEK 505
           R G+V      PG   +  L K+ + L  +  ++K Q E + +   E  NL N+ ES+  
Sbjct: 71  RIGWVEPTAVDPGDSISVRLPKLQSDLEQSQTMVKEQAEKIVELQQESKNLKNTNESLNS 130

Query: 506 HI 511
            +
Sbjct: 131 EV 132


>UniRef50_A0EFM7 Cluster: Chromosome undetermined scaffold_93, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_93,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 551

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +3

Query: 33  KMSILIKRSKSGCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKK-----RDKM 197
           +M ILIKR K    N      L  L  T A +A++K EEE +    +I K      ++ +
Sbjct: 303 EMGILIKRQKDEKLNLEKEKTLLSLKLTDAQAAIQKLEEENKSLKKEIEKSPVAMVKENL 362

Query: 198 QRRVVKRTDVQPDRIDRMAQTR 263
           Q ++++ T+++ + +DR  Q +
Sbjct: 363 QEKIMEITELKKE-LDRTNQIK 383


>UniRef50_Q5AI30 Cluster: Likely mitochondrial ribosomal protein
           Rsm24p; n=5; Saccharomycetales|Rep: Likely mitochondrial
           ribosomal protein Rsm24p - Candida albicans (Yeast)
          Length = 310

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 9/86 (10%)
 Frame = +1

Query: 466 MAESTQL*GKYREAY--------PLEII-SSDYCHASPSIRNPLARVVILRVQLADLKLD 618
           +A    L  KYR+ Y        P+ +  +SD+   + S  N   R V L+V L DL L+
Sbjct: 136 IAYEAPLLAKYRQPYTPRPRTEAPIRLTYNSDFTDDTSSAHN---RKVALKVSLRDLNLN 192

Query: 619 KHATDKFKRLVGDRYDPKTDLVTIHS 696
                KFK L GD+++   D   + S
Sbjct: 193 PKQQHKFKVLAGDKFNHDEDTFQLKS 218


>UniRef50_Q03976 Cluster: 37S ribosomal protein S24, mitochondrial
           precursor; n=6; Saccharomycetales|Rep: 37S ribosomal
           protein S24, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 319

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +1

Query: 562 NPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           +P +R V+L V+  +L L++ +  KF+ L   RYD  TD+  + S
Sbjct: 194 HPNSRKVVLSVKTKELGLEEKSLHKFRILARSRYDHTTDIFKMSS 238


>UniRef50_Q9NRR4 Cluster: Ribonuclease 3; n=59; Eumetazoa|Rep:
           Ribonuclease 3 - Homo sapiens (Human)
          Length = 1374

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 254 PNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKS 433
           PN    + +P P  F P   P+P      P   APPG+     +M  P+  H  PP +  
Sbjct: 103 PNHQMRHPFPVPPCFPPMPPPMPCPNN-PPVPGAPPGQGTFPFMMPPPSMPHPPPPPVMP 161

Query: 434 Q 436
           Q
Sbjct: 162 Q 162


>UniRef50_UPI0000DB730E Cluster: PREDICTED: similar to CG32809-PD,
           isoform D; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG32809-PD, isoform D - Apis mellifera
          Length = 1064

 Score = 33.1 bits (72), Expect = 9.3
 Identities = 18/40 (45%), Positives = 25/40 (62%)
 Frame = +2

Query: 302 PSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           PS   LP  QG+VP GQ PP  + NAEL+++ +   + PP
Sbjct: 739 PSLPTLP--QGFVP-GQKPPVPERNAELLQLASARRVPPP 775


>UniRef50_A6RT79 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 343

 Score = 33.1 bits (72), Expect = 9.3
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +1

Query: 559 RNPLARVVILRVQLADLK-LDKHATDKFKRLVGDRYDPKTDLV 684
           ++P  + V++    AD+  L +  TDK ++LVG R +P+TD+V
Sbjct: 173 QHPAEKKVVMEFCPADMPGLTEVQTDKLRKLVGPRLNPETDIV 215


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 857,278,095
Number of Sequences: 1657284
Number of extensions: 17776808
Number of successful extensions: 46417
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 44389
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46377
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 76652910257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -