SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B5529 Cluster: PREDICTED: similar to AT19737p; ...    84   4e-15
UniRef50_UPI000051A1C1 Cluster: PREDICTED: similar to kelch-like...    75   2e-12
UniRef50_UPI0000E47C98 Cluster: PREDICTED: similar to KLHL10 pro...    68   4e-10
UniRef50_UPI0000D8BFE9 Cluster: UPI0000D8BFE9 related cluster; n...    65   2e-09
UniRef50_O94889 Cluster: Kelch-like protein 18; n=42; Eumetazoa|...    62   1e-08
UniRef50_Q6TDP4 Cluster: Kelch-like protein 17; n=28; Coelomata|...    62   1e-08
UniRef50_Q6GKZ1 Cluster: AT19737p; n=3; Diptera|Rep: AT19737p - ...    62   2e-08
UniRef50_A7SMX0 Cluster: Predicted protein; n=1; Nematostella ve...    62   2e-08
UniRef50_A7SYB7 Cluster: Predicted protein; n=3; Nematostella ve...    61   4e-08
UniRef50_UPI00015B4FDF Cluster: PREDICTED: hypothetical protein;...    60   7e-08
UniRef50_A7S0N0 Cluster: Predicted protein; n=1; Nematostella ve...    60   7e-08
UniRef50_UPI000051A12B Cluster: PREDICTED: similar to Ring canal...    59   1e-07
UniRef50_A7RXT2 Cluster: Predicted protein; n=1; Nematostella ve...    59   1e-07
UniRef50_Q4SQV1 Cluster: Chromosome 1 SCAF14529, whole genome sh...    58   4e-07
UniRef50_UPI0000E46E26 Cluster: PREDICTED: hypothetical protein;...    57   5e-07
UniRef50_A7SR72 Cluster: Predicted protein; n=6; Eumetazoa|Rep: ...    57   5e-07
UniRef50_Q9UH77 Cluster: Kelch-like protein 3; n=31; Eumetazoa|R...    57   5e-07
UniRef50_A7SES3 Cluster: Predicted protein; n=1; Nematostella ve...    57   7e-07
UniRef50_UPI00015B5C6D Cluster: PREDICTED: similar to GA17529-PA...    56   9e-07
UniRef50_Q4T4N0 Cluster: Chromosome 18 SCAF9581, whole genome sh...    56   9e-07
UniRef50_Q7PNH6 Cluster: ENSANGP00000006666; n=1; Anopheles gamb...    56   9e-07
UniRef50_Q8NBE8 Cluster: Kelch-like protein 23; n=20; Euteleosto...    56   9e-07
UniRef50_Q6JEL2 Cluster: Kelch-like protein 10; n=26; Euteleosto...    56   9e-07
UniRef50_UPI000058469D Cluster: PREDICTED: hypothetical protein;...    56   2e-06
UniRef50_Q9Y573 Cluster: Actin-binding protein IPP; n=29; Eutele...    56   2e-06
UniRef50_UPI0001555B86 Cluster: PREDICTED: hypothetical protein;...    55   2e-06
UniRef50_UPI0001554816 Cluster: PREDICTED: similar to Kelch-like...    55   2e-06
UniRef50_UPI0000D8C3A0 Cluster: Kelch-like protein 3.; n=1; Dani...    55   2e-06
UniRef50_UPI0000EB2767 Cluster: Kelch-like protein 2 (Actin-bind...    55   2e-06
UniRef50_O95198 Cluster: Kelch-like protein 2; n=40; Coelomata|R...    55   2e-06
UniRef50_Q8WZ60 Cluster: Kelch-like protein 6; n=28; Euteleostom...    55   3e-06
UniRef50_Q96PQ7 Cluster: Kelch-like protein 5; n=98; Eumetazoa|R...    54   4e-06
UniRef50_Q53G59 Cluster: Kelch-like protein 12; n=31; Euteleosto...    54   4e-06
UniRef50_UPI00005841E4 Cluster: PREDICTED: similar to MGC82233 p...    54   5e-06
UniRef50_Q8IH99 Cluster: AT24465p; n=9; Eumetazoa|Rep: AT24465p ...    54   5e-06
UniRef50_A7SN17 Cluster: Predicted protein; n=1; Nematostella ve...    54   5e-06
UniRef50_Q14145 Cluster: Kelch-like ECH-associated protein 1; n=...    54   5e-06
UniRef50_Q9Y2M5 Cluster: Kelch-like protein 20; n=48; Eumetazoa|...    54   6e-06
UniRef50_Q7KSF5 Cluster: CG3962-PB, isoform B; n=12; Endopterygo...    53   8e-06
UniRef50_UPI0000E46FA6 Cluster: PREDICTED: similar to kelch-like...    53   1e-05
UniRef50_UPI00005867DD Cluster: PREDICTED: hypothetical protein;...    53   1e-05
UniRef50_Q4SHR9 Cluster: Chromosome 5 SCAF14581, whole genome sh...    53   1e-05
UniRef50_Q9C0H6 Cluster: Kelch-like protein 4; n=10; Euteleostom...    53   1e-05
UniRef50_A7SDY1 Cluster: Predicted protein; n=2; Nematostella ve...    52   1e-05
UniRef50_A7S3Z6 Cluster: Predicted protein; n=1; Nematostella ve...    52   1e-05
UniRef50_A7RSF7 Cluster: Predicted protein; n=1; Nematostella ve...    52   1e-05
UniRef50_UPI0000E4A091 Cluster: PREDICTED: similar to MGC83819 p...    52   3e-05
UniRef50_UPI0000E493DC Cluster: PREDICTED: similar to KLHL5 prot...    52   3e-05
UniRef50_Q9NXS3 Cluster: Kelch-like protein 28; n=23; Euteleosto...    52   3e-05
UniRef50_Q4RUA0 Cluster: Chromosome 1 SCAF14995, whole genome sh...    51   3e-05
UniRef50_A7T138 Cluster: Predicted protein; n=1; Nematostella ve...    51   3e-05
UniRef50_UPI0000F1DB4D Cluster: PREDICTED: hypothetical protein;...    51   4e-05
UniRef50_UPI0000588104 Cluster: PREDICTED: similar to actin-bind...    51   4e-05
UniRef50_UPI0000587F3A Cluster: PREDICTED: hypothetical protein;...    51   4e-05
UniRef50_A7RGT6 Cluster: Predicted protein; n=3; Nematostella ve...    51   4e-05
UniRef50_Q8NFY9 Cluster: Kelch repeat and BTB domain-containing ...    51   4e-05
UniRef50_UPI0000586FE1 Cluster: PREDICTED: similar to GA19454-PA...    50   6e-05
UniRef50_Q4RMP4 Cluster: Chromosome 10 SCAF15019, whole genome s...    50   6e-05
UniRef50_Q9UJP4 Cluster: Kelch-like protein 21; n=21; Euteleosto...    50   6e-05
UniRef50_A7T3P4 Cluster: Predicted protein; n=1; Nematostella ve...    50   1e-04
UniRef50_A7RJJ1 Cluster: Predicted protein; n=1; Nematostella ve...    49   1e-04
UniRef50_Q4RJL3 Cluster: Chromosome 3 SCAF15037, whole genome sh...    49   2e-04
UniRef50_UPI0001554EC3 Cluster: PREDICTED: hypothetical protein,...    48   2e-04
UniRef50_A7RP55 Cluster: Predicted protein; n=1; Nematostella ve...    48   3e-04
UniRef50_A7SRT7 Cluster: Predicted protein; n=1; Nematostella ve...    48   4e-04
UniRef50_A7SP59 Cluster: Predicted protein; n=1; Nematostella ve...    48   4e-04
UniRef50_A7S474 Cluster: Predicted protein; n=1; Nematostella ve...    48   4e-04
UniRef50_O93567 Cluster: Zinc finger and BTB domain-containing p...    48   4e-04
UniRef50_UPI000065E579 Cluster: Kelch-like protein 24 (Protein D...    47   5e-04
UniRef50_A7RT28 Cluster: Predicted protein; n=1; Nematostella ve...    47   5e-04
UniRef50_A7S2N5 Cluster: Predicted protein; n=1; Nematostella ve...    47   7e-04
UniRef50_Q8IXQ5 Cluster: Kelch-like protein 7; n=28; Euteleostom...    47   7e-04
UniRef50_Q96M94 Cluster: Kelch-like protein 15; n=21; Euteleosto...    47   7e-04
UniRef50_O60662 Cluster: Kelch repeat and BTB domain-containing ...    47   7e-04
UniRef50_Q4T3G1 Cluster: Chromosome undetermined SCAF10082, whol...    46   0.001
UniRef50_Q0D2K2 Cluster: Kelch-like protein 30; n=23; Euteleosto...    46   0.001
UniRef50_Q2TBA0 Cluster: Kelch repeat and BTB domain-containing ...    46   0.002
UniRef50_UPI0000D56F9D Cluster: PREDICTED: similar to CG1812-PA,...    45   0.002
UniRef50_Q4SHR8 Cluster: Chromosome 5 SCAF14581, whole genome sh...    45   0.002
UniRef50_A7SD21 Cluster: Predicted protein; n=1; Nematostella ve...    45   0.002
UniRef50_Q9H620 Cluster: CDNA: FLJ22673 fis, clone HSI10503; n=3...    45   0.003
UniRef50_Q6TFL4 Cluster: Kelch-like protein 24; n=27; Euteleosto...    45   0.003
UniRef50_Q8IY47 Cluster: Kelch repeat and BTB domain-containing ...    45   0.003
UniRef50_O14682 Cluster: Ectoderm-neural cortex protein 1; n=59;...    45   0.003
UniRef50_UPI0000E45D41 Cluster: PREDICTED: similar to KIAA1378 p...    44   0.004
UniRef50_UPI0000589070 Cluster: PREDICTED: similar to MGC80367 p...    44   0.004
UniRef50_UPI0000D8E0BB Cluster: hypothetical protein LOC559083; ...    44   0.004
UniRef50_UPI000065D9AB Cluster: Kelch repeat and BTB domain-cont...    44   0.004
UniRef50_A5WUJ7 Cluster: Novel protein; n=1; Danio rerio|Rep: No...    44   0.004
UniRef50_A0PK12 Cluster: C8ORFK36 protein; n=19; Euteleostomi|Re...    44   0.004
UniRef50_UPI0000E48704 Cluster: PREDICTED: hypothetical protein;...    44   0.005
UniRef50_UPI0000EB1AED Cluster: Zinc finger and BTB domain-conta...    44   0.005
UniRef50_Q4S1N2 Cluster: Chromosome 6 SCAF14768, whole genome sh...    44   0.005
UniRef50_Q5D8N1 Cluster: SJCHGC06470 protein; n=1; Schistosoma j...    44   0.005
UniRef50_O95365 Cluster: Zinc finger and BTB domain-containing p...    44   0.005
UniRef50_Q9P2J3 Cluster: Kelch-like protein 9; n=59; Euteleostom...    44   0.005
UniRef50_UPI00004D5576 Cluster: Kelch repeat and BTB domain cont...    44   0.007
UniRef50_Q4SNU3 Cluster: Chromosome 15 SCAF14542, whole genome s...    44   0.007
UniRef50_Q4RUA8 Cluster: Chromosome 1 SCAF14995, whole genome sh...    44   0.007
UniRef50_Q9H511 Cluster: Kelch-like protein 31; n=25; Euteleosto...    44   0.007
UniRef50_UPI00015B610E Cluster: PREDICTED: similar to ENSANGP000...    43   0.009
UniRef50_UPI0000E817CF Cluster: PREDICTED: hypothetical protein;...    43   0.009
UniRef50_UPI0000DB7F94 Cluster: PREDICTED: similar to CG9426-PA,...    43   0.009
UniRef50_Q4SKB7 Cluster: Chromosome 13 SCAF14566, whole genome s...    43   0.009
UniRef50_Q9W6R3 Cluster: Kelch protein; n=2; Takifugu rubripes|R...    43   0.012
UniRef50_Q5C318 Cluster: SJCHGC07558 protein; n=1; Schistosoma j...    43   0.012
UniRef50_Q9HBE1 Cluster: POZ-, AT hook-, and zinc finger-contain...    43   0.012
UniRef50_Q5XKL5 Cluster: BTB/POZ domain-containing protein 8; n=...    43   0.012
UniRef50_UPI0000D55679 Cluster: PREDICTED: similar to CG14307-PB...    42   0.016
UniRef50_Q4RWB2 Cluster: Chromosome 2 SCAF14990, whole genome sh...    42   0.016
UniRef50_Q16LA9 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_O61899 Cluster: Putative uncharacterized protein; n=2; ...    42   0.016
UniRef50_Q53GT1 Cluster: Kelch-like protein 22; n=29; Euteleosto...    42   0.016
UniRef50_UPI0000E482DD Cluster: PREDICTED: similar to Kelch-like...    42   0.021
UniRef50_Q4T417 Cluster: Chromosome 1 SCAF9849, whole genome sho...    42   0.021
UniRef50_Q9DHH3 Cluster: 140R protein; n=1; Yaba-like disease vi...    42   0.021
UniRef50_Q9VK21 Cluster: CG9426-PA; n=6; Endopterygota|Rep: CG94...    42   0.021
UniRef50_A7SS71 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.021
UniRef50_A7RQ26 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.021
UniRef50_Q96CT2 Cluster: Kelch-like protein 29; n=41; Euteleosto...    42   0.021
UniRef50_UPI0000E4A3E6 Cluster: PREDICTED: hypothetical protein,...    42   0.027
UniRef50_A7RZR4 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.027
UniRef50_A7RKJ4 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.027
UniRef50_Q8NAB2 Cluster: Kelch repeat and BTB domain-containing ...    42   0.027
UniRef50_UPI00004D80C2 Cluster: UPI00004D80C2 related cluster; n...    41   0.036
UniRef50_Q4T2F4 Cluster: Chromosome undetermined SCAF10277, whol...    41   0.036
UniRef50_Q4SD02 Cluster: Chromosome 14 SCAF14646, whole genome s...    41   0.036
UniRef50_Q9YMC6 Cluster: MA55; n=3; Leporipoxvirus|Rep: MA55 - M...    41   0.036
UniRef50_Q9H2C0 Cluster: Gigaxonin; n=5; Eutheria|Rep: Gigaxonin...    41   0.036
UniRef50_UPI00015B5D8B Cluster: PREDICTED: similar to actin-bind...    41   0.047
UniRef50_UPI00015A49F0 Cluster: UPI00015A49F0 related cluster; n...    41   0.047
UniRef50_UPI0000614A22 Cluster: Kelch repeat and BTB domain-cont...    41   0.047
UniRef50_Q7PTI4 Cluster: ENSANGP00000017144; n=3; Endopterygota|...    40   0.063
UniRef50_A7SR57 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.063
UniRef50_A7RFM5 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.063
UniRef50_Q6DEL7 Cluster: Kelch-like protein 15; n=4; Clupeocepha...    40   0.063
UniRef50_UPI000069DC2B Cluster: Kelch-like protein 22.; n=1; Xen...    40   0.083
UniRef50_Q4SW69 Cluster: Chromosome 9 SCAF13686, whole genome sh...    40   0.083
UniRef50_Q2L3T3 Cluster: POZ domain protein; n=1; Triticum aesti...    40   0.083
UniRef50_Q96NJ5 Cluster: Kelch-like protein 32; n=42; Euteleosto...    40   0.083
UniRef50_Q53HC5 Cluster: Kelch-like protein 26; n=23; Euteleosto...    40   0.083
UniRef50_Q8N4N3 Cluster: Kelch repeat and BTB domain-containing ...    40   0.083
UniRef50_UPI00015B573A Cluster: PREDICTED: similar to ENSANGP000...    40   0.11 
UniRef50_UPI0000F20895 Cluster: PREDICTED: hypothetical protein;...    40   0.11 
UniRef50_Q4SQQ9 Cluster: Chromosome undetermined SCAF14531, whol...    40   0.11 
UniRef50_Q4RXG1 Cluster: Chromosome 11 SCAF14979, whole genome s...    40   0.11 
UniRef50_UPI00015B5791 Cluster: PREDICTED: hypothetical protein;...    39   0.14 
UniRef50_UPI0000DB6F4B Cluster: PREDICTED: similar to bab2 CG910...    39   0.14 
UniRef50_UPI000058439A Cluster: PREDICTED: similar to kelch rela...    39   0.14 
UniRef50_UPI00015A7D3C Cluster: UPI00015A7D3C related cluster; n...    39   0.14 
UniRef50_UPI00015A4291 Cluster: Ectoderm-neural cortex protein 2...    39   0.14 
UniRef50_Q4SA05 Cluster: Chromosome 12 SCAF14692, whole genome s...    39   0.14 
UniRef50_A7S2V3 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.14 
UniRef50_Q18670 Cluster: Putative uncharacterized protein kel-1;...    39   0.19 
UniRef50_A7SZP9 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.19 
UniRef50_UPI0000D5728D Cluster: PREDICTED: similar to CG9102-PA;...    38   0.25 
UniRef50_Q9PVP8 Cluster: Champignon; n=3; Xenopus|Rep: Champigno...    38   0.33 
UniRef50_Q9VZU6 Cluster: BTB-VII protein domain; n=2; Sophophora...    38   0.33 
UniRef50_Q960S0 Cluster: LD38452p; n=1; Drosophila melanogaster|...    38   0.33 
UniRef50_Q176R3 Cluster: Fruitless; n=1; Aedes aegypti|Rep: Frui...    38   0.33 
UniRef50_UPI00015B5B98 Cluster: PREDICTED: similar to broad-comp...    38   0.44 
UniRef50_UPI00015B4D74 Cluster: PREDICTED: similar to ENSANGP000...    38   0.44 
UniRef50_UPI00015B40D2 Cluster: PREDICTED: similar to bric-a-bra...    38   0.44 
UniRef50_UPI0000E81831 Cluster: PREDICTED: similar to MGC53471 p...    38   0.44 
UniRef50_UPI0000DB737B Cluster: PREDICTED: similar to fruitless ...    38   0.44 
UniRef50_UPI0000DB6BB6 Cluster: PREDICTED: similar to bab2 CG910...    38   0.44 
UniRef50_UPI00006A1ACF Cluster: UPI00006A1ACF related cluster; n...    38   0.44 
UniRef50_Q8V3G0 Cluster: SPV136 kelch-like protein; n=1; Swinepo...    38   0.44 
UniRef50_Q6TUZ3 Cluster: 19L; n=2; Yatapoxvirus|Rep: 19L - Yaba ...    38   0.44 
UniRef50_Q2PGG2 Cluster: Broad-complex; n=1; Apis mellifera|Rep:...    38   0.44 
UniRef50_O96376 Cluster: Broad-complex Z4-isoform; n=15; Obtecto...    38   0.44 
UniRef50_UPI0000D56399 Cluster: PREDICTED: similar to CG4807-PA,...    37   0.58 
UniRef50_Q4SC94 Cluster: Chromosome undetermined SCAF14659, whol...    37   0.58 
UniRef50_Q8QN48 Cluster: CPXV013 protein; n=3; Cowpox virus|Rep:...    37   0.58 
UniRef50_A7S7S2 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.58 
UniRef50_Q9Y2K1 Cluster: Zinc finger and BTB domain-containing p...    37   0.58 
UniRef50_P87617 Cluster: Kelch repeat protein C2; n=57; Orthopox...    37   0.58 
UniRef50_UPI0000E46E2C Cluster: PREDICTED: similar to kelch-like...    37   0.77 
UniRef50_Q5RIW6 Cluster: Novel protein similar to human and mous...    37   0.77 
UniRef50_Q7Q666 Cluster: ENSANGP00000010806; n=1; Anopheles gamb...    37   0.77 
UniRef50_Q17KB8 Cluster: Bric-a-brac; n=1; Aedes aegypti|Rep: Br...    37   0.77 
UniRef50_O15156 Cluster: Zinc finger and BTB domain-containing p...    37   0.77 
UniRef50_Q8WVZ9 Cluster: Kelch repeat and BTB domain-containing ...    37   0.77 
UniRef50_UPI00015B6112 Cluster: PREDICTED: similar to fruitless ...    36   1.0  
UniRef50_UPI0000F1EE07 Cluster: PREDICTED: hypothetical protein;...    36   1.0  
UniRef50_UPI0000F1D481 Cluster: PREDICTED: similar to zinc finge...    36   1.0  
UniRef50_UPI0000DB734E Cluster: PREDICTED: similar to Broad-comp...    36   1.0  
UniRef50_UPI00015A4B20 Cluster: UPI00015A4B20 related cluster; n...    36   1.0  
UniRef50_UPI00015A49ED Cluster: UPI00015A49ED related cluster; n...    36   1.0  
UniRef50_Q1L8N5 Cluster: Novel protein; n=6; Clupeocephala|Rep: ...    36   1.0  
UniRef50_Q9LFZ6 Cluster: F20N2.15; n=2; core eudicotyledons|Rep:...    36   1.0  
UniRef50_Q680K8 Cluster: Putative uncharacterized protein At1g55...    36   1.0  
UniRef50_Q7PZG9 Cluster: ENSANGP00000008749; n=2; Culicidae|Rep:...    36   1.0  
UniRef50_Q9UDQ9 Cluster: SBBI26 (Kelch-like 7 (Drosophila), isof...    36   1.0  
UniRef50_P24768 Cluster: Kelch repeat protein A55; n=41; Orthopo...    36   1.0  
UniRef50_UPI00015B543F Cluster: PREDICTED: similar to ENSANGP000...    36   1.4  
UniRef50_UPI0001555635 Cluster: PREDICTED: similar to zinc finge...    36   1.4  
UniRef50_Q4RGN9 Cluster: Chromosome 4 SCAF15094, whole genome sh...    36   1.4  
UniRef50_Q3S2W8 Cluster: BroadZ1 isoform; n=1; Acheta domesticus...    36   1.4  
UniRef50_Q29DP3 Cluster: GA21544-PA; n=1; Drosophila pseudoobscu...    36   1.4  
UniRef50_Q299M6 Cluster: GA12896-PA; n=2; Endopterygota|Rep: GA1...    36   1.4  
UniRef50_Q8IN81 Cluster: Sex determination protein fruitless; n=...    36   1.4  
UniRef50_Q24206 Cluster: Broad-complex core protein isoform 6; n...    36   1.4  
UniRef50_Q9W0K7 Cluster: Protein bric-a-brac 1; n=3; Drosophila|...    36   1.4  
UniRef50_Q24174 Cluster: Protein abrupt; n=5; Diptera|Rep: Prote...    36   1.4  
UniRef50_UPI0000E47915 Cluster: PREDICTED: similar to kelch-like...    36   1.8  
UniRef50_UPI0000DB79F8 Cluster: PREDICTED: similar to bric a bra...    36   1.8  
UniRef50_UPI0000D55ED5 Cluster: PREDICTED: similar to CG9097-PB,...    36   1.8  
UniRef50_UPI000065F96E Cluster: Homolog of Homo sapiens "Zinc fi...    36   1.8  
UniRef50_Q5XXR5 Cluster: Fruitless male-specific zinc-finger C i...    36   1.8  
UniRef50_Q5S3Q0 Cluster: Male-specific transcription factor FRU-...    36   1.8  
UniRef50_A7SAR8 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.8  
UniRef50_Q9W0K4 Cluster: Protein bric-a-brac 2; n=11; Neoptera|R...    36   1.8  
UniRef50_UPI00015B5A77 Cluster: PREDICTED: similar to ENSANGP000...    35   2.4  
UniRef50_UPI0000E47B90 Cluster: PREDICTED: hypothetical protein;...    35   2.4  
UniRef50_UPI0000DB772B Cluster: PREDICTED: similar to abrupt CG4...    35   2.4  
UniRef50_Q4SQQ8 Cluster: Chromosome undetermined SCAF14531, whol...    35   2.4  
UniRef50_Q6Z5C8 Cluster: POZ domain protein family-like; n=3; Or...    35   2.4  
UniRef50_Q99592 Cluster: Zinc finger protein 238; n=26; Euteleos...    35   2.4  
UniRef50_Q9P2G9 Cluster: Kelch-like protein 8; n=30; Euteleostom...    35   2.4  
UniRef50_Q8N239 Cluster: Kelch-like protein 34; n=13; Theria|Rep...    35   2.4  
UniRef50_UPI00015B5DE9 Cluster: PREDICTED: similar to ENSANGP000...    35   3.1  
UniRef50_UPI000155547C Cluster: PREDICTED: similar to keratin as...    35   3.1  
UniRef50_UPI00006C113A Cluster: PREDICTED: similar to Kelch-like...    35   3.1  
UniRef50_UPI0000586D6C Cluster: PREDICTED: similar to repressor ...    35   3.1  
UniRef50_Q7SYJ3 Cluster: Zgc:66442; n=5; Euteleostomi|Rep: Zgc:6...    35   3.1  
UniRef50_Q1RQ11 Cluster: Zinc finger protein; n=1; Ciona intesti...    35   3.1  
UniRef50_Q17JF0 Cluster: Abrupt protein; n=1; Aedes aegypti|Rep:...    35   3.1  
UniRef50_Q16UX3 Cluster: Putative uncharacterized protein; n=1; ...    35   3.1  
UniRef50_UPI0000EBD7C4 Cluster: PREDICTED: similar to zinc finge...    34   4.1  
UniRef50_UPI0000548835 Cluster: PREDICTED: hypothetical protein;...    34   4.1  
UniRef50_Q4TA58 Cluster: Chromosome 17 SCAF7446, whole genome sh...    34   4.1  
UniRef50_Q5TX84 Cluster: ENSANGP00000027308; n=9; Culicidae|Rep:...    34   4.1  
UniRef50_Q294B4 Cluster: GA19554-PA; n=1; Drosophila pseudoobscu...    34   4.1  
UniRef50_Q17H68 Cluster: Microtubule binding protein, putative; ...    34   4.1  
UniRef50_O16313 Cluster: Putative uncharacterized protein; n=2; ...    34   4.1  
UniRef50_UPI0000E494F7 Cluster: PREDICTED: similar to MGC81491 p...    34   5.5  
UniRef50_UPI0000DB6EB9 Cluster: PREDICTED: similar to Protein tr...    34   5.5  
UniRef50_UPI0000DB6E40 Cluster: PREDICTED: similar to BTB-protei...    34   5.5  
UniRef50_UPI0000D55FEF Cluster: PREDICTED: similar to Tramtrack ...    34   5.5  
UniRef50_UPI0000519F94 Cluster: PREDICTED: similar to CG3726-PA;...    34   5.5  
UniRef50_Q4RJ22 Cluster: Chromosome 1 SCAF15039, whole genome sh...    34   5.5  
UniRef50_Q16GQ7 Cluster: ORF-A short, putative; n=1; Aedes aegyp...    34   5.5  
UniRef50_Q9UD99 Cluster: Putative KUP zinc-finger protein; n=2; ...    34   5.5  
UniRef50_Q13105 Cluster: Zinc finger and BTB domain-containing p...    34   5.5  
UniRef50_P17789 Cluster: Protein tramtrack, beta isoform; n=1; D...    34   5.5  
UniRef50_P42282 Cluster: Protein tramtrack, alpha isoform; n=2; ...    34   5.5  
UniRef50_Q10579 Cluster: Spermatocyte protein spe-26; n=2; Caeno...    34   5.5  
UniRef50_Q9P2G3 Cluster: Kelch-like protein 14; n=31; Euteleosto...    34   5.5  
UniRef50_UPI00015B5958 Cluster: PREDICTED: similar to speckle-ty...    33   7.2  
UniRef50_UPI00015A742E Cluster: Influenza virus NS1A-binding pro...    33   7.2  
UniRef50_UPI000069FAC2 Cluster: zinc finger and BTB domain conta...    33   7.2  
UniRef50_UPI0000ECC9FB Cluster: Transcription regulator protein ...    33   7.2  
UniRef50_Q7ZWZ4 Cluster: MGC53446 protein; n=6; Tetrapoda|Rep: M...    33   7.2  
UniRef50_Q4SP61 Cluster: Chromosome 15 SCAF14542, whole genome s...    33   7.2  
UniRef50_Q4RJR7 Cluster: Chromosome 13 SCAF15035, whole genome s...    33   7.2  
UniRef50_A2CG82 Cluster: Novel protein; n=2; Danio rerio|Rep: No...    33   7.2  
UniRef50_Q8ITZ1 Cluster: Putative uncharacterized protein; n=4; ...    33   7.2  
UniRef50_Q7QAU3 Cluster: ENSANGP00000010462; n=1; Anopheles gamb...    33   7.2  
UniRef50_Q7PY88 Cluster: ENSANGP00000018397; n=1; Anopheles gamb...    33   7.2  
UniRef50_A7SJN5 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.2  
UniRef50_A0AVX5 Cluster: RT01152p; n=6; Diptera|Rep: RT01152p - ...    33   7.2  
UniRef50_UPI00015B534A Cluster: PREDICTED: similar to ns1 bindin...    33   9.5  
UniRef50_UPI0000E46C40 Cluster: PREDICTED: similar to MGC80260 p...    33   9.5  
UniRef50_UPI0000D56819 Cluster: PREDICTED: similar to inhibitor ...    33   9.5  
UniRef50_UPI0000D55E18 Cluster: PREDICTED: similar to CG9097-PB,...    33   9.5  
UniRef50_UPI0000ECD40F Cluster: Kelch-like protein 34.; n=2; Gal...    33   9.5  
UniRef50_Q502I2 Cluster: Zgc:112205; n=3; Danio rerio|Rep: Zgc:1...    33   9.5  
UniRef50_Q4T6M9 Cluster: Chromosome undetermined SCAF8689, whole...    33   9.5  
UniRef50_Q4RZB6 Cluster: Chromosome 1 SCAF14944, whole genome sh...    33   9.5  
UniRef50_Q9VRA7 Cluster: CG1812-PA, isoform A; n=3; Sophophora|R...    33   9.5  
UniRef50_Q8WQC4 Cluster: Putative uncharacterized protein kel-3;...    33   9.5  
UniRef50_Q6IDZ8 Cluster: Mod(Mdg4)-h60.1; n=25; Anopheles gambia...    33   9.5  
UniRef50_Q6IDY1 Cluster: Mod(Mdg4)-v21; n=12; Anopheles gambiae|...    33   9.5  
UniRef50_Q6IDX8 Cluster: Mod(Mdg4)-v24; n=34; Culicidae|Rep: Mod...    33   9.5  
UniRef50_Q16WI5 Cluster: Lola; n=6; Aedes aegypti|Rep: Lola - Ae...    33   9.5  
UniRef50_Q2UMP7 Cluster: RNA-binding protein; n=9; Eurotiomyceti...    33   9.5  
UniRef50_Q9Y6Y0 Cluster: Influenza virus NS1A-binding protein; n...    33   9.5  
UniRef50_Q9P2D0 Cluster: Inhibitor of Bruton tyrosine kinase; n=...    33   9.5  
UniRef50_Q24478 Cluster: Centrosome-associated zinc finger prote...    33   9.5  

>UniRef50_UPI00015B5529 Cluster: PREDICTED: similar to AT19737p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           AT19737p - Nasonia vitripennis
          Length = 628

 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 40/82 (48%), Positives = 52/82 (63%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CDA+++ +DG  FPVHRAILSACS YF  LFTTTL+ +  ++ L+S V S          
Sbjct: 77  CDAVLKLEDGGVFPVHRAILSACSTYFRTLFTTTLNPKNNTEFLVSNVSSKIMNLLLEYA 136

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               ID+   +V ELL+TADYL
Sbjct: 137 YLRTIDIKQEDVCELLITADYL 158



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/59 (61%), Positives = 41/59 (69%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           GVL+LCCD LR SL  KNC+GIM FAR  FC  LE +ARRYLLRYFV   T+    + L
Sbjct: 162 GVLELCCDFLRRSLTVKNCIGIMIFAREHFCKDLEKEARRYLLRYFVQPETRKVHIVEL 220


>UniRef50_UPI000051A1C1 Cluster: PREDICTED: similar to kelch-like
           10; n=2; Endopterygota|Rep: PREDICTED: similar to
           kelch-like 10 - Apis mellifera
          Length = 698

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/73 (46%), Positives = 44/73 (60%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           GV+QLCC  L   L P+NCLGI  FAR  FC  LE   R+Y+  +F  +  +S EF  L 
Sbjct: 169 GVVQLCCQFLLQELRPENCLGIFKFARHYFCRDLEEKGRKYIRHHFKRILQESPEFKELT 228

Query: 689 LDELNSIILEDEL 727
             EL +I+ +DEL
Sbjct: 229 SKELEAILRDDEL 241



 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 35/87 (40%), Positives = 41/87 (47%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH--SREQSDVLISGVRSXXXXXXXX 428
           CD  +R   G  FPVHRAILSA SPYF ALFT +L     E ++V I  V          
Sbjct: 82  CDGAIRCATGHVFPVHRAILSAVSPYFKALFTNSLKGGKTETTEVAIDSVPGKIFSLILD 141

Query: 429 XXXXXXIDVTDTNVHELLMTADYLAFL 509
                  +V   NV +LL  AD    L
Sbjct: 142 YAYTGTCNVNADNVEQLLPLADQFEVL 168


>UniRef50_UPI0000E47C98 Cluster: PREDICTED: similar to KLHL10
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to KLHL10 protein -
           Strongylocentrotus purpuratus
          Length = 830

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT--QSDEFLH 682
           G+++ CC +L       NC+G+  FAR  FC+ LE  A RY+L +F  VA   +++EFL 
Sbjct: 112 GLVKECCAYLEDHFGASNCVGMWRFARSYFCFLLEQSAFRYILNHFEEVALGGKAEEFLE 171

Query: 683 LPLDELNSIILEDEL 727
           L +++L  I+ EDEL
Sbjct: 172 LAIEDLECIVKEDEL 186



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/80 (36%), Positives = 37/80 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +   D  +FP HR +L+ACS YF ALFT  +H  ++  + I GV            
Sbjct: 28  CDVSLEVGD-QTFPAHRNVLAACSRYFRALFTIGMHETDEKVIKIPGVEPSLMEQILDYI 86

Query: 435 XXXXIDVTDTNVHELLMTAD 494
                 V   NV ELL  AD
Sbjct: 87  YTKQTPVNSENVVELLPAAD 106


>UniRef50_UPI0000D8BFE9 Cluster: UPI0000D8BFE9 related cluster; n=1;
           Danio rerio|Rep: UPI0000D8BFE9 UniRef100 entry - Danio
           rerio
          Length = 543

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 31/74 (41%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVF-CYKLEADARRYLLRYFVTVATQSDEFLHL 685
           G++  CC  L + L P+NC+GI    +    C KL   A+R++L++F  V   S+EFL L
Sbjct: 96  GLVAACCQFLDTHLGPENCIGIHMITKDFHSCSKLHHKAKRFILQHFENVLQVSEEFLEL 155

Query: 686 PLDELNSIILEDEL 727
           PL+EL  II +D+L
Sbjct: 156 PLEELEEIIDDDKL 169



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 28/81 (34%), Positives = 39/81 (48%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D I+RA+ G  F VH+ I+ ACSPYF  LF++   S  +    I  +             
Sbjct: 13  DLIIRAN-GTKFQVHKIIMCACSPYFRVLFSSKWTSTAEHTYDIPEMSPDILYLIIQYAY 71

Query: 438 XXXIDVTDTNVHELLMTADYL 500
                +T  NV +LL+TAD L
Sbjct: 72  TRSALITAENVLKLLVTADQL 92


>UniRef50_O94889 Cluster: Kelch-like protein 18; n=42;
           Eumetazoa|Rep: Kelch-like protein 18 - Homo sapiens
           (Human)
          Length = 509

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  LR  L+PKNCLG+  FA  + C  L   A  ++ ++FV V + S+EFL LPL+++ 
Sbjct: 62  CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEV-SMSEEFLALPLEDVL 120

Query: 704 SIILEDEL 727
            ++  DEL
Sbjct: 121 ELVSRDEL 128


>UniRef50_Q6TDP4 Cluster: Kelch-like protein 17; n=28;
           Coelomata|Rep: Kelch-like protein 17 - Homo sapiens
           (Human)
          Length = 642

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV   CC  L S L+P NCLGI  FA    C  L   A RY+L++FV VA +++E
Sbjct: 171 LLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVA-KTEE 229

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ LPL ++  ++  D L
Sbjct: 230 FMLLPLKQVLELVSSDSL 247



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 22/82 (26%), Positives = 34/82 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++          H+ +L++CSPYF A+FT  +    Q+ V +  +            
Sbjct: 92  CDIVLHVA-AKEIRAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFA 150

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I V + NV  LL  A  L
Sbjct: 151 YTAEIVVGEGNVQTLLPAASLL 172


>UniRef50_Q6GKZ1 Cluster: AT19737p; n=3; Diptera|Rep: AT19737p -
           Drosophila melanogaster (Fruit fly)
          Length = 767

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/73 (42%), Positives = 44/73 (60%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ C D+L   L P+NC+ IM FAR  F   L   AR Y LRYF  VA ++ + L + 
Sbjct: 177 GLVKKCKDYLGRILTPENCVSIMGFARFRFLEDLHLKARNYTLRYFTEVAYRNIDILDMS 236

Query: 689 LDELNSIILEDEL 727
            ++  SII +DEL
Sbjct: 237 AEDFYSIISDDEL 249



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 32/96 (33%), Positives = 46/96 (47%), Gaps = 11/96 (11%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT----TTLHSREQSD-------VLISGVR 401
           CDA +   +   F VHRAI+ +CS YF A FT     T    + SD       + I GV 
Sbjct: 82  CDAQISVGEDV-FNVHRAIMCSCSSYFRAQFTGFNADTPGCVDGSDAKKNNNFIHIPGVS 140

Query: 402 SXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFL 509
           S               +++++NVHELL+ ADY+  +
Sbjct: 141 SCIMNCVIQYAYLRQTNISESNVHELLICADYVGMV 176


>UniRef50_A7SMX0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 532

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/69 (43%), Positives = 40/69 (57%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   ++S +NP NCLGI T A +  C  L   A +Y+L  F TV +Q+DEF  LP D+L 
Sbjct: 104 CVSFMKSMINPSNCLGIETAANQFDCEALRKTANQYILDNFATV-SQTDEFKSLPADKLE 162

Query: 704 SIILEDELK 730
             +  DE K
Sbjct: 163 EFLSSDETK 171



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSD---VLISGVRSXXXXXXXXXXXXXXI 449
           +G  F  HR +L+A SPYF A+F++  H REQ++   V++  + +              I
Sbjct: 21  NGKPFYAHRNVLAAASPYFRAMFSS--HFREQNESKPVILENITADVMEELLNFIYAGTI 78

Query: 450 DVTDTNVHELLMTADYL 500
            +T  NV +L+  ++YL
Sbjct: 79  KITPFNVKDLVSASNYL 95


>UniRef50_A7SYB7 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 570

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 30/78 (38%), Positives = 48/78 (61%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L+  L+P+NCLGI  FA    C +L   +  +   +FV V  QS+E
Sbjct: 136 LLQVQSVQEACCEFLKRQLSPENCLGICAFADSHSCTELVKFSDAFARLHFVDV-VQSEE 194

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ +PL +L+ I++ED+L
Sbjct: 195 FMDVPLKQLSRILVEDDL 212



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G++   H+ +L++ SPYF A+FT  +    Q  V +  +            
Sbjct: 57  CDMVLVVG-GSTISAHKVVLASGSPYFRAMFTGGMSESRQDTVTLQELDEKAMQNMIDFF 115

Query: 435 XXXXIDVTDTNVHELLMTA 491
               I++++ NV E+L  A
Sbjct: 116 YSGKIEISELNVQEVLPIA 134


>UniRef50_UPI00015B4FDF Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 381

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 4/77 (5%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD----EF 676
           G+++LC D L   L P NCLGI  FA+  FC  LE  +R Y  R+F  +         EF
Sbjct: 117 GLVRLCSDFLAEQLKPDNCLGIHKFAQHYFCQGLERRSRGYARRHFEQIVRGPGGGALEF 176

Query: 677 LHLPLDELNSIILEDEL 727
             L  DE+ +++ EDEL
Sbjct: 177 CQLECDEVEALLREDEL 193



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 18/40 (45%), Positives = 23/40 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  + + DG  +  HR IL+  SPYF  LFT+ L S  Q
Sbjct: 32  CDCEIESGDGQVYAAHRVILAGVSPYFKVLFTSRLSSERQ 71


>UniRef50_A7S0N0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 560

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 27/75 (36%), Positives = 47/75 (62%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++ +C + L+  L+P NCLGI+  A R  C +L  +A +Y +++F  V ++ DEF 
Sbjct: 111 QIPEIINVCSEFLKEQLHPSNCLGILALADRFSCEELANEAHKYTVKHFGRV-SECDEFK 169

Query: 680 HLPLDELNSIILEDE 724
            LP +E+  ++L DE
Sbjct: 170 ALPFNEI-KLLLNDE 183



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 29/90 (32%), Positives = 42/90 (46%)
 Frame = +3

Query: 222 GAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVR 401
           G  S   +   CD  +  +DG S  VHR +L+A SPYF A+FT  L    +  +L+ G+ 
Sbjct: 18  GLFSQIGLKELCDVTLETEDGLSIAVHRNVLAAVSPYFRAMFTGNLLESGKDRILLKGIA 77

Query: 402 SXXXXXXXXXXXXXXIDVTDTNVHELLMTA 491
                          I++ D NV E+L  A
Sbjct: 78  GVALQALLDYVYTSSIEIFDDNVEEVLNAA 107


>UniRef50_UPI000051A12B Cluster: PREDICTED: similar to Ring canal
           kelch protein; n=3; Coelomata|Rep: PREDICTED: similar to
           Ring canal kelch protein - Apis mellifera
          Length = 1049

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+ AD G   P H+ +L+ACSPYF A+F T+   R+Q  + + GV            
Sbjct: 78  CDVILVADGGLEVPAHKMVLAACSPYFYAMF-TSFEERDQERITLQGVDYSALELLVDYV 136

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + VT+ NV  LL  A+ L
Sbjct: 137 YSAEVHVTEDNVQVLLPAANLL 158



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/80 (35%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD L++ L+P NCLGI  FA    C +L + A  Y+ ++F  V    
Sbjct: 155 ANLLQLTDVRDACCDFLQAQLHPSNCLGIRAFADLHSCLELLSHADSYIEQHFSEV-VDG 213

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL L   ++  +I  D L
Sbjct: 214 EEFLTLAPQQVAKLICSDRL 233


>UniRef50_A7RXT2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 466

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 28/82 (34%), Positives = 45/82 (54%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD G  FP H+ +L+A S YFL LFTT +  + +++V     +S          
Sbjct: 34  CDVVLIAD-GTRFPAHKNVLAAGSSYFLGLFTTDMKEQNETEVNFEDFKSSTMDELLCYI 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +++T+TN  +L+  ADYL
Sbjct: 93  YTGEVNLTETNAKDLVFAADYL 114



 Score = 41.5 bits (93), Expect = 0.027
 Identities = 24/66 (36%), Positives = 36/66 (54%)
 Frame = +2

Query: 530 DHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELNSI 709
           + L  +L P NCL + +FA    C +L+  A  Y+L  FV V ++ +EFL L   +L  +
Sbjct: 125 EFLEDTLTPGNCLSVRSFAETFDCPELQTKAECYILDNFVEV-SRCEEFLSLDPVQLERL 183

Query: 710 ILEDEL 727
           I  D L
Sbjct: 184 ISCDGL 189


>UniRef50_Q4SQV1 Cluster: Chromosome 1 SCAF14529, whole genome
           shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 1
           SCAF14529, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 678

 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 30/78 (38%), Positives = 45/78 (57%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V Q+CC+ L+S L+P NCLGI  FA    C +L   A+ +  ++F T   Q +E
Sbjct: 170 LLQLADVRQVCCEFLQSQLHPSNCLGIRAFADLHTCPQLLRQAQAFAEQHF-TEVVQGEE 228

Query: 674 FLHLPLDELNSIILEDEL 727
           FL L L  + S++  D+L
Sbjct: 229 FLALSLQHVCSLLASDQL 246



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 19/57 (33%), Positives = 27/57 (47%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           HR +L++CSPYF A+FT  +   +   V I  V                I+VT+ NV
Sbjct: 72  HRVVLASCSPYFCAMFTGNMSESKAGRVEIREVDGQTLRTLVDYIYTAEIEVTEDNV 128


>UniRef50_UPI0000E46E26 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 642

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 30/78 (38%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V   CC  L   L+P NCLGI  FA    CY LE  +R+Y L  F  V   ++E
Sbjct: 174 LLQMESVRDACCKFLVGQLDPTNCLGIRRFADTHGCYDLEQSSRQYALYNFCHV-VNTEE 232

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP  E+  ++  ++L
Sbjct: 233 FLQLPETEVEQMVSSEQL 250



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++  D      HR +L++CS YF A+FT+ +    +S+V +  + S          
Sbjct: 95  CDIVLKVTDH-EIRAHRLVLASCSAYFHAMFTSDMTESHRSEVTLHEIDSDAVNQLVSFA 153

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I + ++NV  LL  A  L
Sbjct: 154 YTAEIMIGESNVQALLPAASLL 175


>UniRef50_A7SR72 Cluster: Predicted protein; n=6; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 546

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 28/68 (41%), Positives = 41/68 (60%)
 Frame = +2

Query: 518 QLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDE 697
           Q CC  L++ L+  NCLGI  FA    C +LE  A +Y+ ++F+ V  + DEFL LP  +
Sbjct: 99  QACCSFLQTHLDASNCLGIRAFADLYSCTELENAAFKYICQHFLDV-IKCDEFLQLPYRD 157

Query: 698 LNSIILED 721
           L S++  D
Sbjct: 158 LKSLLESD 165



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 21/82 (25%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G  F  HR +L+  S Y  A+FT  +      D+ + G+            
Sbjct: 12  CDVLLHVG-GREFRGHRIVLAGASSYLRAMFTNGMLESGMRDIKLQGIDPAVMEILLDFV 70

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +D++  NV  LL  A  L
Sbjct: 71  YTGIVDISVENVQALLSGATLL 92


>UniRef50_Q9UH77 Cluster: Kelch-like protein 3; n=31; Eumetazoa|Rep:
           Kelch-like protein 3 - Homo sapiens (Human)
          Length = 587

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 135 VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 193

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 194 DQVCSLISSDKL 205



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A+D      HR +L+ACSPYF A+FT  +   +   + I  V            
Sbjct: 50  CDVMIVAED-VEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYI 108

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A  L  ++
Sbjct: 109 YTAEIEVTEENVQVLLPAASLLQLMD 134


>UniRef50_A7SES3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 291

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 30/78 (38%), Positives = 47/78 (60%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +F  V++ C D L+  L+  NCLGI  FA    C KL+  A+ Y  ++F+ VA +SDE
Sbjct: 115 LLQFTTVVETCSDFLKKQLHATNCLGIGNFADHHGCGKLKLAAQSYAEKHFLDVA-KSDE 173

Query: 674 FLHLPLDELNSIILEDEL 727
           FL    ++++S++  D L
Sbjct: 174 FLLATYEQISSMLKSDSL 191



 Score = 37.9 bits (84), Expect = 0.33
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V        P HR IL+A S YF ++FT+ +    Q+ + +  V +          
Sbjct: 36  CDVTVVVGK-MEIPSHRLILAANSSYFYSMFTSGMSETAQNRINLKEVDATVVRQLIEYC 94

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               I++ + NV  LL   + L F
Sbjct: 95  YTSTIEINENNVQNLLSIGNLLQF 118


>UniRef50_UPI00015B5C6D Cluster: PREDICTED: similar to GA17529-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA17529-PA - Nasonia vitripennis
          Length = 564

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C D L+S  +P N LGI  FA  + C  L   + +Y+ R+F  V +QS+EFL+L  
Sbjct: 164 VKNACADFLKSRFHPHNVLGIRNFADMLSCTPLLDQSTKYIYRFFEDV-SQSEEFLNLGF 222

Query: 692 DELNSIILEDEL 727
           D+L  +I  D+L
Sbjct: 223 DDLRELIGNDDL 234



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 24/87 (27%), Positives = 40/87 (45%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD  ++ DD  SF  HR +L+A  PYF  +F   +   +Q ++ + G  S     
Sbjct: 74  RQGKLCDVTLKVDD-QSFSAHRLVLAATIPYFNGMFLNDMAESKQKNITLQGFDSTALEA 132

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    I +T+ NV  +++ A +L
Sbjct: 133 FINFAYSGRIILTNDNVQSIMVGASFL 159


>UniRef50_Q4T4N0 Cluster: Chromosome 18 SCAF9581, whole genome
           shotgun sequence; n=3; Euteleostomi|Rep: Chromosome 18
           SCAF9581, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 679

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC+ L S L+P NCLGI  FA    C +L   A  Y  ++F  V   S+EFL+L +
Sbjct: 120 VKKACCEFLSSQLHPSNCLGIRAFADLHACSQLLTQANSYAEQHFPEV-VGSEEFLNLGM 178

Query: 692 DELNSIILEDEL 727
           ++++++I  D+L
Sbjct: 179 EQVSNLIASDKL 190



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 29/89 (32%), Positives = 36/89 (40%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD  + A+D      HR +L+A SPYF A+FT  +       V I  V         
Sbjct: 32  SLLCDVTIVAED-VEIGAHRVVLAAGSPYFHAMFTGEMAESRAKRVRIKEVDGWTLGLLV 90

Query: 426 XXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                  I VT+ NV  LL  A  L   E
Sbjct: 91  DYIYTAEIQVTEDNVQALLPAAGLLQLNE 119


>UniRef50_Q7PNH6 Cluster: ENSANGP00000006666; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000006666 - Anopheles gambiae
           str. PEST
          Length = 1430

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 31/80 (38%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD+L++ L+P NCLGI  FA    C  L   A  Y+ ++F  V  Q 
Sbjct: 176 ANLLQLTDVRDACCDYLQTQLDPSNCLGIRDFADIHGCIDLLNYAETYIEQHFSEV-VQF 234

Query: 668 DEFLHLPLDELNSIILEDEL 727
           DEFL+L  D++  +I  D L
Sbjct: 235 DEFLNLTSDQVAHLIKSDRL 254



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 31/107 (28%), Positives = 49/107 (45%)
 Frame = +3

Query: 180 GSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           G+   ++H   S          +  CD ++ A+ G   P H+ +L++CSPYF A+FT   
Sbjct: 75  GAYRNNIHTQRSFEAMNMMREQNLLCDVVLVAE-GIEIPAHKMVLASCSPYFYAMFTGFE 133

Query: 360 HSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYL 500
            SR Q  + + GV                ++VT+ NV  LL  A+ L
Sbjct: 134 ESR-QDRITLQGVDPRALQLLIEYVYRAVVEVTEDNVQILLTAANLL 179


>UniRef50_Q8NBE8 Cluster: Kelch-like protein 23; n=20;
           Euteleostomi|Rep: Kelch-like protein 23 - Homo sapiens
           (Human)
          Length = 558

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++   G  F  HRA+L+ACS YF A+FT  +  + ++ + +SG+             
Sbjct: 37  DITLQCPSGIIFHCHRAVLAACSNYFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAY 96

Query: 438 XXXIDVTDTNVHELLMTADYLAFL 509
              I++T  NV  LL  AD L FL
Sbjct: 97  TSQIEITKRNVQSLLEAADLLQFL 120


>UniRef50_Q6JEL2 Cluster: Kelch-like protein 10; n=26;
           Euteleostomi|Rep: Kelch-like protein 10 - Homo sapiens
           (Human)
          Length = 608

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ CC+ L+S L   NC+GI  F    +C +L   A  ++L  F  +   S EFL L 
Sbjct: 123 GIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELS 182

Query: 689 LDELNSIILEDEL 727
           + EL  II +DEL
Sbjct: 183 VTELKDIIEKDEL 195



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++ + G  F  H+ IL +CS YF ALFT+  ++ E+    I G+            
Sbjct: 39  CDVVIKVN-GFEFSAHKNILCSCSSYFRALFTSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               + +T  NV +LL  AD
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117


>UniRef50_UPI000058469D Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 597

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V +LCC+ L++ L+  NCLGI  FA    C +L+A   +++  +F  + +QS
Sbjct: 136 ANLFQMHSVKKLCCEFLQAQLHATNCLGITHFAEVHACRELQAFGDKFIAAHFQEL-SQS 194

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EF  L  +EL  I+  D+L
Sbjct: 195 EEFCQLIFEELTKILSRDDL 214



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 29/80 (36%), Positives = 38/80 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++R D G     HRA+LS CSPYF A+FT  L   E+ ++ +  V            
Sbjct: 59  CDVVLRVD-GHKVKAHRAVLSGCSPYFKAMFTGNLCESEKEEIDLKSVDKTAINVLVDFA 117

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I VT  NV  LL  A+
Sbjct: 118 YTGRIAVTHANVQSLLPAAN 137


>UniRef50_Q9Y573 Cluster: Actin-binding protein IPP; n=29;
           Euteleostomi|Rep: Actin-binding protein IPP - Homo
           sapiens (Human)
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>UniRef50_UPI0001555B86 Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 357

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ CC+ L+S L   NC+GI  F    +C +L   A  ++L  F  +   S EFL L 
Sbjct: 100 GIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLDLS 159

Query: 689 LDELNSIILEDEL 727
           + EL  II +DEL
Sbjct: 160 VMELRDIIEKDEL 172


>UniRef50_UPI0001554816 Cluster: PREDICTED: similar to Kelch-like
           protein 30; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to Kelch-like protein 30 -
           Ornithorhynchus anatinus
          Length = 594

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/76 (38%), Positives = 46/76 (60%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +FP VL++CC +L+  ++  NCLGI  F     C ++ + AR +L   F  V +Q +EFL
Sbjct: 114 QFPTVLKVCCRYLQQQVDATNCLGICEFGELHGCPEVSSKARAFLQENFEDV-SQEEEFL 172

Query: 680 HLPLDELNSIILEDEL 727
            LP + L ++ L D+L
Sbjct: 173 LLPKERL-ALCLSDDL 187



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 23/75 (30%), Positives = 32/75 (42%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP HR+IL+ CS YF A+F         + V I  V +              + +  
Sbjct: 41  GREFPCHRSILALCSHYFHAMFAGDFVESISARVEIKDVDAAVVGELLDFAYTGKLTINQ 100

Query: 462 TNVHELLMTADYLAF 506
            NV  L+ TA+ L F
Sbjct: 101 GNVEGLIRTANRLQF 115


>UniRef50_UPI0000D8C3A0 Cluster: Kelch-like protein 3.; n=1; Danio
           rerio|Rep: Kelch-like protein 3. - Danio rerio
          Length = 610

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/72 (38%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+CCD L++ L+P NCLGI  FA    C  L + A  Y      T     +EF+ L L
Sbjct: 88  VRQVCCDFLQTQLHPTNCLGIRAFADLHACTVLLSQAHAYAAEQHFTDVMVGEEFMALSL 147

Query: 692 DELNSIILEDEL 727
            ++ S+I  D+L
Sbjct: 148 QQVCSLISSDKL 159



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/86 (30%), Positives = 41/86 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A +    P HR +L++CSPYF A+FT  +   + + V I  V            
Sbjct: 3   CDVLLVAGE-VEIPAHRVVLASCSPYFCAMFTGDMSESKANHVEIRDVDGQTLLKLVDYI 61

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+V++ NV  LL  A  L  ++
Sbjct: 62  YSAEIEVSEENVQVLLPAASLLQLMD 87


>UniRef50_UPI0000EB2767 Cluster: Kelch-like protein 2 (Actin-binding
           protein Mayven).; n=1; Canis lupus familiaris|Rep:
           Kelch-like protein 2 (Actin-binding protein Mayven). -
           Canis familiaris
          Length = 477

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 11  LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 69

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 70  FLNLGIEQVCSLISSDKL 87


>UniRef50_O95198 Cluster: Kelch-like protein 2; n=40; Coelomata|Rep:
           Kelch-like protein 2 - Homo sapiens (Human)
          Length = 593

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 135 LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 193

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 194 FLNLGIEQVCSLISSDKL 211



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 28/82 (34%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+D      HR +L+ACSPYF A+FT  +       V I  V            
Sbjct: 56  CDVTIVAED-MEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYV 114

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ NV  LL  A  L
Sbjct: 115 YTAEIQVTEENVQVLLPAAGLL 136


>UniRef50_Q8WZ60 Cluster: Kelch-like protein 6; n=28;
           Euteleostomi|Rep: Kelch-like protein 6 - Homo sapiens
           (Human)
          Length = 610

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +F  ++  C   L  +LNP+NC+GI+  A       L+   + Y+++ FV +   S
Sbjct: 138 ANLFQFLRMVDACASFLTEALNPENCVGILRLADTHSLDSLKKQVQSYIIQNFVQI-LNS 196

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP+D L+ I+  D+L
Sbjct: 197 EEFLDLPVDTLHHILKSDDL 216



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 4/102 (3%)
 Frame = +3

Query: 234 TARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXX 413
           T R+ +A   ++   D   F  HR +L+A S YF A+F   L  + +  ++I GV +   
Sbjct: 53  TLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETM 112

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
                        +T  NV  +L  A+   FL     C SF+
Sbjct: 113 HTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFL 154


>UniRef50_Q96PQ7 Cluster: Kelch-like protein 5; n=98; Eumetazoa|Rep:
           Kelch-like protein 5 - Homo sapiens (Human)
          Length = 755

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 305 VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 363

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 364 SEIAKLLASDDM 375



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD I+ A D    P HR +LS+ S YF A+FT  +    Q ++ + GV       
Sbjct: 215 RHKQLCDVILVAGD-RRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWS 273

Query: 420 XXXXXXXXXIDVTDTNVHELLMTA 491
                    +++ + N+  LL TA
Sbjct: 274 LIQYAYTGRLELKEDNIECLLSTA 297


>UniRef50_Q53G59 Cluster: Kelch-like protein 12; n=31;
           Euteleostomi|Rep: Kelch-like protein 12 - Homo sapiens
           (Human)
          Length = 568

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q CC+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110


>UniRef50_UPI00005841E4 Cluster: PREDICTED: similar to MGC82233
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC82233 protein -
           Strongylocentrotus purpuratus
          Length = 581

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 29/77 (37%), Positives = 39/77 (50%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           ++  +++ CC  L+  LNP  CLGI   A    C  L A A +Y    F+ V+ Q D FL
Sbjct: 121 QYQSIVKACCLFLKKHLNPSTCLGIKHLAETYSCTDLLAAASKYCRENFIVVSRQED-FL 179

Query: 680 HLPLDELNSIILEDELK 730
            L   EL   I  +ELK
Sbjct: 180 KLSAKELADYISSNELK 196



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 27/106 (25%), Positives = 43/106 (40%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           F  HRAIL+  SPYF A+FT     + +  V + G+                + +  +N 
Sbjct: 51  FQCHRAILACNSPYFQAMFTNDFLEKVKGIVTLEGMNPVIVAQIIEFSYTSQLTINTSNA 110

Query: 471 HELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSVTN 608
            ELL  A +L +        +  + H    T L +  L   +S T+
Sbjct: 111 QELLEAASHLQYQSIVKACCLFLKKHLNPSTCLGIKHLAETYSCTD 156


>UniRef50_Q8IH99 Cluster: AT24465p; n=9; Eumetazoa|Rep: AT24465p -
           Drosophila melanogaster (Fruit fly)
          Length = 620

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V   CC  L   L+P NCLGI +FA    C +L   + +Y L+ F  V   +
Sbjct: 152 SGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQV-VGT 210

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +E+  +I   +L
Sbjct: 211 EEFLLLPFEEVRELISNSQL 230



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 24/82 (29%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +    G +   HR +L++ SPYF A+F   +  R Q  V +  V S          
Sbjct: 75  CDVRLEVG-GDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDSSALRQLIDYT 133

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I +T+ NV  LL  +  L
Sbjct: 134 YTGEITITEQNVQVLLPASGLL 155


>UniRef50_A7SN17 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 577

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 28/87 (32%), Positives = 45/87 (51%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R+++ CDA+++ ++   FP+H+ ++SA SPYF  LF+  L       V I G+ S     
Sbjct: 29  RLNTMCDAVLKVEE-KQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSA 87

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    I+V + NV +LL  A  L
Sbjct: 88  LLDFIYTGVINVNEENVQQLLPAAKML 114



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           +++ +   V + CCD L   L   NCLGI  FA    C  L  +A  ++ R FV V  +S
Sbjct: 111 AKMLQLDAVEKCCCDFLMRQLEHANCLGIYLFAEAHSCADLSTNALEFIHRNFVLVC-ES 169

Query: 668 DEFLHLPLDELNSIILEDELK 730
           +E+L L    L  ++  ++LK
Sbjct: 170 EEYLELDRWHLLQLLDSEDLK 190


>UniRef50_Q14145 Cluster: Kelch-like ECH-associated protein 1; n=32;
           Euteleostomi|Rep: Kelch-like ECH-associated protein 1 -
           Homo sapiens (Human)
          Length = 624

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237


>UniRef50_Q9Y2M5 Cluster: Kelch-like protein 20; n=48;
           Eumetazoa|Rep: Kelch-like protein 20 - Homo sapiens
           (Human)
          Length = 604

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 148 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 206

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 207 NQLIDIISSDEL 218



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 63  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 121

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 122 YTSQITVEEGNVQTLLPAACLLQLAE 147


>UniRef50_Q7KSF5 Cluster: CG3962-PB, isoform B; n=12;
           Endopterygota|Rep: CG3962-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 776

 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 173 PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 231

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 232 SAYQLIALIRRDEL 245



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP H+ +LSA SPYF A+FT  L   E S V + GV                I VT+  V
Sbjct: 101 FPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTV 160

Query: 471 HELLMTA 491
            +LL  A
Sbjct: 161 CQLLPAA 167


>UniRef50_UPI0000E46FA6 Cluster: PREDICTED: similar to kelch-like
           ECH-associated protein 1; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to kelch-like
           ECH-associated protein 1 - Strongylocentrotus purpuratus
          Length = 1147

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           ++  CC+ L   L+P NC+GI  +A       L   A  ++ R+F  V +QS+EF++L L
Sbjct: 687 IVDACCNFLEHQLDPTNCIGISMYAEEHSLRSLSEQASMFVFRHFCEV-SQSEEFMNLNL 745

Query: 692 DELNSIILEDEL 727
            +L ++I  D+L
Sbjct: 746 VQLLTVIKHDKL 757



 Score = 40.3 bits (90), Expect = 0.063
 Identities = 22/79 (27%), Positives = 35/79 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  +    F  H+ +L++CS YF A+FT+  H   +  + I  V            
Sbjct: 602 CDVTLIVET-VKFHAHKVVLASCSQYFKAMFTSGFHECSKQSIEIKDVHPCVFSRIMDFI 660

Query: 435 XXXXIDVTDTNVHELLMTA 491
               I +T+ +V ELL  A
Sbjct: 661 YTSEITITECSVLELLPKA 679


>UniRef50_UPI00005867DD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 580

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 31/106 (29%), Positives = 49/106 (46%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP HR++L+ACSPYF A+FT  +    Q  V +  V S              I + D NV
Sbjct: 38  FPCHRSVLAACSPYFKAMFTGGMSESHQETVALQDVESSSLRLLLDFLYTGNIILDDQNV 97

Query: 471 HELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSVTN 608
            ++ +T++ L  +    F A   E   +    + +  L  V+S T+
Sbjct: 98  QDVFITSNLLQVVPLIHFCAEYLEKSLSIANCIGMYCLATVYSCTS 143


>UniRef50_Q4SHR9 Cluster: Chromosome 5 SCAF14581, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 5
           SCAF14581, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 716

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ CCD L  +L+  NCL I  F+   +C +L+  A + +L  F  V + S EFL L 
Sbjct: 262 GIVEACCDLLMEALSADNCLAIWRFSDAYYCSQLQRKAFQTILYNFEKVIS-SKEFLQLS 320

Query: 689 LDELNSIILEDEL 727
           ++EL  I   DEL
Sbjct: 321 VEELCDIFDHDEL 333


>UniRef50_Q9C0H6 Cluster: Kelch-like protein 4; n=10;
           Euteleostomi|Rep: Kelch-like protein 4 - Homo sapiens
           (Human)
          Length = 718

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>UniRef50_A7SDY1 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 544

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/78 (38%), Positives = 40/78 (51%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +F  V  LCC  L S L+P NCLGI  F     C K      +Y+L  F  V  +S+E
Sbjct: 91  LLQFHEVKDLCCQFLESQLDPSNCLGIRKFTESHGCCKFLEVIDKYVLENFKQV-MKSEE 149

Query: 674 FLHLPLDELNSIILEDEL 727
           +  LP + L  +I  D+L
Sbjct: 150 YALLPSELLVKVISSDDL 167



 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++R D+  S+  HRA+L++CS YF A+F   L   +Q  + +  +            
Sbjct: 12  CDVVLRIDE-QSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++T  NV  LL TA  L F E
Sbjct: 71  YTGRVEITVENVQNLLATASLLQFHE 96


>UniRef50_A7S3Z6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 549

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  L S LN  NCLGI +F+    C++L   A RY+ + FV V ++SDEFL +  
Sbjct: 119 VKDACCRFLESRLNVSNCLGIQSFSETYACHELWHIASRYVYQNFVHV-SESDEFLAMSP 177

Query: 692 DELNSIILEDEL 727
             +  +   DE+
Sbjct: 178 KNVAILFSSDEI 189



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/48 (43%), Positives = 28/48 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD +++A+D   F  HR ILSA S YF A+F   +    Q  V I+GV
Sbjct: 34  CDVVIKAED-TEFLAHRNILSASSDYFFAMFNGNMKESSQDVVTITGV 80


>UniRef50_A7RSF7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 539

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYK-LEADARRYLLRYFVTVATQSDEF 676
           R  G++  C   LR ++ P NCLG+ + A R+FC   L   A R+ L +F +V  Q +EF
Sbjct: 96  RLDGLVDHCEMFLRRNMTPSNCLGLQSLA-RLFCLDGLSEHANRFALWHFQSV-YQEEEF 153

Query: 677 LHLPLDELNSIILEDELK 730
             +P  +L S++ +D LK
Sbjct: 154 NRVPYQQLKSLVQDDTLK 171



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD  + A D    P HRAIL+A SPYF A+F +     ++  V +  V
Sbjct: 15  CDVTLLAGD-RKIPAHRAILAASSPYFRAMFLSGFVEAKEESVTVKEV 61


>UniRef50_UPI0000E4A091 Cluster: PREDICTED: similar to MGC83819
           protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC83819 protein -
           Strongylocentrotus purpuratus
          Length = 684

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 30/79 (37%), Positives = 40/79 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV   C + L+  L+  NCLGI  FA       L A A  Y L +F  + T+ DE
Sbjct: 267 LLQLKGVEMRCSEFLKEQLDSSNCLGIKRFAETHSTAGLLAAAESYCLTHFSEI-TKEDE 325

Query: 674 FLHLPLDELNSIILEDELK 730
           FL L  DE + +I  D L+
Sbjct: 326 FLDLTPDEFSQLICRDNLE 344


>UniRef50_UPI0000E493DC Cluster: PREDICTED: similar to KLHL5
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to KLHL5 protein - Strongylocentrotus
           purpuratus
          Length = 633

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + + P V   C + L+  L+P NCLGI  FA    C  L+  +  Y + +F  VA 
Sbjct: 171 NTASMLQLPDVQASCSEFLKKQLHPANCLGIRNFADAHTCTDLKLASGHYAVTHFNEVAY 230

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           + +EFL L  ++L+ ++  ++L
Sbjct: 231 E-EEFLQLTKEQLSELLQSEDL 251



 Score = 33.9 bits (74), Expect = 5.5
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 6/83 (7%)
 Frame = +3

Query: 171 SDGGSGNRSVHVGGSDAGAPSTA------RVSSACDAIVRADDGASFPVHRAILSACSPY 332
           +DGGS +  +H   S  G  +        +V   CD I+  + G   P HR +L++   Y
Sbjct: 9   ADGGSPDVMIHRADSFYGNQALRTMDDLRQVGKLCDVILDIE-GTRIPAHRIVLASFCQY 67

Query: 333 FLALFTTTLHSREQSDVLISGVR 401
           F  +FT  +     +++ +  V+
Sbjct: 68  FYTMFTGEMKEAGLAEITMKEVK 90


>UniRef50_Q9NXS3 Cluster: Kelch-like protein 28; n=23;
           Euteleostomi|Rep: Kelch-like protein 28 - Homo sapiens
           (Human)
          Length = 571

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VL+ CC  L S L+P NC+GI  FA    C  L   A +Y+ + F  V  Q++EF  L  
Sbjct: 120 VLKECCAFLESQLDPGNCIGISRFAETYGCRDLYLAATKYICQNFEAVC-QTEEFFELTH 178

Query: 692 DELNSIILED 721
            +L+ I+  D
Sbjct: 179 ADLDEIVSND 188



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+R  D      H+ +L++ SPYF A+FT  L  +E S+V    +            
Sbjct: 35  CDIILRVGD-VKIHAHKVVLASVSPYFKAMFTGNLSEKENSEVEFQCIDETALQAIVEYA 93

Query: 435 XXXXIDVTDTNVHELLMTADY----LAFLECFSFV 527
               + ++   V  LL  A+     L   EC +F+
Sbjct: 94  YTGTVFISQDTVESLLPAANLLQIKLVLKECCAFL 128


>UniRef50_Q4RUA0 Cluster: Chromosome 1 SCAF14995, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 1
           SCAF14995, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 531

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/69 (36%), Positives = 40/69 (57%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LCC  L   L+  NCLG+M +A R+ C +L   AR+  L +F  +  + +EFL LP + +
Sbjct: 116 LCCKFLERQLHITNCLGMMAYAWRLGCNQLYKAARQVALSHFPALLAE-EEFLSLPKEAV 174

Query: 701 NSIILEDEL 727
             ++  D+L
Sbjct: 175 ADLLASDDL 183



 Score = 33.5 bits (73), Expect = 7.2
 Identities = 23/74 (31%), Positives = 33/74 (44%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  F V+R  L+  SPYF ALF  +     +  V I GV                + ++
Sbjct: 35  EGEKFYVNRKQLALQSPYFRALFFGSGIESTKRQVCIKGVDLQHFQVLMEHSRTSRLALS 94

Query: 459 DTNVHELLMTADYL 500
             NV  +L TAD+L
Sbjct: 95  RENVQGILETADFL 108


>UniRef50_A7T138 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 593

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/78 (34%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV + C + L+  L+P NCLGI  FA    C +L+A A  ++ ++F T   +S+E
Sbjct: 117 LLQLTGVQKACSEFLQHQLDPTNCLGIRAFADTHCCDELKAAAENFIHKHF-TEIVKSEE 175

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ L  D++  +   D L
Sbjct: 176 FMMLNSDDVMCLSKSDNL 193



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++ +    FP HR +L++CS YF A+FT  +   ++  + + G+ S          
Sbjct: 38  CDVVLQVEK-KEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLASDTMEVLLDFV 96

Query: 435 XXXXIDVTDTNVHELLMTA 491
               + V+  NV  LL  A
Sbjct: 97  YTETVKVSVENVQALLPAA 115


>UniRef50_UPI0000F1DB4D Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 621

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 27/72 (37%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC  +   ++  NC+GI  FA    C +LE  +  Y+ ++F TV +Q +EFL L  
Sbjct: 149 VREACCRFMERQMDEMNCVGIHCFAEAHSCRELERRSMEYIQQHFSTV-SQQEEFLSLCG 207

Query: 692 DELNSIILEDEL 727
           D+L  II  D L
Sbjct: 208 DKLIEIISSDHL 219



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/90 (28%), Positives = 42/90 (46%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           ++ R+++A   +     G  FP HR +L++ S YF A+F+T L    Q  V I+GV    
Sbjct: 55  NSLRLNNAFCDVTLCCGGQEFPCHRIVLASFSSYFQAMFSTDLMESRQERVAINGVEPQM 114

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTADYL 500
                       + ++  NV  LL  A+ L
Sbjct: 115 IGMLVSYAYTAEVVISKANVQALLAAANLL 144


>UniRef50_UPI0000588104 Cluster: PREDICTED: similar to actin-binding
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to actin-binding protein -
           Strongylocentrotus purpuratus
          Length = 583

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           F  HR +LSACSPYF AL T+ L    Q  + I GV+               +DVT +N 
Sbjct: 41  FQAHRLVLSACSPYFDALLTSGLSETHQDVINIQGVQPNIFEHLLGFIYTGHLDVTTSNA 100

Query: 471 HELLMTAD 494
             LL  AD
Sbjct: 101 QGLLFAAD 108


>UniRef50_UPI0000587F3A Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 886

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/68 (38%), Positives = 40/68 (58%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C    R  L+ +NC+GI+ FA+   C +L   A  ++L YF  +   +D+FL L +D+L 
Sbjct: 429 CSQFFRDQLDVQNCVGIINFAKLYSCDQLFDHAFLFILTYFKDIML-TDDFLLLTVDQLA 487

Query: 704 SIILEDEL 727
           S IL+D L
Sbjct: 488 SFILDDRL 495



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/81 (29%), Positives = 42/81 (51%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D I+  ++ A FP HR+++ A SPYF A+FT+ +    + +V + G+RS           
Sbjct: 341 DLILSVEEVA-FPSHRSVMVAVSPYFRAMFTSGMREIREEEVELKGIRSDIFGILLDFIY 399

Query: 438 XXXIDVTDTNVHELLMTADYL 500
              + + + N  E+L  A +L
Sbjct: 400 TCRLAINEDNAQEMLEMASFL 420


>UniRef50_A7RGT6 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 552

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  +DG     H+ +LSA S YF A+F T +   +Q  + I  + S          
Sbjct: 26  CDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLVEFA 85

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
               + +   NV  LL  A  L F+     C+ F+
Sbjct: 86  YTSNVRINSENVETLLYAASMLQFVRVEKACYEFL 120


>UniRef50_Q8NFY9 Cluster: Kelch repeat and BTB domain-containing
           protein 8; n=22; Euteleostomi|Rep: Kelch repeat and BTB
           domain-containing protein 8 - Homo sapiens (Human)
          Length = 601

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/78 (33%), Positives = 38/78 (48%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D +V  D G +F  HR +L+A SPYF ++FT+ L    Q +V I GV +           
Sbjct: 50  DIVVEVDHGKTFSCHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAY 109

Query: 438 XXXIDVTDTNVHELLMTA 491
              + +T+ NV  L   A
Sbjct: 110 TSRVILTEANVQALFTAA 127



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +   C  ++ S L+P+N +G+  FA      +L   ++ Y+ + F+ V T+  EFL
Sbjct: 131 QIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCV-TKEQEFL 189

Query: 680 HLPLDELNSIILEDEL 727
            L  D+L SI+  D+L
Sbjct: 190 QLTKDQLISILDSDDL 205


>UniRef50_UPI0000586FE1 Cluster: PREDICTED: similar to GA19454-PA;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA19454-PA - Strongylocentrotus purpuratus
          Length = 595

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 27/72 (37%), Positives = 37/72 (51%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V  LC D L++ L+P NCLG   FA    C++L   A  ++   F  V    DEFL L  
Sbjct: 148 VTNLCSDFLKTQLHPTNCLGFRNFASMHGCFELSEAADTFIQLNFTKVVAH-DEFLQLST 206

Query: 692 DELNSIILEDEL 727
            +L  +I +D L
Sbjct: 207 KDLIKLIEKDSL 218



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 29/96 (30%), Positives = 42/96 (43%)
 Frame = +3

Query: 192 RSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           R  H  G  +   S    +  CD ++  D     P HR +LSA SPYF A+FT+ L    
Sbjct: 42  RQQHALGMLSVIQSLQDQNHLCDVVLSVDSKL-IPAHRLVLSAFSPYFHAMFTSQLKESR 100

Query: 372 QSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           Q  V + G+ +              ID+T+ NV  +
Sbjct: 101 QEVVELQGMNAEAIEAIVKFAYRATIDITEDNVQSI 136


>UniRef50_Q4RMP4 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 621

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 26/73 (35%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CCD L   + P N +GI  FA  + C +L    R Y+  +F  V T+ +EF  L  
Sbjct: 140 VAKACCDFLTKHVEPANVIGIARFAEEIGCCELHCWCREYINTHFSEV-TKEEEFFSLSH 198

Query: 692 DELNSIILEDELK 730
            +L  +I +D LK
Sbjct: 199 CQLLELISQDSLK 211



 Score = 37.9 bits (84), Expect = 0.33
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +3

Query: 255 CDAIVRA---DDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD ++     D    F VH+ +L++CS YF A+FT++      S+V +  V
Sbjct: 51  CDLVLHVTHKDRTVDFKVHKVVLASCSQYFRAMFTSSFRECSASEVTLRDV 101


>UniRef50_Q9UJP4 Cluster: Kelch-like protein 21; n=21;
           Euteleostomi|Rep: Kelch-like protein 21 - Homo sapiens
           (Human)
          Length = 539

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 36  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 95

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 96  TGRVAVSGDNAEPLLRAADLLQF 118



 Score = 41.5 bits (93), Expect = 0.027
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 115 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 174

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 175 --RLPLARLLRYLRDDGL 190


>UniRef50_A7T3P4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 585

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 26/80 (32%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   + + C + L   L+P NCLGI +FA    C  L   + +++  YF  V  ++
Sbjct: 124 SSLFQLNAIQKACSEFLERQLHPSNCLGIRSFADAHSCVGLLHASEKFINEYFSDV-VKN 182

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +EL  ++  ++L
Sbjct: 183 EEFLLLPQEELAVLLSSEDL 202



 Score = 33.9 bits (74), Expect = 5.5
 Identities = 20/76 (26%), Positives = 32/76 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  D+      HR +L++ S YF A+FT  L    +  V +  V S          
Sbjct: 47  CDVTLCVDE-RQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVELLVDFA 105

Query: 435 XXXXIDVTDTNVHELL 482
               +D+T  NV  ++
Sbjct: 106 YTGKLDITTENVQSIM 121


>UniRef50_A7RJJ1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 530

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 40/82 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +    +G  FP HR +L+A S YF  LFT+ +  +    V +  +R+          
Sbjct: 9   CD-VTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 67

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ N  +L+ +A+YL
Sbjct: 68  YTGEITVTELNAEDLIASANYL 89


>UniRef50_Q4RJL3 Cluster: Chromosome 3 SCAF15037, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 3
           SCAF15037, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 629

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/72 (36%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC  +   ++  NC+GI  FA    C  LE  +  Y+L +F  V  Q +EFL L +
Sbjct: 140 VREACCRFMERQMDEMNCVGIHCFAEAHSCKVLEKRSMEYILEHFSGVHKQ-EEFLSLCV 198

Query: 692 DELNSIILEDEL 727
           D+L  I+  D L
Sbjct: 199 DKLTEILASDFL 210



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/90 (28%), Positives = 43/90 (47%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           ++ R+++A   +     G  FP HR +L++ S YF A+F+T L   +Q  V I+GV    
Sbjct: 46  NSLRLNNAFCDVTLCCGGQEFPCHRIVLASFSSYFQAMFSTDLIESKQERVAINGVEPQM 105

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTADYL 500
                       + ++  NV  LL  A+ L
Sbjct: 106 IGMLVSYAYTSEVYISKANVQALLAAANLL 135


>UniRef50_UPI0001554EC3 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 414

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/80 (33%), Positives = 34/80 (42%)
 Frame = +3

Query: 267 VRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXX 446
           + A  G  FP HRA+L+A SPYF A+F   L       V + GV                
Sbjct: 275 LEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSYTGR 334

Query: 447 IDVTDTNVHELLMTADYLAF 506
           + V+  N   LL  AD L F
Sbjct: 335 VAVSGDNAEPLLRAADLLQF 354


>UniRef50_A7RP55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 569

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  L   L+  NCLGI  FA    C  L   A++++   F +V  Q +EFL LP 
Sbjct: 117 VKDACCQFLSDQLDYSNCLGISKFAEAFTCQTLVKKAKKFIQDNFRSVVEQ-EEFLLLPY 175

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 176 SHVTELLEDDNL 187



 Score = 40.7 bits (91), Expect = 0.047
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR +LSACS YF A+FT  L   ++  + I G+                 ++T  NV  L
Sbjct: 46  HRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDETALQLLVDFAYTGKAEITQENVQLL 105

Query: 480 LMTADYL 500
           L  A+ L
Sbjct: 106 LPAANML 112


>UniRef50_A7SRT7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 599

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD I+ AD+G   FP HRA+L+A S YF  L+  T  +R   + ++SG+           
Sbjct: 40  CDVIILADNGCRRFPAHRAVLAASSRYFHKLYNGTTLARYSRETILSGICDRELETVVHY 99

Query: 432 XXXXXIDVTDTNVHELLMTADYLAF----LECFSFVAIISEVH*TQKTVLEL*LLQGVFS 599
                + +   NV  LL  A  L      L C  +  ++  VH   +  +EL +L  ++S
Sbjct: 100 IYTSEVCIDGDNVRALLHAAYNLGLDLLTLACEKY--LVENVH--HENSIELMVLAQMYS 155


>UniRef50_A7SP59 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 471

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 23/82 (28%), Positives = 43/82 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  ++   F  H+ IL+A S YF+A+FTT +  +EQ  V++  ++           
Sbjct: 41  CDVVLLVEN-EEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFL 99

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I++ + NV +LL  + +L
Sbjct: 100 YTGRIEIDNKNVRDLLEASSFL 121


>UniRef50_A7S474 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 187

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L  F  V + CC+ LR  L   N + IM  A      +L+ D ++Y+LR F+ +   ++ 
Sbjct: 106 LQGFQFVEESCCNFLRLGLKETNAVDIMRIADTYSLQELKKDTKKYILRNFIKI-LDTEH 164

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ +P+  L  +I ED L
Sbjct: 165 FIGVPVTVLAELISEDSL 182


>UniRef50_O93567 Cluster: Zinc finger and BTB domain-containing
           protein 7; n=3; Amniota|Rep: Zinc finger and BTB
           domain-containing protein 7 - Gallus gallus (Chicken)
          Length = 546

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+ L   +Q+   I  V +          
Sbjct: 34  CDVVILVE-GQEFPTHRSVLAACSQYFKKLFTSGLVVDQQNVYEIDFVSADALSALLEFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+ +NV+++L  A  L
Sbjct: 93  YTATLTVSTSNVNDILNAAKLL 114


>UniRef50_UPI000065E579 Cluster: Kelch-like protein 24 (Protein
           DRE1).; n=1; Takifugu rubripes|Rep: Kelch-like protein
           24 (Protein DRE1). - Takifugu rubripes
          Length = 623

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 29/68 (42%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA      +L    R Y L  F  VA Q +EFL L  +EL 
Sbjct: 113 CAKFLEDQLDPCNCLGIQRFAEAHSLKQLAGRCRTYTLANFSEVA-QHEEFLDLHKEELE 171

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 172 EYIGSDEL 179



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 24/76 (31%), Positives = 34/76 (44%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V +  G  FP HRA+LSACS YF A+F        +  V I+G+ +             
Sbjct: 26  VVISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMDSFLTYVYTG 85

Query: 444 XIDVTDTNVHELLMTA 491
              +T  NV  L  T+
Sbjct: 86  RAKITTENVQFLFETS 101


>UniRef50_A7RT28 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 450

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 22/82 (26%), Positives = 38/82 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CDA+++   G + PVH+ +L A SP+F  LFT  +  + Q  + +  +            
Sbjct: 14  CDAVIQIG-GKTHPVHKNVLCAASPFFRGLFTNDMQEKNQEHIELQVISGDVGEEVISFM 72

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I V   N  +++M  D+L
Sbjct: 73  YTGAIKVEKENAQDIVMAGDFL 94


>UniRef50_A7S2N5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 571

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P + QL  D L  +L   NCL I+  A +     L+ +A+RY L  F TV +Q++EF  L
Sbjct: 109 PKLKQLGIDFLSHNLTSANCLSILAIAEKFNFQTLKDNAQRYTLEQFGTV-SQAEEFERL 167

Query: 686 PLDELNSIILEDEL 727
            +++L +II  D+L
Sbjct: 168 NVEQLLAIISCDDL 181



 Score = 41.5 bits (93), Expect = 0.027
 Identities = 22/82 (26%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  ++   F  HR IL+A SPYF ALFT+ +   + +++ ++ V            
Sbjct: 26  CDVTLNVNE-VLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V ++    L + ADY+
Sbjct: 85  YSGSVVVEESKAIPLTVAADYM 106


>UniRef50_Q8IXQ5 Cluster: Kelch-like protein 7; n=28;
           Euteleostomi|Rep: Kelch-like protein 7 - Homo sapiens
           (Human)
          Length = 586

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V ++C D L+  ++  NCLGI   A  + C +L+A A  ++ ++F T   ++DEFL L +
Sbjct: 129 VKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHF-TEVYKTDEFLQLDV 187

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 188 KRVTHLLNQDTL 199



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 21/80 (26%), Positives = 32/80 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +L+A S +F  +FTT +   +  +V +               
Sbjct: 44  CDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFA 102

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I V   NV  LL  A+
Sbjct: 103 YTARISVNSNNVQSLLDAAN 122


>UniRef50_Q96M94 Cluster: Kelch-like protein 15; n=21;
           Euteleostomi|Rep: Kelch-like protein 15 - Homo sapiens
           (Human)
          Length = 604

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 27/110 (24%), Positives = 47/110 (42%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           S+H     AG  +        D  +  +D   F  H+A+L+  S YF  +FT  +  R+Q
Sbjct: 11  SIHDTSVSAGFRALYEEGLLLDVTLVIEDH-QFQAHKALLATQSDYFRIMFTADMRERDQ 69

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFLECFSF 524
             + + G+ +              I+++   VHE+L  A Y+  +E   F
Sbjct: 70  DKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKF 119


>UniRef50_O60662 Cluster: Kelch repeat and BTB domain-containing
           protein 10; n=44; Euteleostomi|Rep: Kelch repeat and BTB
           domain-containing protein 10 - Homo sapiens (Human)
          Length = 606

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++A D  S P HR ILSACSPYF   F + +   ++ +V++  V             
Sbjct: 34  DCTLKAGD-KSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLY 92

Query: 438 XXXIDVTDTNVHELLMTA 491
              ID+ D NV ++   A
Sbjct: 93  SASIDLNDGNVQDIFALA 110


>UniRef50_Q4T3G1 Cluster: Chromosome undetermined SCAF10082, whole
           genome shotgun sequence; n=18; Euteleostomi|Rep:
           Chromosome undetermined SCAF10082, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 746

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LCC  L S +  +NC+GI  F+ R   + +   A  +L  +F  VA +++EF  LP ++L
Sbjct: 125 LCCQFLESCITAENCIGIRLFSLRYCLHHVHYVATEFLQTHFGEVA-RAEEFRELPAEQL 183

Query: 701 NSIILEDEL 727
             ++  ++L
Sbjct: 184 RELLAMEKL 192


>UniRef50_Q0D2K2 Cluster: Kelch-like protein 30; n=23;
           Euteleostomi|Rep: Kelch-like protein 30 - Homo sapiens
           (Human)
          Length = 578

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           FP V ++C  +L+  L+  NCLGI  F  +     + A A  +L   F  VA + DEFL 
Sbjct: 115 FPSVQKVCGRYLQQQLDAANCLGICEFGEQQGLLGVAAKAWAFLRENFEAVA-REDEFLQ 173

Query: 683 LPLDELNSIILEDELK 730
           LP + L + +  D L+
Sbjct: 174 LPRERLVTCLAGDLLQ 189



 Score = 33.5 bits (73), Expect = 7.2
 Identities = 21/75 (28%), Positives = 28/75 (37%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G   P HR +L+  SPYF A+F         + V +  V                + +T 
Sbjct: 41  GRELPCHRGLLALSSPYFHAMFAGDFAESFSARVELRDVEPAVVGQLVDFVYTGRLTITQ 100

Query: 462 TNVHELLMTADYLAF 506
            NV  L  TA  L F
Sbjct: 101 GNVEALTRTAARLHF 115


>UniRef50_Q2TBA0 Cluster: Kelch repeat and BTB domain-containing
           protein 5; n=16; Euteleostomi|Rep: Kelch repeat and BTB
           domain-containing protein 5 - Homo sapiens (Human)
          Length = 621

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +  +C   L+  L   NCL +      + C +L   AR ++  +F  VA  +D FL
Sbjct: 112 QIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDAD-FL 170

Query: 680 HLPLDELNSIILEDEL 727
            L  DEL +II  D L
Sbjct: 171 GLSADELIAIISSDGL 186



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D +VRA +   FP HR +L+ACSPYF A F
Sbjct: 34  DCVVRAGE-REFPCHRLVLAACSPYFRARF 62


>UniRef50_UPI0000D56F9D Cluster: PREDICTED: similar to CG1812-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG1812-PA, isoform A - Tribolium castaneum
          Length = 617

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  F  H+A+LSACS YF A+FT  +    Q ++ ++G+ +              I + 
Sbjct: 50  EGQLFKAHKAVLSACSDYFRAMFTNNMLESRQDEICLNGITAVGFHQILEYAYTSRIMLN 109

Query: 459 DTNVHELLMTADYL 500
             N+ ++L  A ++
Sbjct: 110 LGNIQDVLEAASHI 123


>UniRef50_Q4SHR8 Cluster: Chromosome 5 SCAF14581, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 5 SCAF14581, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 209

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/68 (36%), Positives = 35/68 (51%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC+ L   L  +NC+ I    +  FC   E  A +++L  F +V T S EF  L ++ L 
Sbjct: 104 CCNFLGDMLCTENCISIYQLTKYHFCIPHEQKAYKFILNNFESVET-SKEFPQLEMENLC 162

Query: 704 SIILEDEL 727
           SII  D L
Sbjct: 163 SIIASDHL 170



 Score = 40.3 bits (90), Expect = 0.063
 Identities = 25/81 (30%), Positives = 37/81 (45%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           DA+++  D   FP+H+ I+  CS  F ALF       ++S  +I  +             
Sbjct: 17  DAVIQVQD-VKFPIHKIIMCKCSSVFRALFIRWSRP-DESHFVIMELSPAMMQLIIEFAY 74

Query: 438 XXXIDVTDTNVHELLMTADYL 500
              I VT+  V ELL TA +L
Sbjct: 75  TNNIPVTEKTVRELLQTAGFL 95


>UniRef50_A7SD21 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 582

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/83 (25%), Positives = 42/83 (50%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S CD  +  + G +F  HR +L+A SP+F  LFTT +  ++++ +++  V++        
Sbjct: 32  SLCDVDLMVE-GLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLE 90

Query: 429 XXXXXXIDVTDTNVHELLMTADY 497
                   +   N  +L+++A Y
Sbjct: 91  YLYTGKTSLNPENAEDLVVSASY 113



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 20/71 (28%), Positives = 37/71 (52%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+ +   + +RSSLN  NC+ +  FA +  C  L   AR ++ ++F  +    +EFL L 
Sbjct: 118 GLKEKASNFIRSSLNVDNCIQVREFAEKHDCKSLSLAARVFIGQHFGEI-INGEEFLGLE 176

Query: 689 LDELNSIILED 721
            +++   I  +
Sbjct: 177 FEKIEEFIASE 187


>UniRef50_Q9H620 Cluster: CDNA: FLJ22673 fis, clone HSI10503; n=3;
           Catarrhini|Rep: CDNA: FLJ22673 fis, clone HSI10503 -
           Homo sapiens (Human)
          Length = 403

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 23/59 (38%), Positives = 29/59 (49%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDEL 212


>UniRef50_Q6TFL4 Cluster: Kelch-like protein 24; n=27;
           Euteleostomi|Rep: Kelch-like protein 24 - Homo sapiens
           (Human)
          Length = 600

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL 
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDELI 213

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 214 DYICSDEL 221


>UniRef50_Q8IY47 Cluster: Kelch repeat and BTB domain-containing
           protein 2; n=33; Euteleostomi|Rep: Kelch repeat and BTB
           domain-containing protein 2 - Homo sapiens (Human)
          Length = 623

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VLQ C ++L   +N +NC+ +++FA    C +L+  A+R +   F  V  Q D F+ L  
Sbjct: 116 VLQRCREYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYHQ-DAFMQLSH 174

Query: 692 DELNSIILEDEL 727
           D L  I+  D L
Sbjct: 175 DLLIDILSSDNL 186



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           IV   +G  FP H+ +L+ CS YF A+F + L   +Q+ V +  V +             
Sbjct: 33  IVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTG 92

Query: 444 XIDVTDTNVHELLMTADYL 500
            + + D+ V +L  TA +L
Sbjct: 93  NLAMNDSTVEQLYETACFL 111


>UniRef50_O14682 Cluster: Ectoderm-neural cortex protein 1; n=59;
           cellular organisms|Rep: Ectoderm-neural cortex protein 1
           - Homo sapiens (Human)
          Length = 589

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.036
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>UniRef50_UPI0000E45D41 Cluster: PREDICTED: similar to KIAA1378
           protein isoform 2; n=4; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to KIAA1378 protein
           isoform 2 - Strongylocentrotus purpuratus
          Length = 603

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEF 676
           V + C D ++  L+P NCLG+ TFA +  C  L   A  Y   +F+ V +Q + F
Sbjct: 169 VSKACSDFMKCHLHPSNCLGVRTFADQHGCTTLSGAADSYAHEHFLEVVSQEEYF 223



 Score = 39.9 bits (89), Expect = 0.083
 Identities = 22/87 (25%), Positives = 37/87 (42%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           +  + CD  +R    +SF  HR +L+ACSPYF A+F + +       + +  +       
Sbjct: 79  KTKALCDFTLRCG-ASSFLCHRLVLAACSPYFRAMFMSEMIESRHDSLEVQDIDEKSLEA 137

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    I +T  NV ++L     L
Sbjct: 138 IVEFMYTSKIVLTVDNVQKILFAGSLL 164


>UniRef50_UPI0000589070 Cluster: PREDICTED: similar to MGC80367
           protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC80367 protein -
           Strongylocentrotus purpuratus
          Length = 643

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 27/100 (27%), Positives = 51/100 (51%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C  +L S L  +NC+GI+  +R+    +LE D   +++  F+ VA +  EF  L  
Sbjct: 140 VINICSQYLTSVLAVENCIGILHLSRKFGFKELEQDVHEFIVDNFLIVA-ERPEFQSLKY 198

Query: 692 DELNSIILEDELKR*K*GSSFGNPFAVGXINDSRRSDWQH 811
           D++   + +D +        FG   A   IN  +++ ++H
Sbjct: 199 DDMCFFLKQDRMAIGSEFELFG--IAARWINHDKQTRFRH 236



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+ G  F VHRA+L++CS YF A++    + R+    L S +            
Sbjct: 57  CDGNIIAN-GNHFAVHRAVLASCSEYFRAIYLENDNVRDVQ--LHSNISKESLELLLHYA 113

Query: 435 XXXXIDVTDTNVHELLMTA 491
               I++T  NVH+++  A
Sbjct: 114 YTSQIELTLENVHKVVSGA 132


>UniRef50_UPI0000D8E0BB Cluster: hypothetical protein LOC559083;
           n=1; Danio rerio|Rep: hypothetical protein LOC559083 -
           Danio rerio
          Length = 453

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + C   L+  LNP+NCL ++  +  + C  L+  A+   +R F  VA  S++F  L L
Sbjct: 103 LFEACSTFLQEQLNPENCLSMIRLSEILHCETLKERAKEMAVRCFSDVAA-SEDFCELTL 161

Query: 692 DELNSIILEDEL 727
            EL   + +D L
Sbjct: 162 PELMCYLEDDRL 173



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 24/87 (27%), Positives = 36/87 (41%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D I+  +D    P HR +L + SPYF A+F +      Q+ V + G+ S           
Sbjct: 19  DVILCTED-KEIPCHRNVLVSSSPYFRAMFCSNFRESSQARVDLKGIASEVIECVVDYIY 77

Query: 438 XXXIDVTDTNVHELLMTADYLAFLECF 518
              I +T   V  L+  A  L +   F
Sbjct: 78  TGSITITMELVLPLMQAASMLQYGRLF 104


>UniRef50_UPI000065D9AB Cluster: Kelch repeat and BTB
           domain-containing protein 7.; n=1; Takifugu
           rubripes|Rep: Kelch repeat and BTB domain-containing
           protein 7. - Takifugu rubripes
          Length = 435

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +3

Query: 273 ADD-GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXI 449
           ADD G  F   R +LSA SPYF ++FT  L+   Q  V+I GV +              +
Sbjct: 56  ADDIGQLFLCSRNVLSAASPYFKSMFTGGLNESMQERVVIRGVDAESMSVIIDYCYTGRV 115

Query: 450 DVTDTNVHELLMTADYL 500
            +T++NV  L   A+ L
Sbjct: 116 TITESNVQRLYAAANML 132


>UniRef50_A5WUJ7 Cluster: Novel protein; n=1; Danio rerio|Rep: Novel
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 178

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 25/79 (31%), Positives = 34/79 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I++ D G   P H  IL+A + YF ALF   L       V + GV S          
Sbjct: 15  CDVIIQTDSGDRLPAHCVILAAGADYFRALFCGGLRESRAEVVFLRGVSSWILRDLLEFI 74

Query: 435 XXXXIDVTDTNVHELLMTA 491
               + ++ TNV +L   A
Sbjct: 75  YSGRLKLSSTNVWDLTEAA 93



 Score = 39.9 bits (89), Expect = 0.083
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G L+LC + LR +++  +CL I+  A       L   A  Y+L +F  V ++ ++F  LP
Sbjct: 100 GALELCLNFLRDNMDENSCLDILALAEAYSLEDLAKRAEDYVLAHFQRV-SEGEKFNDLP 158

Query: 689 LDELNSIILEDEL 727
             +L   +  D L
Sbjct: 159 CIQLKRFLDRDAL 171


>UniRef50_A0PK12 Cluster: C8ORFK36 protein; n=19; Euteleostomi|Rep:
           C8ORFK36 protein - Homo sapiens (Human)
          Length = 581

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD 670
           +FP + + C  +L+S L P NCLG++  +  + C  L+  AR   L  F  VA  +D
Sbjct: 115 QFPKLFEACSSYLQSQLAPSNCLGMIRLSEILSCETLKKKAREVALTSFPEVAASAD 171



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L++ SPYF A+F ++   + ++ V + G+                  +   NV 
Sbjct: 46  PCHRNVLASSSPYFRAMFCSSFREKSEAKVQLKGIDPPTLDQIVSYVYTGEARIATDNVL 105

Query: 474 ELLMTADYLAFLECF 518
            ++  A  L F + F
Sbjct: 106 PVMEAASMLQFPKLF 120


>UniRef50_UPI0000E48704 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 616

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  +RA D   FP HR +L+A SP+F AL T  +    ++   +    S           
Sbjct: 40  DMKLRAGD-TEFPCHRVVLAASSPFFRALLTGPMKEESRTTFDLQDTCSSTLSLLLDFMY 98

Query: 438 XXXIDVTDTNVHELLMTADYL 500
              + +T+ NV ++L++A+YL
Sbjct: 99  TGKLRITEENVQDVLVSANYL 119



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           ++  C D LR  L+ +NC  + +FA    C +L    +RY+LR  +  A+ S  FL    
Sbjct: 124 LVDACSDFLRRQLDFQNCFEMYSFADAHGCEELLRATQRYILRN-LPEASSSPAFLEAGF 182

Query: 692 DELNSIILEDEL 727
           ++L S++ ED L
Sbjct: 183 EQLRSLLGEDNL 194


>UniRef50_UPI0000EB1AED Cluster: Zinc finger and BTB
           domain-containing protein 7A (Leukemia/lymphoma- related
           factor) (Factor that binds to inducer of short
           transcripts protein 1) (Factor binding IST protein 1)
           (FBI-1) (HIV-1 1st-binding protein 1) (TTF-I-interacting
           peptide 21) (TIP21).; n=1; Canis lupus familiaris|Rep:
           Zinc finger and BTB domain-containing protein 7A
           (Leukemia/lymphoma- related factor) (Factor that binds
           to inducer of short transcripts protein 1) (Factor
           binding IST protein 1) (FBI-1) (HIV-1 1st-binding
           protein 1) (TTF-I-interacting peptide 21) (TIP21). -
           Canis familiaris
          Length = 517

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 34  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 93  YTATLTVSTANVGDILSAARLL 114


>UniRef50_Q4S1N2 Cluster: Chromosome 6 SCAF14768, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 6
           SCAF14768, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 598

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/82 (29%), Positives = 36/82 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A  G SFP HRA L++ S YF ALF  T   R    + +  +            
Sbjct: 28  CDVVLEAG-GVSFPCHRAFLASSSEYFWALFGETTAERFAGCIRLPALTPEGLEAILDFL 86

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + ++   +H +L  A YL
Sbjct: 87  YSGWLSISPATLHSVLQAARYL 108


>UniRef50_Q5D8N1 Cluster: SJCHGC06470 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06470 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 239

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 25/79 (31%), Positives = 35/79 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  D G     HR +L+ACS YF A+FT  L    Q++V +  +            
Sbjct: 149 CDVVLLVD-GREIYTHRVVLAACSAYFRAMFTGELAESRQTEVTLYDLDGDAVETLIDFC 207

Query: 435 XXXXIDVTDTNVHELLMTA 491
               I V + NV  LL  A
Sbjct: 208 YTSQITVEECNVQNLLPAA 226


>UniRef50_O95365 Cluster: Zinc finger and BTB domain-containing
           protein 7A; n=12; Mammalia|Rep: Zinc finger and BTB
           domain-containing protein 7A - Homo sapiens (Human)
          Length = 584

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 34  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 93  YTATLTVSTANVGDILSAARLL 114


>UniRef50_Q9P2J3 Cluster: Kelch-like protein 9; n=59;
           Euteleostomi|Rep: Kelch-like protein 9 - Homo sapiens
           (Human)
          Length = 617

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 143


>UniRef50_UPI00004D5576 Cluster: Kelch repeat and BTB domain
           containing protein 6.; n=1; Xenopus tropicalis|Rep:
           Kelch repeat and BTB domain containing protein 6. -
           Xenopus tropicalis
          Length = 554

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 24/75 (32%), Positives = 34/75 (45%)
 Frame = +3

Query: 276 DDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDV 455
           + G SF  +R ILSA  PYF ++FT  L+  +Q  V +  +                + V
Sbjct: 45  ESGRSFSCNRNILSAACPYFKSMFTGGLYESKQQQVTLHDMDPESMALIIDYCYTGRVTV 104

Query: 456 TDTNVHELLMTADYL 500
           T+ NV  L   AD L
Sbjct: 105 TEANVQRLYAAADML 119



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q C  +L   L+  NC  I+ FA      +L + +  ++ R+F  +A   DE   L L
Sbjct: 124 VRQACAGYLARRLDLHNCASILRFADAFDHPELRSRSLAFMSRHFEQLAV-GDELCELSL 182

Query: 692 DELNSIILEDEL 727
            +L  ++  D L
Sbjct: 183 AQLKEVLTMDNL 194


>UniRef50_Q4SNU3 Cluster: Chromosome 15 SCAF14542, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 15 SCAF14542, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 630

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 20/77 (25%), Positives = 38/77 (49%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP HR +L+A SP+F A+F + L   ++ ++++  V                I++T+ NV
Sbjct: 45  FPCHRLVLAASSPFFKAMFLSDLEESKKREIVLRDVEPGVMGMILRYLYTSDINLTEQNV 104

Query: 471 HELLMTADYLAFLECFS 521
            ++ + A+       FS
Sbjct: 105 QDIFIVANMYQIPSIFS 121


>UniRef50_Q4RUA8 Cluster: Chromosome 1 SCAF14995, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF14995, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 526

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  +     + L  +L+  NCLG+M  +    C +L   A R  L  F  +  ++++FL
Sbjct: 119 QFHDIRDAAAEFLEKNLHQSNCLGMMLLSDAHQCRRLYEPAWRMCLADFAAL-VKTEDFL 177

Query: 680 HLPLDELNSIILEDELK 730
            LP D++  +IL +EL+
Sbjct: 178 RLPGDKVQELILSEELE 194



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 1/110 (0%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D +++A  G SFP HRA+L++CS YF A+F+  L     ++V     +            
Sbjct: 38  DVLLKAG-GRSFPCHRAVLASCSRYFEAMFSGGLRESRDAEVDFHDSLHPEVLELLLDYA 96

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LL 584
               + + + N   LL   D L F +     A   E +  Q   L + LL
Sbjct: 97  YSARVIINEENAESLLEAGDMLQFHDIRDAAAEFLEKNLHQSNCLGMMLL 146


>UniRef50_Q9H511 Cluster: Kelch-like protein 31; n=25;
           Euteleostomi|Rep: Kelch-like protein 31 - Homo sapiens
           (Human)
          Length = 634

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 17/73 (23%), Positives = 45/73 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           ++++C D L   ++ +NC+ ++  A        +A A++++   F+  A +SD+F+ L  
Sbjct: 155 LVKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFA-ESDQFMKLTF 213

Query: 692 DELNSIILEDELK 730
           +++N ++++D+L+
Sbjct: 214 EQINELLIDDDLQ 226


>UniRef50_UPI00015B610E Cluster: PREDICTED: similar to
           ENSANGP00000012602; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012602 - Nasonia
           vitripennis
          Length = 567

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 24/86 (27%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+  +D  SFP HR IL+A   YF  L   +     +  + +  V +          
Sbjct: 51  CDVIIDVED-KSFPAHRIILAATIKYFQELILNSSDEETKVTISVKDVSAQSMESILTFA 109

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I +T+ N   LL+ AD+L   +
Sbjct: 110 YTGAITITEENAQTLLVDADHLGLTD 135


>UniRef50_UPI0000E817CF Cluster: PREDICTED: hypothetical protein;
           n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 528

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  V  LC   L   L+  NCLG+M +++R    +L A A    L ++  V +Q +EF 
Sbjct: 99  QFDRVKLLCEKFLERELHVSNCLGLMAYSQRFAFIELHASAMNVALTHWGDVVSQ-EEFK 157

Query: 680 HLPLDELNSIILEDEL 727
            LP + L   +  D+L
Sbjct: 158 ALPKETLMQFLRSDDL 173


>UniRef50_UPI0000DB7F94 Cluster: PREDICTED: similar to CG9426-PA,
           partial; n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG9426-PA, partial - Apis mellifera
          Length = 255

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 25/73 (34%), Positives = 34/73 (46%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G+    HR++L+A S YF A+FT  L   +Q  V I  V +              +D+T 
Sbjct: 101 GSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLVDFIYTGNVDITQ 160

Query: 462 TNVHELLMTADYL 500
            NV EL   AD L
Sbjct: 161 DNVQELFAAADML 173


>UniRef50_Q4SKB7 Cluster: Chromosome 13 SCAF14566, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 13
           SCAF14566, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 616

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+ A +      HRA+L+  SPYF A+FT  +    Q +V + GV            
Sbjct: 43  CDVILVAGN-QRVAAHRALLAVSSPYFHAMFTLGMKEERQEEVKLGGVSYAGLNTVVNFL 101

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + +   NV  +L TA +L
Sbjct: 102 YSGELPLDGGNVEHVLQTAHFL 123


>UniRef50_Q9W6R3 Cluster: Kelch protein; n=2; Takifugu rubripes|Rep:
           Kelch protein - Fugu rubripes (Japanese pufferfish)
           (Takifugu rubripes)
          Length = 531

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  L + L   NC+ I    +  FC +LE  A +++L  F  + +  +EF  L ++   
Sbjct: 63  CCTFLGNMLCADNCIDIYQLTKYNFCTQLEQKAYKFILNNFDLIES-GEEFFQLDMEHFC 121

Query: 704 SIILEDEL 727
           SII  D L
Sbjct: 122 SIIASDHL 129


>UniRef50_Q5C318 Cluster: SJCHGC07558 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC07558 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 218

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D I+ A D    P H+A+L+A S YFLA+F++    ++ S V +  +             
Sbjct: 34  DVILCAGD-EELPCHKAVLAASSAYFLAMFSSPYREQQTSRVKLDYISPWALRRLLDFAY 92

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              +++T+T V ++ + A  L +
Sbjct: 93  LGCLEITETTVQDVFLAASLLDY 115



 Score = 39.9 bits (89), Expect = 0.083
 Identities = 19/75 (25%), Positives = 38/75 (50%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           +P  ++ C D +++ L+  NCLGI   A       L   + +  +  F ++  +S+E+ +
Sbjct: 115 YPIAVKYCVDFMKNHLDVTNCLGIEALAEMHNLTDLAQSSHKLAVENFSSLLMESNEWTN 174

Query: 683 LPLDELNSIILEDEL 727
           LP+  + S +  D L
Sbjct: 175 LPISTVISYVSSDNL 189


>UniRef50_Q9HBE1 Cluster: POZ-, AT hook-, and zinc finger-containing
           protein 1; n=45; Tetrapoda|Rep: POZ-, AT hook-, and zinc
           finger-containing protein 1 - Homo sapiens (Human)
          Length = 687

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>UniRef50_Q5XKL5 Cluster: BTB/POZ domain-containing protein 8; n=34;
           Tetrapoda|Rep: BTB/POZ domain-containing protein 8 -
           Homo sapiens (Human)
          Length = 378

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 33/98 (33%), Positives = 41/98 (41%), Gaps = 1/98 (1%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V   C  I    DG  F  HRAILSA S YF A+ +       Q  V + G+        
Sbjct: 201 VKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVM 260

Query: 423 XXXXXXXXIDVTD-TNVHELLMTADYLAFLECFSFVAI 533
                   +D+ D TNV ++L  AD    LE    VAI
Sbjct: 261 MHFIYGGTLDIPDKTNVGQILNMADMYG-LEGLKEVAI 297


>UniRef50_UPI0000D55679 Cluster: PREDICTED: similar to CG14307-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG14307-PB, isoform B - Tribolium castaneum
          Length = 544

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 20/44 (45%), Positives = 25/44 (56%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           S  R  + CD +  A DG +F  H+ ILSACSPYF  +F    H
Sbjct: 27  SLLRREALCD-VTLACDGETFKAHQTILSACSPYFETIFIQNAH 69


>UniRef50_Q4RWB2 Cluster: Chromosome 2 SCAF14990, whole genome
           shotgun sequence; n=2; Clupeocephala|Rep: Chromosome 2
           SCAF14990, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 613

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = +3

Query: 276 DDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDV 455
           D G  F   R +LSA SPYF ++FT  L+   Q  V+I GV +              + +
Sbjct: 53  DVGRLFLCSRNVLSAASPYFQSMFTGGLNESMQERVVIRGVDAESMSVIIDYCYTGRVTI 112

Query: 456 TDTNVHELLMTADYL 500
           T+ NV  L   A+ L
Sbjct: 113 TEGNVQRLYAAANML 127


>UniRef50_Q16LA9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 581

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           DG  F  HRA+LSACS YF A+F+        S++ +  +                + + 
Sbjct: 23  DGKVFRAHRAVLSACSEYFRAMFSDHTRESRLSEIDLHNISPLGIELLLDYIYTSKLALN 82

Query: 459 DTNVHELLMTADYL 500
             N+ E+L  A Y+
Sbjct: 83  LANIQEVLSAASYI 96


>UniRef50_O61899 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 690

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 4/93 (4%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G+    HR IL+A SPYF A+FT  +   ++  + +  +                I +T 
Sbjct: 119 GSVIRAHRYILAAASPYFKAMFTNGMVEMKKLTIELQDIPEESVRIIVDYIYTDKIAITM 178

Query: 462 TNVHELLMTADYLAF----LECFSFVAIISEVH 548
            NVH+L+ TA  L      + C  F+A +   H
Sbjct: 179 NNVHQLIFTATVLQMDVIVVACQQFLATMITSH 211


>UniRef50_Q53GT1 Cluster: Kelch-like protein 22; n=29;
           Euteleostomi|Rep: Kelch-like protein 22 - Homo sapiens
           (Human)
          Length = 634

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 20/77 (25%), Positives = 42/77 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++  CCD L S ++ +N L +   A      +L      Y+L+ FV   +++D++ 
Sbjct: 131 QIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAF-SRTDKYR 189

Query: 680 HLPLDELNSIILEDELK 730
            LPL+++ S++  + L+
Sbjct: 190 QLPLEKVYSLLSSNRLE 206



 Score = 40.7 bits (91), Expect = 0.047
 Identities = 25/87 (28%), Positives = 37/87 (42%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G     HR +L+A   YF  +F   L   EQ +VLI GV               
Sbjct: 52  VVLVVEGRHIEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTS 111

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            ++++ +NV E L+ A  L   E   F
Sbjct: 112 ELELSLSNVQETLVAACQLQIPEIIHF 138


>UniRef50_UPI0000E482DD Cluster: PREDICTED: similar to Kelch-like 22
           (Drosophila), partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to Kelch-like 22
           (Drosophila), partial - Strongylocentrotus purpuratus
          Length = 629

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 18/78 (23%), Positives = 38/78 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P + Q C +  ++ L P  CL I+  A +    K++    +Y+   F+ +   S+++L
Sbjct: 159 KMPELKQYCAEQTKNLLKPDTCLNILRQAEKADSGKIKRSIEKYIAENFMLLVNSSEDYL 218

Query: 680 HLPLDELNSIILEDELKR 733
            +  D + +I   +E  R
Sbjct: 219 TISSDNIMAICQLEEFHR 236


>UniRef50_Q4T417 Cluster: Chromosome 1 SCAF9849, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 1
           SCAF9849, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 590

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = +3

Query: 222 GAPSTARVSSA-CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           G+ +  R+S   CD ++ A +   FP HRAIL++CS YF  LFT+   + +Q+   I  V
Sbjct: 75  GSLNKQRLSGQLCDVLLVAQE-QEFPAHRAILASCSSYFHKLFTSGAVADQQNVYNIDFV 133

Query: 399 RSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYL 500
            +              + V+ ++V ++L  A  L
Sbjct: 134 AAEALAALLDFAYTATLTVSHSSVADILAAAHLL 167


>UniRef50_Q9DHH3 Cluster: 140R protein; n=1; Yaba-like disease
           virus|Rep: 140R protein - Yaba-like disease virus (YLDV)
          Length = 570

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 20/74 (27%), Positives = 34/74 (45%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           DG     H+ IL++ S YF  +FT     +  +++ +SG+                +++ 
Sbjct: 31  DGKKIQAHKIILASVSDYFKKMFTDNFSEKNSNEINMSGIDFNSLSLLINFIYSGNLNIN 90

Query: 459 DTNVHELLMTADYL 500
            +NV  LL  ADYL
Sbjct: 91  QSNVEILLYKADYL 104


>UniRef50_Q9VK21 Cluster: CG9426-PA; n=6; Endopterygota|Rep:
           CG9426-PA - Drosophila melanogaster (Fruit fly)
          Length = 627

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE--QSDVLISGVRSXXXXX 419
           S  CD  + A   A+   HRA+LSA S YF A+F   L   E  Q  V++  +       
Sbjct: 80  SRFCDVEIIAGM-ATLSAHRAVLSAASAYFEAMFRPELGLNEVKQKSVVLHTIDGDILHI 138

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                     ++T +NV ELL  AD L   E
Sbjct: 139 LLDFIYTGRCEITQSNVQELLAAADMLQLNE 169



 Score = 41.1 bits (92), Expect = 0.036
 Identities = 28/74 (37%), Positives = 35/74 (47%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ L   L+  N LGI+ FA    C  L   A  ++   F  V T  DEFL  P 
Sbjct: 170 VVDGCCEFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANFPAV-TLEDEFLETP- 227

Query: 692 DELNSIILEDELKR 733
             L S +L  EL R
Sbjct: 228 QTLLSQLLNSELLR 241


>UniRef50_A7SS71 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 542

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 27/104 (25%), Positives = 43/104 (41%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           S+H G   +      +    CD  +  ++      H+A+L+A S YF A+FT  +     
Sbjct: 15  SLHPGCVLSRLQELRKNEELCDITLLVEN-KRITAHKAVLAATSRYFNAMFTGQMRESST 73

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAF 506
             V I GV S              + +TD NV  + + +D L F
Sbjct: 74  DLVEIHGVDSVSAELLINFAYTSRLRITDANVQNIFLASDLLQF 117



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 23/81 (28%), Positives = 38/81 (46%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +F      C D +   +   NCL I+  A R     L+  A   ++  F T   ++
Sbjct: 112 SDLLQFKSAKDACIDFIMRQIETSNCLRILALAERHGLKILKEAAFSVIMDNF-TEVVET 170

Query: 668 DEFLHLPLDELNSIILEDELK 730
           D+F +L   ++  I+L D+LK
Sbjct: 171 DDFKNLSTSQVIDILLRDDLK 191


>UniRef50_A7RQ26 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 520

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  ++  L   NC GI + A R  C ++      ++   FV  AT ++EFL LP 
Sbjct: 92  VTHACCKFIQERLTLANCWGIRSLADRYNCREMLKKVTSFIEENFVD-ATATEEFLSLPE 150

Query: 692 DELNSIILEDEL 727
           +E+  ++ ++++
Sbjct: 151 EEVCQLLSDNDI 162



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 21/80 (26%), Positives = 40/80 (50%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R  S    +V   DG  FP H+ IL+A S YF+A+F+  + + +++ V++  + S     
Sbjct: 2   RYHSILTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRT-VVVQEITSTAMEV 60

Query: 420 XXXXXXXXXIDVTDTNVHEL 479
                    + +T+ NV ++
Sbjct: 61  LLAFIYQGKLLITEENVEDI 80


>UniRef50_Q96CT2 Cluster: Kelch-like protein 29; n=41;
           Euteleostomi|Rep: Kelch-like protein 29 - Homo sapiens
           (Human)
          Length = 655

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 195 QFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQ-EEIL 253

Query: 680 HLPLDELNSIILEDEL 727
            +  D+  + +  D L
Sbjct: 254 SISKDDFIAYVSNDSL 269


>UniRef50_UPI0000E4A3E6 Cluster: PREDICTED: hypothetical protein,
           partial; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 1139

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTV------ATQSDEFLHL 685
           C D ++  L+P NCLGI T A R  C +L     ++ +R F +V        QS E +  
Sbjct: 148 CVDFMKEHLHPSNCLGIYTLAERFSCDELAGKVWKFAVRNFRSVRKHREILDQSFEMIEK 207

Query: 686 PLDELNSIILEDE 724
            L   N +I E+E
Sbjct: 208 YLSTDNLVIEEEE 220



 Score = 40.3 bits (90), Expect = 0.063
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP HR +L++ SPYF  +F + +   + S V + G+R+              ++ +  NV
Sbjct: 70  FPCHRNVLASVSPYFHRMFCSNMQESKLSSVSLQGIRADSVALILDFAYTSRMNFSKENV 129

Query: 471 HELLMTADYL 500
             +L  AD L
Sbjct: 130 PLILEAADML 139


>UniRef50_A7RZR4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 655

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 21/85 (24%), Positives = 41/85 (48%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD I++ + G  +PVHR +L+A SP+F  +F + +    Q  + +  +++       
Sbjct: 50  SGFCDVILQVE-GRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESIL 108

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  I + +  + +LL  A +L
Sbjct: 109 EFFYTQEIVLEEDELLDLLDAASFL 133



 Score = 37.9 bits (84), Expect = 0.33
 Identities = 20/74 (27%), Positives = 39/74 (52%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P +     + L S L+  NC  I   A +     L ++A  ++   FV ++  S+EF++L
Sbjct: 136 PALTDAIIELLSSILSVDNCFSIRMIASKYNAKDLLSNADGFIKGNFVYLSLWSNEFIYL 195

Query: 686 PLDELNSIILEDEL 727
           P +E+ ++I  D++
Sbjct: 196 PCEEICNVISGDDI 209


>UniRef50_A7RKJ4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 278

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 22/82 (26%), Positives = 36/82 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  + G  FP HRA+L+A   +F  LF + +    Q+ V +  +            
Sbjct: 36  CDVTIVVN-GREFPAHRAVLAASGGFFAGLFASNMQENSQNIVNLGEIDPEVTEDVLTFI 94

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I++T  N   +L  AD+L
Sbjct: 95  YTGQIELTTENAVAILKAADFL 116


>UniRef50_Q8NAB2 Cluster: Kelch repeat and BTB domain-containing
           protein 3; n=27; Euteleostomi|Rep: Kelch repeat and BTB
           domain-containing protein 3 - Homo sapiens (Human)
          Length = 608

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L+ACS +F A+F   +  R+   V I+ + S                +TD NV 
Sbjct: 60  PCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVE 119

Query: 474 ELLMTADYL 500
                + +L
Sbjct: 120 MFFQLSSFL 128


>UniRef50_UPI00004D80C2 Cluster: UPI00004D80C2 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00004D80C2 UniRef100 entry -
           Xenopus tropicalis
          Length = 422

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L + L   NCLG+MT++++  C +L + A    L +F  +   ++EF  L  + L 
Sbjct: 112 CAGFLANELRVSNCLGMMTYSQQYNCPELYSSALNVALTHFSELYINAEEFTQLDKETLF 171

Query: 704 SIILEDEL 727
            ++ + +L
Sbjct: 172 KLLQKSDL 179


>UniRef50_Q4T2F4 Cluster: Chromosome undetermined SCAF10277, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF10277,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 734

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 21/42 (50%), Positives = 25/42 (59%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV 383
           D  +RA  G SFP HRA+L+ACS YF A+F   L      DV
Sbjct: 47  DVTLRAG-GRSFPCHRAVLAACSQYFQAMFGGGLRESLDQDV 87


>UniRef50_Q4SD02 Cluster: Chromosome 14 SCAF14646, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14
           SCAF14646, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 642

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 22/76 (28%), Positives = 39/76 (51%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 304 QFNTFCKVCVSFLEKQLTAVNCLGVLAMAEAMSCTELHNMAKAFALQNFPEVAGQ-EEIL 362

Query: 680 HLPLDELNSIILEDEL 727
           ++  ++L + +  D L
Sbjct: 363 NVSKEDLVTYLSNDSL 378


>UniRef50_Q9YMC6 Cluster: MA55; n=3; Leporipoxvirus|Rep: MA55 -
           Myxoma virus
          Length = 553

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 25/89 (28%), Positives = 41/89 (46%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           ++ CD  +  DD  S   H+ ILSA S YF  +F+     ++++ + +  V         
Sbjct: 20  TTLCDVTLVTDDDVSIHAHKLILSASSTYFEYMFSHDFIEKDRNVINVC-VEYRALLHLI 78

Query: 426 XXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                  + +TD  V  +L+ ADYL  LE
Sbjct: 79  NFIYSGTLRLTDDTVDCILVAADYLQILE 107


>UniRef50_Q9H2C0 Cluster: Gigaxonin; n=5; Eutheria|Rep: Gigaxonin -
           Homo sapiens (Human)
          Length = 597

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LCC+ L   +  +NC+GI  FA     + +   A  YL  +F  V++ ++EFL L   +L
Sbjct: 120 LCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSS-TEEFLELSPQKL 178

Query: 701 NSIILEDEL 727
             +I  ++L
Sbjct: 179 KEVISLEKL 187


>UniRef50_UPI00015B5D8B Cluster: PREDICTED: similar to actin-binding
           protein ipp; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to actin-binding protein ipp - Nasonia
           vitripennis
          Length = 615

 Score = 40.7 bits (91), Expect = 0.047
 Identities = 24/74 (32%), Positives = 33/74 (44%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR++L+A S YF A+FT  L   +Q  V I  +                +++T  NV EL
Sbjct: 107 HRSVLAASSAYFNAMFTGGLVEEQQELVEIHSISENILSILIDFIYTGNVNITQDNVQEL 166

Query: 480 LMTADYLAFLECFS 521
              AD L   E  S
Sbjct: 167 FAAADMLELDEVVS 180


>UniRef50_UPI00015A49F0 Cluster: UPI00015A49F0 related cluster; n=1;
           Danio rerio|Rep: UPI00015A49F0 UniRef100 entry - Danio
           rerio
          Length = 444

 Score = 40.7 bits (91), Expect = 0.047
 Identities = 22/76 (28%), Positives = 38/76 (50%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F     LC   L    +  NCL +++FA      +L A A  ++LR+F  V+  + +F 
Sbjct: 71  QFQTAFSLCTKFLHQETDAHNCLDVVSFAEAYGMPELHAFANDFVLRHFQDVSI-TPKFQ 129

Query: 680 HLPLDELNSIILEDEL 727
            LP+++L   +  D L
Sbjct: 130 DLPVEKLKKYLQSDSL 145


>UniRef50_UPI0000614A22 Cluster: Kelch repeat and BTB
           domain-containing protein C16orf44.; n=1; Bos
           taurus|Rep: Kelch repeat and BTB domain-containing
           protein C16orf44. - Bos Taurus
          Length = 555

 Score = 40.7 bits (91), Expect = 0.047
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD+    P HR +L+ CS YF ++FT  +    Q +V + G             
Sbjct: 46  CDVVLVADE-QRLPAHRNLLAVCSDYFNSMFTLGMREAFQKEVELIGASYIGLKAVVDFL 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSV 602
               + +   N+  +L TA  L       F     E   ++   L L  L  ++S+
Sbjct: 105 YGGELVLDGGNIDYVLETAHLLQIWTAVDFCCEYLEQEVSEDNYLYLQELASIYSL 160


>UniRef50_Q7PTI4 Cluster: ENSANGP00000017144; n=3;
           Endopterygota|Rep: ENSANGP00000017144 - Anopheles
           gambiae str. PEST
          Length = 585

 Score = 40.3 bits (90), Expect = 0.063
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 9/91 (9%)
 Frame = +3

Query: 255 CDA-IVRADDGASFPVHRAILSACSPYFLA--------LFTTTLHSREQSDVLISGVRSX 407
           CDA IV  D+G  F +HR I+ +CS YF          LFTT++ S E+  V I G+   
Sbjct: 14  CDASIVLPDNGHEFRIHRVIVGSCSEYFRTGSPIIFSILFTTSVPS-EKYHVEIPGIPGS 72

Query: 408 XXXXXXXXXXXXXIDVTDTNVHELLMTADYL 500
                         ++T+  V ++   AD+L
Sbjct: 73  IMEQIIRYAYLRECELTEDTVFDVYAAADFL 103


>UniRef50_A7SR57 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 512

 Score = 40.3 bits (90), Expect = 0.063
 Identities = 20/82 (24%), Positives = 37/82 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++      FP H+ +L+A S YF ALFTT +  +   ++ +  + +          
Sbjct: 2   CDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLD-ISTRTLKAILKYV 60

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + +  +N   + + ADYL
Sbjct: 61  YCGDVSLNVSNARSVFVAADYL 82


>UniRef50_A7RFM5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 588

 Score = 40.3 bits (90), Expect = 0.063
 Identities = 20/76 (26%), Positives = 34/76 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++A +      HR +L++CS YF ++FT ++    Q  + I G+            
Sbjct: 34  CDVTIKAGE-RKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVIQLINFM 92

Query: 435 XXXXIDVTDTNVHELL 482
               I +T  N+  LL
Sbjct: 93  YTRKITITIDNIESLL 108



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ ++  L+  NCL +  +A    C +    A ++    F T+ + +D FL L  
Sbjct: 119 VVYACCEFMKRHLHVSNCLEMRAYAELHGCIEFIHFADKFARGCFTTLVS-NDMFLKLSP 177

Query: 692 DELNSIILEDEL 727
             L  I+  D+L
Sbjct: 178 KHLAEIVSGDDL 189


>UniRef50_Q6DEL7 Cluster: Kelch-like protein 15; n=4;
           Clupeocephala|Rep: Kelch-like protein 15 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 604

 Score = 40.3 bits (90), Expect = 0.063
 Identities = 19/78 (24%), Positives = 35/78 (44%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           F  H+A+L+  S YF  +FT  +  R+Q  + + G+ +              ++++   V
Sbjct: 42  FQAHKALLATQSDYFRVMFTADMRERDQDKIHMKGLTAAGFGHVLRFMYYGSLELSMLTV 101

Query: 471 HELLMTADYLAFLECFSF 524
            E+L  A Y+   E   F
Sbjct: 102 QEILQAAMYVQLTEAVEF 119


>UniRef50_UPI000069DC2B Cluster: Kelch-like protein 22.; n=1;
           Xenopus tropicalis|Rep: Kelch-like protein 22. - Xenopus
           tropicalis
          Length = 455

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 30/111 (27%), Positives = 43/111 (38%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G S   HR +L+A   YF  +F   L   +Q +V I GV               
Sbjct: 50  VVLKVEGKSIEAHRILLAASCDYFRGMFAGGLKEMDQREVQIHGVSYSAMCRIMDFIYTS 109

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVF 596
            + ++  NV E L  A  L   E   F          ++ VLEL  L  +F
Sbjct: 110 DLALSVNNVQETLTAACQLQISEVIQFCCDFLVSWVDEENVLELYKLADIF 160



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 21/73 (28%), Positives = 40/73 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+Q CCD L S ++ +N L +   A      +L      ++L+ F+T  +Q+  +  LPL
Sbjct: 133 VIQFCCDFLVSWVDEENVLELYKLADIFHLNRLTEQLDTFVLKNFITF-SQTQMYRQLPL 191

Query: 692 DELNSIILEDELK 730
           D++ S++  + L+
Sbjct: 192 DKVFSLLNSNRLE 204


>UniRef50_Q4SW69 Cluster: Chromosome 9 SCAF13686, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 9
           SCAF13686, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1143

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           R S     +V   +G  F  H+ +LSA SPYF A+FT  L   + ++VL+  V
Sbjct: 14  RSSKELTDMVLLAEGVPFHCHKVVLSAFSPYFQAMFTCGLRETQGNEVLLRDV 66


>UniRef50_Q2L3T3 Cluster: POZ domain protein; n=1; Triticum
           aestivum|Rep: POZ domain protein - Triticum aestivum
           (Wheat)
          Length = 275

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = +3

Query: 192 RSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           R+  V  + +G     R     D  V A  G S   HRA+L+A SP FL++F+  L  +E
Sbjct: 2   RTASVEQAQSGVARMLREGILTDITVNAA-GGSMRAHRAVLAARSPVFLSMFSHNLREKE 60

Query: 372 QSDVLIS 392
            S V IS
Sbjct: 61  LSTVDIS 67


>UniRef50_Q96NJ5 Cluster: Kelch-like protein 32; n=42;
           Euteleostomi|Rep: Kelch-like protein 32 - Homo sapiens
           (Human)
          Length = 620

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>UniRef50_Q53HC5 Cluster: Kelch-like protein 26; n=23;
           Euteleostomi|Rep: Kelch-like protein 26 - Homo sapiens
           (Human)
          Length = 615

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +T R       +V   +  +FP H+ +L+ACS YF A+FT  +    Q  + + GV
Sbjct: 54  ATLRAQGQLLDVVLTINREAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGV 109



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++LC + L+++++ + CL I   A       L      +  R+F+ +A + D FL LPL
Sbjct: 148 VVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEED-FLRLPL 206

Query: 692 DELNSIILEDELK 730
           + L   +  + L+
Sbjct: 207 ERLVFFLQSNRLQ 219


>UniRef50_Q8N4N3 Cluster: Kelch repeat and BTB domain-containing
           protein C16orf44; n=25; Euteleostomi|Rep: Kelch repeat
           and BTB domain-containing protein C16orf44 - Homo
           sapiens (Human)
          Length = 616

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD+    P HR +L+ CS YF ++FT  +    Q +V + G             
Sbjct: 46  CDVVLVADE-QRVPAHRNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFL 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSV 602
               + +   N+  +L TA  L       F     E   ++   L L  L  ++S+
Sbjct: 105 YGGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSL 160


>UniRef50_UPI00015B573A Cluster: PREDICTED: similar to
           ENSANGP00000024127; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000024127 - Nasonia
           vitripennis
          Length = 356

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           S   DA +  + G    VHR ILSACSP F A+F   +  + ++ V I+ V
Sbjct: 190 SKFSDAKLVLNGGTEIAVHRIILSACSPVFAAMFEKNMKEQRENRVEITDV 240


>UniRef50_UPI0000F20895 Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 625

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 19/76 (25%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +LQ+C D L + LN   C+ +           +   ARRY+L  F    +++ +F 
Sbjct: 130 QIPHLLQMCMDFLMAELNTHTCVYVWNIGAAYGLMPVRDAARRYILENFAQF-SETTQFN 188

Query: 680 HLPLDELNSIILEDEL 727
            L  +++ + + +D L
Sbjct: 189 QLTFEQITAFLQDDNL 204


>UniRef50_Q4SQQ9 Cluster: Chromosome undetermined SCAF14531, whole
           genome shotgun sequence; n=6; Clupeocephala|Rep:
           Chromosome undetermined SCAF14531, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 520

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 491 RLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD 670
           +L   P  L+L  D +R  +NP +CL + +FA      +L   +  Y+LR F  VA+ S 
Sbjct: 68  QLQHLPA-LRLGLDFMRREMNPLSCLDVASFAEAYALAELLDASHDYVLRQFQKVASTS- 125

Query: 671 EFLHLPLDEL 700
           +F  LP ++L
Sbjct: 126 KFKDLPAEQL 135



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDV 383
           PVHR IL+ACS YF  +FT+ +    Q  V
Sbjct: 1   PVHRVILAACSDYFRCMFTSGMKECGQPSV 30


>UniRef50_Q4RXG1 Cluster: Chromosome 11 SCAF14979, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 11
           SCAF14979, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 572

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD I+R  +  SFP H+A+L+ACS YF ++F+
Sbjct: 39  CDVILRVGE-ESFPAHKAVLAACSEYFESVFS 69


>UniRef50_UPI00015B5791 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 613

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 25/84 (29%), Positives = 35/84 (41%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +   +G S   H+ +LSACS YF ALF    H      V++  VR         
Sbjct: 40  SLVDVTLACTEGPSIRAHKVVLSACSSYFQALFLD--HPNRHPIVILKDVRFAELRTLVD 97

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 ++V    +  LL TA+ L
Sbjct: 98  FMYKGEVNVEYCQLSALLKTAESL 121


>UniRef50_UPI0000DB6F4B Cluster: PREDICTED: similar to bab2
           CG9102-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to bab2 CG9102-PA - Apis mellifera
          Length = 336

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 25/84 (29%), Positives = 35/84 (41%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +   +G S   H+ +LSACS YF ALF    H      V++  VR         
Sbjct: 29  SLVDVTLACTEGPSIRAHKVVLSACSSYFQALFLD--HPNRHPIVILKDVRFAELRTLVD 86

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 ++V    +  LL TA+ L
Sbjct: 87  FMYKGEVNVEYCQLSALLKTAESL 110


>UniRef50_UPI000058439A Cluster: PREDICTED: similar to kelch related
           protein 1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to kelch related protein 1 -
           Strongylocentrotus purpuratus
          Length = 472

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +   C   L   +   N +GI  FA    C KLE  A+  ++  F+ V  + +EF+
Sbjct: 3   QMPTLRDACARFLEKHITVSNAIGIYFFAVAHNCDKLEELAKTVVMDNFIEVC-KEEEFV 61

Query: 680 HLPLDELNSIILEDEL 727
            L  D++  II  DEL
Sbjct: 62  TLGKDKVIDIIARDEL 77


>UniRef50_UPI00015A7D3C Cluster: UPI00015A7D3C related cluster; n=2;
           Danio rerio|Rep: UPI00015A7D3C UniRef100 entry - Danio
           rerio
          Length = 604

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LC   L    +  NCL +++FA      +L A A  ++LR+F  V+  + +F  LP+++L
Sbjct: 114 LCTKFLHQETDAHNCLDVVSFAEAYGMPELHAFANDFVLRHFQDVSI-TPKFQDLPVEKL 172

Query: 701 NSIILEDEL 727
              +  D L
Sbjct: 173 KKYLQSDSL 181


>UniRef50_UPI00015A4291 Cluster: Ectoderm-neural cortex protein 2
           (ENC-2) (Kelch-like protein 25).; n=2; Euteleostomi|Rep:
           Ectoderm-neural cortex protein 2 (ENC-2) (Kelch-like
           protein 25). - Danio rerio
          Length = 500

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = +3

Query: 288 SFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXXXXXXIDVTDT 464
           SFP HRA+L+ACS YF A+F+  L     ++V     V                + + + 
Sbjct: 34  SFPCHRAVLAACSRYFEAMFSGGLRESLDNEVNFRDSVHPEVLELLLDFAYSSRVIINEE 93

Query: 465 NVHELLMTADYLAF 506
           N   LL   D L F
Sbjct: 94  NAESLLEAGDMLQF 107



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  +     + L  +L+  NCLG+M  +    C +L   + R  L +F T+   +++F 
Sbjct: 106 QFHDIRDAAAEFLEKNLHASNCLGMMLLSDAHQCKRLYELSWRMCLIHFETL-RDTEDFC 164

Query: 680 HLPLDELNSIILEDELK 730
            L  D+L  +IL DEL+
Sbjct: 165 GLSKDKLLDLILSDELE 181


>UniRef50_Q4SA05 Cluster: Chromosome 12 SCAF14692, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 12 SCAF14692, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 561

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 22/73 (30%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ + S L+  N L ++  A      +L A    YLLR   T  ++++E+  LP 
Sbjct: 125 VISFCCEFVYSWLDESNVLEVLGLADAYGLQQLRAKVHSYLLRNIQTF-SRTEEYRLLPQ 183

Query: 692 DELNSIILEDELK 730
           DE+   +  D+L+
Sbjct: 184 DEVFRALSSDQLQ 196



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 24/87 (27%), Positives = 35/87 (40%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G   P HR +L+A   YF  +F   L   EQ++V I  V               
Sbjct: 42  VVLLVEGRPIPAHRVLLAASCDYFRGMFAGGLREAEQTEVSIHSVSFTAMKKLLDYIYTS 101

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            I++    V E+L+ A  L      SF
Sbjct: 102 EIELDLECVQEVLVAATLLQLDVVISF 128


>UniRef50_A7S2V3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 576

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 22/76 (28%), Positives = 34/76 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  DD    P H+ +L+A SPYF A+FT+ L    Q  + +  +            
Sbjct: 30  CDVLLCVDD-EEIPSHKLVLAASSPYFRAMFTSNLLECTQRTITLYDIDVGALQQIVEYF 88

Query: 435 XXXXIDVTDTNVHELL 482
               I + + NV  LL
Sbjct: 89  YTGKITIDEDNVQFLL 104


>UniRef50_Q18670 Cluster: Putative uncharacterized protein kel-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein kel-1 - Caenorhabditis elegans
          Length = 618

 Score = 38.7 bits (86), Expect = 0.19
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   +   L+  NC+G+  FAR   C++L   A+ Y  ++FV +   ++E L L  
Sbjct: 156 VRDACARFMLELLDMTNCVGMAEFARAHACHQLAHAAQLYTRQHFVEI-IDNEELLSLDK 214

Query: 692 DELNSIILEDEL 727
           D    +I +D +
Sbjct: 215 DAFCELIQDDRI 226



 Score = 33.9 bits (74), Expect = 5.5
 Identities = 22/67 (32%), Positives = 28/67 (41%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR ILSA S YF A+FT  L    Q  + I  V                + + + NV  +
Sbjct: 85  HRVILSASSSYFRAMFTGGLRESTQRIIPIKEVDVEVLSQLIDYMYTGRMRIDEQNVQTI 144

Query: 480 LMTADYL 500
           L TA  L
Sbjct: 145 LATASLL 151


>UniRef50_A7SZP9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 544

 Score = 38.7 bits (86), Expect = 0.19
 Identities = 21/78 (26%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L   P ++  C + ++  +   NCLGI + A +     L++    ++   F+ VA + DE
Sbjct: 118 LFEIPSIVHECGEFIQGEIQIDNCLGIQSLAGQYSLSSLKSKVDDFVCWNFMKVACE-DE 176

Query: 674 FLHLPLDELNSIILEDEL 727
           +  +P D L  I+ +D L
Sbjct: 177 YDMVPPDHLRDILSQDTL 194



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 19/70 (27%), Positives = 27/70 (38%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G     HR +L+ACSPYF A+ TT       S + +                   + +T 
Sbjct: 47  GEEIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPLHECDPVGVQSIVEYFYSKRLTITK 106

Query: 462 TNVHELLMTA 491
            N+  LL  A
Sbjct: 107 ENIEGLLSAA 116


>UniRef50_UPI0000D5728D Cluster: PREDICTED: similar to CG9102-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9102-PA - Tribolium castaneum
          Length = 282

 Score = 38.3 bits (85), Expect = 0.25
 Identities = 25/87 (28%), Positives = 35/87 (40%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R  S  D  +   +G S   H+ +LSACS YF  LF    H      V++  VR      
Sbjct: 26  RDESLVDVTLACSEGHSIRAHKVVLSACSSYFQTLFVD--HPSRHPIVILKDVRFAELRT 83

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    ++V    +  LL TA+ L
Sbjct: 84  LIEFMYKGEVNVEYCQLSALLKTAESL 110


>UniRef50_Q9PVP8 Cluster: Champignon; n=3; Xenopus|Rep: Champignon -
           Xenopus laevis (African clawed frog)
          Length = 470

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD  ++   G  +P HRA+L+ACS YF  +FT
Sbjct: 34  CDITIKTR-GLEYPTHRAVLAACSDYFRKMFT 64


>UniRef50_Q9VZU6 Cluster: BTB-VII protein domain; n=2;
           Sophophora|Rep: BTB-VII protein domain - Drosophila
           melanogaster (Fruit fly)
          Length = 115

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 30  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 87

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 88  EVNVSQEQLPHILKTAEML 106


>UniRef50_Q960S0 Cluster: LD38452p; n=1; Drosophila
           melanogaster|Rep: LD38452p - Drosophila melanogaster
           (Fruit fly)
          Length = 743

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 33  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 90

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 91  EVNVSQEQLPHILKTAEML 109


>UniRef50_Q176R3 Cluster: Fruitless; n=1; Aedes aegypti|Rep:
           Fruitless - Aedes aegypti (Yellowfever mosquito)
          Length = 552

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  D+G     H+AILSACSPYF  +F    H
Sbjct: 30  CDVTLACDNGI-VKAHQAILSACSPYFEQIFVENKH 64


>UniRef50_UPI00015B5B98 Cluster: PREDICTED: similar to
           broad-complex; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to broad-complex - Nasonia vitripennis
          Length = 436

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACDGKSLKAHRVVLSACSPYFRELLKST 64


>UniRef50_UPI00015B4D74 Cluster: PREDICTED: similar to
           ENSANGP00000012602; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012602 - Nasonia
           vitripennis
          Length = 561

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 20/86 (23%), Positives = 36/86 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+ G     HR IL+A  PYF  +  +     ++  + + G+            
Sbjct: 30  CDITINAN-GKEIRAHRFILAATIPYFETVLLSNFAESDREMISVQGISQTNVELFIKYA 88

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I +T+ N   +++ +DYL   E
Sbjct: 89  YTGQITLTEENAQCVMIDSDYLGLSE 114


>UniRef50_UPI00015B40D2 Cluster: PREDICTED: similar to bric-a-brac;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           bric-a-brac - Nasonia vitripennis
          Length = 399

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 16/28 (57%), Positives = 19/28 (67%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A DG S   H+ +LSACSPYF ALF
Sbjct: 100 VTLACDGHSVKAHKMVLSACSPYFQALF 127


>UniRef50_UPI0000E81831 Cluster: PREDICTED: similar to MGC53471
           protein; n=2; Gallus gallus|Rep: PREDICTED: similar to
           MGC53471 protein - Gallus gallus
          Length = 301

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           DA++RA +  +F  HRA+L+ACS YF A+F+  L     ++V     +            
Sbjct: 47  DAVLRAGN-RTFHCHRAVLAACSRYFDAMFSGGLKESRDAEVNFHDSLHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSARVLINEENAESLLEAGDMLQF 129


>UniRef50_UPI0000DB737B Cluster: PREDICTED: similar to fruitless
           CG14307-PB, isoform B; n=1; Apis mellifera|Rep:
           PREDICTED: similar to fruitless CG14307-PB, isoform B -
           Apis mellifera
          Length = 402

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A  G +F  H+ ILSACSPYF ++F    H
Sbjct: 56  CD-VTLACVGETFKAHQTILSACSPYFESIFLQNTH 90


>UniRef50_UPI0000DB6BB6 Cluster: PREDICTED: similar to bab2
           CG9102-PA, partial; n=1; Apis mellifera|Rep: PREDICTED:
           similar to bab2 CG9102-PA, partial - Apis mellifera
          Length = 323

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 16/28 (57%), Positives = 19/28 (67%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A DG S   H+ +LSACSPYF ALF
Sbjct: 40  VTLACDGHSVKAHKMVLSACSPYFQALF 67


>UniRef50_UPI00006A1ACF Cluster: UPI00006A1ACF related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A1ACF UniRef100 entry -
           Xenopus tropicalis
          Length = 525

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 15/48 (31%), Positives = 29/48 (60%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD  V   +   F  HR +L++ SPYF A+F++++   E+ +V++  +
Sbjct: 22  CDTTV-VTESRRFLCHRVVLASVSPYFRAMFSSSMREAERGEVVLPDI 68


>UniRef50_Q8V3G0 Cluster: SPV136 kelch-like protein; n=1; Swinepox
           virus|Rep: SPV136 kelch-like protein - Swinepox virus
           (SWPV)
          Length = 574

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 20/82 (24%), Positives = 36/82 (43%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  +  DD      H+ ILSA S YF ++ +        +++ I  +             
Sbjct: 23  DITLVTDDNRKIKSHKLILSAVSDYFRSMLSEKFIEGSLNEIRIYDISYTTLKELISFCY 82

Query: 438 XXXIDVTDTNVHELLMTADYLA 503
              +D+ + NV +L++ ADYL+
Sbjct: 83  SGKLDIHEYNVEDLIIKADYLS 104


>UniRef50_Q6TUZ3 Cluster: 19L; n=2; Yatapoxvirus|Rep: 19L - Yaba
           monkey tumor virus (YMTV)
          Length = 524

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V  +C D +   ++  NC+  +       CY+L  +A  ++   F T+A   ++ L L  
Sbjct: 109 VKNVCVDFMTKIISEDNCVHFLRIGFNYECYRLYGEAVDFIRNNFETLA-MFEKLLKLSY 167

Query: 692 DELNSIILEDEL 727
           +EL  +++ DEL
Sbjct: 168 NELKLMLISDEL 179


>UniRef50_Q2PGG2 Cluster: Broad-complex; n=1; Apis mellifera|Rep:
           Broad-complex - Apis mellifera (Honeybee)
          Length = 429

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACDGRSLKAHRVVLSACSPYFRELLKST 64


>UniRef50_O96376 Cluster: Broad-complex Z4-isoform; n=15;
           Obtectomera|Rep: Broad-complex Z4-isoform - Manduca
           sexta (Tobacco hawkmoth) (Tobacco hornworm)
          Length = 459

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   HR +LSACSPYF  L  +T
Sbjct: 36  VTLACDGKSLKAHRVVLSACSPYFRELLKST 66


>UniRef50_UPI0000D56399 Cluster: PREDICTED: similar to CG4807-PA,
           isoform A; n=3; Endopterygota|Rep: PREDICTED: similar to
           CG4807-PA, isoform A - Tribolium castaneum
          Length = 727

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A DG SF  H+ +LSACSPYF  L
Sbjct: 131 VTLACDGCSFTAHKVVLSACSPYFRRL 157


>UniRef50_Q4SC94 Cluster: Chromosome undetermined SCAF14659, whole
           genome shotgun sequence; n=3; Clupeocephala|Rep:
           Chromosome undetermined SCAF14659, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 856

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV-RSXXXXXXXXXXXXXXIDV 455
           DG  F  H+A+L+ACS YF ALF       EQ DV+   +  +              + +
Sbjct: 31  DGVDFKAHKAVLAACSAYFRALFL------EQKDVVHLDISNAAGLGEVLEFMYTAKLSL 84

Query: 456 TDTNVHELLMTADYLAFLE 512
           +  N+ ++L  A++L   E
Sbjct: 85  SQQNLEDVLAVANFLQMQE 103


>UniRef50_Q8QN48 Cluster: CPXV013 protein; n=3; Cowpox virus|Rep:
           CPXV013 protein - Cowpox virus (CPV)
          Length = 523

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 22/71 (30%), Positives = 35/71 (49%)
 Frame = +2

Query: 515 LQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLD 694
           + LC + ++  L+  NCL I+T+A       L+  A       F T   + D F+ LP D
Sbjct: 85  IDLCTEFIKERLDAINCLDIITYAAFYNLEDLKLAAINTTATNF-THVVKDDTFISLPFD 143

Query: 695 ELNSIILEDEL 727
            ++SI   D+L
Sbjct: 144 IISSIFENDDL 154


>UniRef50_A7S7S2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 423

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 20/82 (24%), Positives = 37/82 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  + G  F  HR +L+A S +F  +FT+ +     S + +  + S          
Sbjct: 1   CDVNLEVE-GQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFF 59

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I+++  NV ++L  A +L
Sbjct: 60  YTREINISRDNVVDILEAASFL 81



 Score = 33.1 bits (72), Expect = 9.5
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   + S+L   NC+     A +    +L+  A  ++ + F  V ++ +EFL L +
Sbjct: 86  VKSACAQIILSALRINNCISTRRVADKYALEELKIKADSFIKKNFQQVRSE-EEFLDLSI 144

Query: 692 DELNSIILEDEL 727
            EL  +I  D+L
Sbjct: 145 GELCELISSDDL 156


>UniRef50_Q9Y2K1 Cluster: Zinc finger and BTB domain-containing
           protein 1; n=24; Tetrapoda|Rep: Zinc finger and BTB
           domain-containing protein 1 - Homo sapiens (Human)
          Length = 713

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +  DD   F  H+A+L+ACS YF   F    HS  Q
Sbjct: 24  CDCCIAIDD-IYFQAHKAVLAACSSYFRMFFMNHQHSTAQ 62


>UniRef50_P87617 Cluster: Kelch repeat protein C2; n=57;
           Orthopoxvirus|Rep: Kelch repeat protein C2 - Cowpox
           virus (strain GRI-90 / Grishak) (CPV)
          Length = 512

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+ LC   +  ++N  NC+ +  F++R    KL   +   ++   +T  T   EF  L
Sbjct: 83  PPVVDLCVKTMIHNINSTNCIRMFNFSKRYGIKKLYNASMSEIINN-ITAVTSDPEFGKL 141

Query: 686 PLDELNSIILEDEL 727
             DEL +I+  +++
Sbjct: 142 SKDELTTILSHEDV 155


>UniRef50_UPI0000E46E2C Cluster: PREDICTED: similar to kelch-like
           13; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to kelch-like 13 - Strongylocentrotus purpuratus
          Length = 662

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 8/84 (9%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTL----HSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTN 467
           HR IL+ACS YF  LFT+         EQ    + GV                +DVT  N
Sbjct: 122 HRLILAACSGYFCDLFTSEEDDPDSDGEQFVYTLHGVSHEIIKILLESLYTSGLDVTYEN 181

Query: 468 VHELLMTADYL----AFLECFSFV 527
           + ELL  A YL    A   C SF+
Sbjct: 182 IDELLNAALYLRIQTALDACMSFL 205


>UniRef50_Q5RIW6 Cluster: Novel protein similar to human and mouse
           BTB and CNC homology 1, basic leucine zipper
           transcription factor 2; n=2; Danio rerio|Rep: Novel
           protein similar to human and mouse BTB and CNC homology
           1, basic leucine zipper transcription factor 2 - Danio
           rerio (Zebrafish) (Brachydanio rerio)
          Length = 796

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 20/53 (37%), Positives = 25/53 (47%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           +VH      G     +    CD  V  + G  F  HRA+L+ACS YFL  F T
Sbjct: 17  TVHCTNILLGLNEQRKQGLLCDVTVLVE-GKEFRAHRAVLAACSEYFLQGFAT 68


>UniRef50_Q7Q666 Cluster: ENSANGP00000010806; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010806 - Anopheles gambiae
           str. PEST
          Length = 560

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A DG S   H+ +LSACSPYF  LF
Sbjct: 181 VTLACDGQSMKAHKMVLSACSPYFQTLF 208


>UniRef50_Q17KB8 Cluster: Bric-a-brac; n=1; Aedes aegypti|Rep:
           Bric-a-brac - Aedes aegypti (Yellowfever mosquito)
          Length = 429

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A DG S   H+ +LSACSPYF  LF
Sbjct: 85  VTLACDGKSIKAHKMVLSACSPYFQTLF 112


>UniRef50_O15156 Cluster: Zinc finger and BTB domain-containing
           protein 7B; n=14; Theria|Rep: Zinc finger and BTB
           domain-containing protein 7B - Homo sapiens (Human)
          Length = 539

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD  +R   G  +  HRA+L+ACS YF  LFT
Sbjct: 34  CDLTIRTQ-GLEYRTHRAVLAACSHYFKKLFT 64


>UniRef50_Q8WVZ9 Cluster: Kelch repeat and BTB domain-containing
           protein 7; n=22; Mammalia|Rep: Kelch repeat and BTB
           domain-containing protein 7 - Homo sapiens (Human)
          Length = 684

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 18/73 (24%), Positives = 34/73 (46%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  F  +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVQRLYAASDML 151


>UniRef50_UPI00015B6112 Cluster: PREDICTED: similar to fruitless
           type A; n=1; Nasonia vitripennis|Rep: PREDICTED: similar
           to fruitless type A - Nasonia vitripennis
          Length = 584

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A  G +F  H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACVGETFKAHQTILSACSPYFENIFLQNTH 64


>UniRef50_UPI0000F1EE07 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 442

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 23/87 (26%), Positives = 33/87 (37%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R S     +V   DG  FP HRA L A S +F  +F +      Q+ V +  V       
Sbjct: 35  RRSGTFTDVVLLVDGCEFPCHRATLCASSGFFRTMFGSHFTESRQAAVTLQDVSRAAMEK 94

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    + + + NV  +   AD L
Sbjct: 95  LLDFMYEGRLTLDEENVQSVFQAADRL 121


>UniRef50_UPI0000F1D481 Cluster: PREDICTED: similar to zinc finger
           and BTB domain containing 5; n=2; Danio rerio|Rep:
           PREDICTED: similar to zinc finger and BTB domain
           containing 5 - Danio rerio
          Length = 715

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD ++       F  HRA+LSACS +F ALFT
Sbjct: 29  CDCVIMVGS-RHFKAHRAVLSACSTHFRALFT 59


>UniRef50_UPI0000DB734E Cluster: PREDICTED: similar to Broad-complex
           core-protein isoform 6; n=2; Apocrita|Rep: PREDICTED:
           similar to Broad-complex core-protein isoform 6 - Apis
           mellifera
          Length = 454

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTT 353
           +  A DG     H+ +LSACSPYF  LF T
Sbjct: 35  VTLACDGRRLQAHKVVLSACSPYFKELFKT 64


>UniRef50_UPI00015A4B20 Cluster: UPI00015A4B20 related cluster; n=2;
           Danio rerio|Rep: UPI00015A4B20 UniRef100 entry - Danio
           rerio
          Length = 554

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 23/87 (26%), Positives = 33/87 (37%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R S     +V   DG  FP HRA L A S +F  +F +      Q+ V +  V       
Sbjct: 20  RRSGTFTDVVLLVDGCEFPCHRATLCASSGFFRTMFGSHFTESRQAAVTLQDVSRAAMEK 79

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    + + + NV  +   AD L
Sbjct: 80  LLDFMYEGRLTLDEENVQSVFQAADRL 106


>UniRef50_UPI00015A49ED Cluster: UPI00015A49ED related cluster; n=2;
           Danio rerio|Rep: UPI00015A49ED UniRef100 entry - Danio
           rerio
          Length = 570

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F   + LC   L+  ++  NCL + +FA       +   A  ++LR+F  ++  + +F 
Sbjct: 96  QFQPAVSLCLQFLQQEMDVHNCLDVASFAEAYGMVDIMEMAEDFVLRHFQEISA-TPKFQ 154

Query: 680 HLPLDELNSIILEDEL 727
            LP D+L   +  D L
Sbjct: 155 DLPADKLLQFLRCDAL 170


>UniRef50_Q1L8N5 Cluster: Novel protein; n=6; Clupeocephala|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 662

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD  +  + G  F  HR +L+A SPYF A+FT+ L     +++ +  V
Sbjct: 64  CDVTLLVE-GKKFMCHRVLLAAVSPYFRAMFTSPLVESRLTEIRLEEV 110



 Score = 33.5 bits (73), Expect = 7.2
 Identities = 27/79 (34%), Positives = 38/79 (48%)
 Frame = +2

Query: 491 RLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD 670
           RL   P +  LC   L   L+ +NCLG+ + AR      L   + R + ++F  VA Q D
Sbjct: 143 RLQVMP-LQDLCSRFLFEHLSVENCLGMYSLARSHHDQLLLRASLRLVGQHFPRVARQQD 201

Query: 671 EFLHLPLDELNSIILEDEL 727
            FL L    L S++  D L
Sbjct: 202 -FLLLDPGTLGSLLESDRL 219


>UniRef50_Q9LFZ6 Cluster: F20N2.15; n=2; core eudicotyledons|Rep:
           F20N2.15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 979

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 138 AQRNGKRPK*QSDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILS 317
           +Q +G+     ++G + N+S     +  G   T  + +  D  + A DG S   HRA+L+
Sbjct: 127 SQDSGELYSIWANGSTENQSQVTAVTSLGRMLTESIYT--DITINASDG-SIGAHRAVLA 183

Query: 318 ACSPYFLALFTTTLHSREQSDV 383
           A SP F ++F   L  +E S++
Sbjct: 184 ARSPVFRSMFLHDLKEKELSEI 205


>UniRef50_Q680K8 Cluster: Putative uncharacterized protein
           At1g55760; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein At1g55760 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 329

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 138 AQRNGKRPK*QSDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILS 317
           +Q +G+     ++G + N+S     +  G   T  + +  D  + A DG S   HRA+L+
Sbjct: 127 SQDSGELYSIWANGSTENQSQVTAVTSLGRMLTESIYT--DITINASDG-SIGAHRAVLA 183

Query: 318 ACSPYFLALFTTTLHSREQSDV 383
           A SP F ++F   L  +E S++
Sbjct: 184 ARSPVFRSMFLHDLKEKELSEI 205


>UniRef50_Q7PZG9 Cluster: ENSANGP00000008749; n=2; Culicidae|Rep:
           ENSANGP00000008749 - Anopheles gambiae str. PEST
          Length = 529

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 19/81 (23%), Positives = 33/81 (40%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  +  DD   F  HR +L+A SPYF ++        +   +L  GV+            
Sbjct: 43  DCTIYVDDQVQFKAHRVVLAANSPYFQSILQDV--PMDHCSILFPGVQEFEMRALLEYMY 100

Query: 438 XXXIDVTDTNVHELLMTADYL 500
              ++VT   +  ++  A+ L
Sbjct: 101 TGEVNVTQAQIPRIMKIAEQL 121


>UniRef50_Q9UDQ9 Cluster: SBBI26 (Kelch-like 7 (Drosophila), isoform
           CRA_d); n=3; Eutheria|Rep: SBBI26 (Kelch-like 7
           (Drosophila), isoform CRA_d) - Homo sapiens (Human)
          Length = 166

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 21/80 (26%), Positives = 32/80 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +L+A S +F  +FTT +   +  +V +               
Sbjct: 44  CDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFA 102

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I V   NV  LL  A+
Sbjct: 103 YTARISVNSNNVQSLLDAAN 122


>UniRef50_P24768 Cluster: Kelch repeat protein A55; n=41;
           Orthopoxvirus|Rep: Kelch repeat protein A55 - Vaccinia
           virus (strain Western Reserve / WR) (VACV)
          Length = 564

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  +D      H+ ILS  S YF  LF+       + +V +S +            
Sbjct: 21  CDISIVIND-ERINAHKLILSGASEYFSILFSNNFIDSNEYEVNLSHLDYQSVNDLIDYI 79

Query: 435 XXXXIDVTDTNVHELLMTADYL----AFLECFSFV 527
               + +T+ NV  +L TAD+L    A  EC +++
Sbjct: 80  YGIPLSLTNDNVKYILSTADFLQIGSAITECENYI 114


>UniRef50_UPI00015B543F Cluster: PREDICTED: similar to
           ENSANGP00000010462; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000010462 - Nasonia
           vitripennis
          Length = 531

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/29 (51%), Positives = 19/29 (65%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFT 350
           +  A +G     H+ +LSACSPYF ALFT
Sbjct: 50  VTLAVEGQLLRAHKMVLSACSPYFQALFT 78


>UniRef50_UPI0001555635 Cluster: PREDICTED: similar to zinc finger
           and BTB domain containing 7C; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to zinc finger and BTB
           domain containing 7C - Ornithorhynchus anatinus
          Length = 481

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 24/93 (25%), Positives = 40/93 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++   +   +  HR++L+ACS YF  LFTT   + +     I  V+           
Sbjct: 34  CDVLLIVQE-QEYRTHRSVLAACSKYFKKLFTTGALADQPYVYEIDFVQPEALAAILEFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
               + +T  NV  +L  A  L  ++C   V +
Sbjct: 93  YTSTLTITAANVKHILSAAKLLE-IQCIVNVCL 124


>UniRef50_Q4RGN9 Cluster: Chromosome 4 SCAF15094, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF15094, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 529

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL-----HSREQSDVLISGVRSXXXXX 419
           CD ++   D   +  HR++L+ACS YF  LFT T      H    +   I  V       
Sbjct: 29  CDVVLIVRD-QEYRTHRSVLAACSQYFKKLFTVTTGDGGDHRHAAAVYEIDFVAPESLTA 87

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    + VT +NV E+L  A  L
Sbjct: 88  ILEFAYTSTLTVTASNVKEILNAAQLL 114


>UniRef50_Q3S2W8 Cluster: BroadZ1 isoform; n=1; Acheta
           domesticus|Rep: BroadZ1 isoform - Acheta domesticus
           (House cricket)
          Length = 506

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGKSLKAHRVVLSACSPYFRELLKST 64


>UniRef50_Q29DP3 Cluster: GA21544-PA; n=1; Drosophila
           pseudoobscura|Rep: GA21544-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 968

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 229 EGQSIKAHKMVLSACSPYFQALF 251


>UniRef50_Q299M6 Cluster: GA12896-PA; n=2; Endopterygota|Rep:
           GA12896-PA - Drosophila pseudoobscura (Fruit fly)
          Length = 558

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>UniRef50_Q8IN81 Cluster: Sex determination protein fruitless; n=65;
           Neoptera|Rep: Sex determination protein fruitless -
           Drosophila melanogaster (Fruit fly)
          Length = 955

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>UniRef50_Q24206 Cluster: Broad-complex core protein isoform 6;
           n=13; Neoptera|Rep: Broad-complex core protein isoform 6
           - Drosophila melanogaster (Fruit fly)
          Length = 880

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>UniRef50_Q9W0K7 Cluster: Protein bric-a-brac 1; n=3;
           Drosophila|Rep: Protein bric-a-brac 1 - Drosophila
           melanogaster (Fruit fly)
          Length = 977

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 129 VTLACDGRSMKAHKMVLSACSPYFQTLLAET 159


>UniRef50_Q24174 Cluster: Protein abrupt; n=5; Diptera|Rep: Protein
           abrupt - Drosophila melanogaster (Fruit fly)
          Length = 904

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 23/79 (29%), Positives = 34/79 (43%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A D  SF  H+ +LSACSPYF  L     +  E   V++  VR              
Sbjct: 105 VTLACDERSFTAHKVVLSACSPYFRRLLKA--NPCEHPIVILRDVRCDDVENLLSFMYNG 162

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   + + L TA  L
Sbjct: 163 EVNVSHEQLPDFLKTAHLL 181


>UniRef50_UPI0000E47915 Cluster: PREDICTED: similar to kelch-like 5
           protein; n=4; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to kelch-like 5 protein -
           Strongylocentrotus purpuratus
          Length = 604

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
 Frame = +3

Query: 249 SACDAIVRADDGASF---PVHRAILSACSPYFLALFTTTLHSREQS--DVLISGVRS 404
           S CD  ++ +D       P HR +L+A S YF A+FT+ L   +Q   ++ I GV +
Sbjct: 34  SLCDVFLQGEDDMPMEPVPAHRCVLAANSVYFHAMFTSGLAESKQDHREISIRGVNT 90


>UniRef50_UPI0000DB79F8 Cluster: PREDICTED: similar to bric a brac 1
           CG9097-PB, isoform B; n=1; Apis mellifera|Rep:
           PREDICTED: similar to bric a brac 1 CG9097-PB, isoform B
           - Apis mellifera
          Length = 504

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D  +  D+GAS   H+ +L+ACS YF  LF
Sbjct: 34  DVTLAVDEGASVKCHKMVLAACSSYFQTLF 63


>UniRef50_UPI0000D55ED5 Cluster: PREDICTED: similar to CG9097-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG9097-PB, isoform B - Tribolium castaneum
          Length = 605

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFT 350
           D  +  + G+    HR +L+ACSPYF  LFT
Sbjct: 33  DVTLACEGGSPIKCHRMVLAACSPYFQNLFT 63


>UniRef50_UPI000065F96E Cluster: Homolog of Homo sapiens "Zinc
           finger and BTB domain containing protein 5; n=1;
           Takifugu rubripes|Rep: Homolog of Homo sapiens "Zinc
           finger and BTB domain containing protein 5 - Takifugu
           rubripes
          Length = 599

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           CD +V   D   F  HR+IL+ACS +F AL +T+
Sbjct: 24  CDCVVMVGD-QRFQAHRSILAACSSHFRALLSTS 56


>UniRef50_Q5XXR5 Cluster: Fruitless male-specific zinc-finger C
           isoform; n=2; Anopheles gambiae|Rep: Fruitless
           male-specific zinc-finger C isoform - Anopheles gambiae
           (African malaria mosquito)
          Length = 569

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 78  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 112


>UniRef50_Q5S3Q0 Cluster: Male-specific transcription factor FRU-MA;
           n=6; Anopheles gambiae|Rep: Male-specific transcription
           factor FRU-MA - Anopheles gambiae (African malaria
           mosquito)
          Length = 960

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 78  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 112


>UniRef50_A7SAR8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 582

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 4/90 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLIS----GVRSXXXXXX 422
           CD  +  ++  SF  H+++L+A SPYF  LFT+ +  + Q  +       G+        
Sbjct: 34  CDVTLIVEE-TSFHAHKSVLAAKSPYFHKLFTSEMAEKAQEMIKFELSSLGLSKSVMGDM 92

Query: 423 XXXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                   ++V  +   + L+ ADY    E
Sbjct: 93  LCYLYTGNLNVLASQAQDFLIAADYFLLSE 122


>UniRef50_Q9W0K4 Cluster: Protein bric-a-brac 2; n=11; Neoptera|Rep:
           Protein bric-a-brac 2 - Drosophila melanogaster (Fruit
           fly)
          Length = 1067

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 230 EGHSIKAHKMVLSACSPYFQALF 252


>UniRef50_UPI00015B5A77 Cluster: PREDICTED: similar to
           ENSANGP00000024127; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000024127 - Nasonia
           vitripennis
          Length = 600

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 22/71 (30%), Positives = 31/71 (43%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           F VH+A+LSA S  F A+F   +  ++QS+V I  +                +   DT  
Sbjct: 220 FEVHKALLSARSRVFAAMFEHDMKEKQQSEVRILDIEKEVLEELIRFLYTGRVKEIDTIA 279

Query: 471 HELLMTADYLA 503
             LL  AD  A
Sbjct: 280 PGLLAAADKYA 290


>UniRef50_UPI0000E47B90 Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 585

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVR---SXXXXXXX 425
           CD ++  + G  F  HR +L+ACSPYF  +  + L   ++ D  ++ +    +       
Sbjct: 35  CDIVLNVE-GKVFKAHRNVLAACSPYFDTMCNSGL-EEDKVDTAVATIECTSAEAMDEIL 92

Query: 426 XXXXXXXIDVTDTNVHELLMTAD 494
                  I +  TNV  +L  AD
Sbjct: 93  NYMYTGKISINATNVESILRGAD 115


>UniRef50_UPI0000DB772B Cluster: PREDICTED: similar to abrupt
           CG4807-PA, isoform A; n=2; Apocrita|Rep: PREDICTED:
           similar to abrupt CG4807-PA, isoform A - Apis mellifera
          Length = 591

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A D +SF  H+ +LSACSPYF  L
Sbjct: 82  VTLACDSSSFTAHKVVLSACSPYFRRL 108


>UniRef50_Q4SQQ8 Cluster: Chromosome undetermined SCAF14531, whole
           genome shotgun sequence; n=2; Clupeocephala|Rep:
           Chromosome undetermined SCAF14531, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 576

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F   L LC   L+ ++   +CL + +FA      +LE +A  ++LR F  V +++ +F 
Sbjct: 152 QFQQALALCLRFLKENIEVTSCLDVASFAEAYGASELE-EANDFILRNFWEV-SETAKFQ 209

Query: 680 HLPLDELNSIILEDEL 727
            L  ++L  II +D L
Sbjct: 210 DLTAEKLLEIIGQDGL 225


>UniRef50_Q6Z5C8 Cluster: POZ domain protein family-like; n=3; Oryza
           sativa|Rep: POZ domain protein family-like - Oryza
           sativa subsp. japonica (Rice)
          Length = 330

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLIS 392
           D  + A DG S   HRAIL++ SP F ++F+  L  +E S V IS
Sbjct: 166 DITINATDG-SIMAHRAILASRSPVFRSMFSHDLKEKELSTVDIS 209


>UniRef50_Q99592 Cluster: Zinc finger protein 238; n=26;
           Euteleostomi|Rep: Zinc finger protein 238 - Homo sapiens
           (Human)
          Length = 522

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>UniRef50_Q9P2G9 Cluster: Kelch-like protein 8; n=30;
           Euteleostomi|Rep: Kelch-like protein 8 - Homo sapiens
           (Human)
          Length = 620

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 152 VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 210

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 211 QHLHKLLSSSDL 222


>UniRef50_Q8N239 Cluster: Kelch-like protein 34; n=13; Theria|Rep:
           Kelch-like protein 34 - Homo sapiens (Human)
          Length = 644

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 201 HVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           H G    G  +       CD  +  + G+ FP HR++L+  S YF ALF +  H++E
Sbjct: 11  HGGALLTGYQALRAEGFLCDVTLETE-GSEFPAHRSLLACSSDYFRALFKS--HTQE 64


>UniRef50_UPI00015B5DE9 Cluster: PREDICTED: similar to
           ENSANGP00000024127; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000024127 - Nasonia
           vitripennis
          Length = 334

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 21/78 (26%), Positives = 34/78 (43%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           DG +F  H+ IL+  SP F A+F   +  +  ++V+I  +R               ++  
Sbjct: 182 DGKTFKAHKCILAKESPVFDAMFKIDMKEKLLNEVIIEDIRPDIFEKLLRYMYVGEVEDI 241

Query: 459 DTNVHELLMTADYLAFLE 512
                ELL+ AD  A  E
Sbjct: 242 QAIAVELLVAADKYAIDE 259


>UniRef50_UPI000155547C Cluster: PREDICTED: similar to keratin
           associated protein 12-2; n=3; Euteleostomi|Rep:
           PREDICTED: similar to keratin associated protein 12-2 -
           Ornithorhynchus anatinus
          Length = 591

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLA 341
           CD  V  +D   F  HRA+L+ACS YFLA
Sbjct: 36  CDVTVLVED-RRFRAHRAVLAACSNYFLA 63


>UniRef50_UPI00006C113A Cluster: PREDICTED: similar to Kelch-like
           protein 2; n=3; Catarrhini|Rep: PREDICTED: similar to
           Kelch-like protein 2 - Homo sapiens
          Length = 712

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYF 335
           CD +++A+ G + P H  ILSACSP+F
Sbjct: 34  CDVLLQAE-GEAVPAHCCILSACSPFF 59


>UniRef50_UPI0000586D6C Cluster: PREDICTED: similar to repressor
           transcriptional factor; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to repressor
           transcriptional factor - Strongylocentrotus purpuratus
          Length = 797

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVL 386
           S CDAI+   D   F  HRA+L ACS +F  ++          D+L
Sbjct: 40  SLCDAIISVQD-LQFNAHRAVLMACSDFFRDIYQALPAGGRNPDLL 84


>UniRef50_Q7SYJ3 Cluster: Zgc:66442; n=5; Euteleostomi|Rep:
           Zgc:66442 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 442

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVL-ISGVRSXXXXXXXXX 431
           CD  V  +D   F  HR +L+ACS YF  LF    H  + S V+ I  +RS         
Sbjct: 30  CDIAVVVED-VKFRAHRCVLAACSNYFKKLFKK--HEVDSSSVIEIDFIRSDIFEEVLNY 86

Query: 432 XXXXXIDVTDTNVHELLMTADYL 500
                I V   +V+ ++ +   L
Sbjct: 87  MYTAKISVKKKDVNLMMSSGQIL 109


>UniRef50_Q1RQ11 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 375

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +VR +D  +F  HR++L+ACS YF +   T   + +  +V++  V S          
Sbjct: 47  CDILVRTND-QTFHAHRSLLAACSLYFRSNLPTD-PNNQVYEVVLPQVTSVGFDVLLNYM 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
               + +   N+ +++  A  L        C+ FV
Sbjct: 105 YTGILGINSENIKDVISGAMALKMTNVVETCYQFV 139


>UniRef50_Q17JF0 Cluster: Abrupt protein; n=1; Aedes aegypti|Rep:
           Abrupt protein - Aedes aegypti (Yellowfever mosquito)
          Length = 442

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 21/71 (29%), Positives = 30/71 (42%)
 Frame = +3

Query: 288 SFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTN 467
           SF  H+ +LSACSPYF  L     +  E   V++  VRS              + +    
Sbjct: 39  SFTAHKVVLSACSPYFRKLLKA--NPCEHPIVILRDVRSEDIESLLRFMYNGEVHIGQDQ 96

Query: 468 VHELLMTADYL 500
           + + L TA  L
Sbjct: 97  LSDFLKTAQLL 107


>UniRef50_Q16UX3 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 379

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 19/92 (20%), Positives = 37/92 (40%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           H+  L A S YF A+F        +S++++  +                ID+   N+HE+
Sbjct: 50  HKLFLIASSEYFYAMFNGNFKESSESEIVLEDIEPKIFLEILRFVYCGKIDLNFQNIHEI 109

Query: 480 LMTADYLAFLECFSFVAIISEVH*TQKTVLEL 575
            + +     +E  S  +   E     + VL++
Sbjct: 110 YIHSRKYMLMELLSMASNFLEKSIEPENVLKI 141


>UniRef50_UPI0000EBD7C4 Cluster: PREDICTED: similar to zinc finger
           and BTB domain containing 17; n=4; Laurasiatheria|Rep:
           PREDICTED: similar to zinc finger and BTB domain
           containing 17 - Bos taurus
          Length = 731

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVDFKAHKAVLAACSEYFKMLF 53


>UniRef50_UPI0000548835 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 587

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALF 347
           CD ++ A+ G  FP HR +L+  S YF +LF
Sbjct: 29  CDVVLDAE-GVEFPAHRTLLACSSDYFWSLF 58


>UniRef50_Q4TA58 Cluster: Chromosome 17 SCAF7446, whole genome
           shotgun sequence; n=2; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF7446, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 566

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           CD+ V   D A F  HRA+L++CS YF   +   L  R+
Sbjct: 24  CDSTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRD 61


>UniRef50_Q5TX84 Cluster: ENSANGP00000027308; n=9; Culicidae|Rep:
           ENSANGP00000027308 - Anopheles gambiae str. PEST
          Length = 637

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   HR +LSACS YF  L  +T
Sbjct: 34  VTLACDGRSLKAHRVVLSACSTYFRELLKST 64


>UniRef50_Q294B4 Cluster: GA19554-PA; n=1; Drosophila
           pseudoobscura|Rep: GA19554-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1125

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLAL 344
           CD  ++  D +   VHR +LSAC+ YF AL
Sbjct: 30  CDLTLQFRDNSQLKVHRLVLSACTDYFNAL 59


>UniRef50_Q17H68 Cluster: Microtubule binding protein, putative;
           n=1; Aedes aegypti|Rep: Microtubule binding protein,
           putative - Aedes aegypti (Yellowfever mosquito)
          Length = 1114

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  ++ +D +   VHR +LSAC+ YF  L  T
Sbjct: 30  CDLTLQFNDNSQLKVHRLVLSACTDYFNMLENT 62


>UniRef50_O16313 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 581

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 26/114 (22%), Positives = 44/114 (38%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  +  DDG  F  HR IL+  S +F A+  T      Q  V +    S           
Sbjct: 65  DVTLVLDDGTEFAAHRLILAVRSSFFRAMLYTGFQESHQQLVTLQETNSVAFRAVLRYMY 124

Query: 438 XXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFS 599
              ID     +  LL   +YL+    +  + +++ +    K +L+   L  +F+
Sbjct: 125 TSKIDFAGVELDILL---EYLSLAHRYDLIQLMTAISEYFKEILKNENLCSIFN 175


>UniRef50_UPI0000E494F7 Cluster: PREDICTED: similar to MGC81491
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC81491 protein -
           Strongylocentrotus purpuratus
          Length = 798

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI 389
           DG  FP H+ IL+A S YF A+F + +   +  +V I
Sbjct: 611 DGTPFPAHKPILAARSSYFEAMFRSFMPENDSVNVTI 647


>UniRef50_UPI0000DB6EB9 Cluster: PREDICTED: similar to Protein
           tramtrack, beta isoform (Tramtrack p69) (Repressor
           protein fushi tarazu); n=1; Apis mellifera|Rep:
           PREDICTED: similar to Protein tramtrack, beta isoform
           (Tramtrack p69) (Repressor protein fushi tarazu) - Apis
           mellifera
          Length = 502

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A +G     H+ +LSACSPYF ALF
Sbjct: 33  VTLAVEGQLLRAHKMVLSACSPYFQALF 60


>UniRef50_UPI0000DB6E40 Cluster: PREDICTED: similar to
           BTB-protein-VII CG11494-PA, isoform A; n=1; Apis
           mellifera|Rep: PREDICTED: similar to BTB-protein-VII
           CG11494-PA, isoform A - Apis mellifera
          Length = 954

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 18/79 (22%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF +LF  T++  +   V++  V+              
Sbjct: 33  VTLAAEGRHLQAHKVVLSACSTYFQSLF--TVNPCQHPIVILKDVKFSDLKIMVDFMYYG 90

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++++   +  ++ TA+ L
Sbjct: 91  EVNISQDQLPSIIKTAESL 109


>UniRef50_UPI0000D55FEF Cluster: PREDICTED: similar to Tramtrack
           protein, beta isoform (Tramtrack p69) (Fushi tarazu
           repressor protein); n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to Tramtrack protein, beta isoform
           (Tramtrack p69) (Fushi tarazu repressor protein) -
           Tribolium castaneum
          Length = 616

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A +G     H+ +LSACSPYF ALF
Sbjct: 33  VTLAVEGQLLRAHKMVLSACSPYFQALF 60


>UniRef50_UPI0000519F94 Cluster: PREDICTED: similar to CG3726-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG3726-PA
           - Apis mellifera
          Length = 519

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSD--VLISGVRSXXXXXXXX 428
           CD +  A +G +   H+ +LSACS Y    F T L   E+ D  V++  V+         
Sbjct: 50  CD-VTLACEGKTLRAHKVVLSACSTY----FDTILSQYEEKDPIVIMRDVKFSDIKVLVE 104

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 I++  T +  LL TA+ L
Sbjct: 105 FMYKGEINIDHTRLSSLLKTAEDL 128


>UniRef50_Q4RJ22 Cluster: Chromosome 1 SCAF15039, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF15039, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 613

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++ +N +    FA  +   +L      ++  + + V+ Q D FL LP 
Sbjct: 117 VKQICGDYLLSKMDSQNAISFRNFASSMGDGRLLDKVDAFIQDHLLDVSEQED-FLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED L
Sbjct: 176 LKL-EVMLEDNL 186


>UniRef50_Q16GQ7 Cluster: ORF-A short, putative; n=1; Aedes
           aegypti|Rep: ORF-A short, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 409

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +3

Query: 222 GAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALF 347
           G P   R     D  + A  G  F  H+ +LS CSPYF  +F
Sbjct: 20  GFPQLQRDGQMVDVTIAAG-GKIFKAHKLVLSVCSPYFQKIF 60


>UniRef50_Q9UD99 Cluster: Putative KUP zinc-finger protein; n=2;
           Euteleostomi|Rep: Putative KUP zinc-finger protein -
           Homo sapiens (Human)
          Length = 75

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           CD  V   D A F  HRA+L++CS YF   +   L  R+
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRD 61


>UniRef50_Q13105 Cluster: Zinc finger and BTB domain-containing
           protein 17; n=24; Tetrapoda|Rep: Zinc finger and BTB
           domain-containing protein 17 - Homo sapiens (Human)
          Length = 803

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVHFKAHKAVLAACSEYFKMLF 53


>UniRef50_P17789 Cluster: Protein tramtrack, beta isoform; n=1;
           Drosophila melanogaster|Rep: Protein tramtrack, beta
           isoform - Drosophila melanogaster (Fruit fly)
          Length = 643

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>UniRef50_P42282 Cluster: Protein tramtrack, alpha isoform; n=2;
           Sophophora|Rep: Protein tramtrack, alpha isoform -
           Drosophila melanogaster (Fruit fly)
          Length = 813

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>UniRef50_Q10579 Cluster: Spermatocyte protein spe-26; n=2;
           Caenorhabditis|Rep: Spermatocyte protein spe-26 -
           Caenorhabditis elegans
          Length = 570

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 7/82 (8%)
 Frame = +2

Query: 503 FPGVLQL---CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYL---LRYFVTVATQ 664
           FP +L++    CDH+ S+L+  NC  +    R   C         Y+   L   V V  +
Sbjct: 100 FPKILEMKNTICDHILSTLSDVNCFLLHKKFREFDCQNHAHKTLEYILYNLARMVVVDKR 159

Query: 665 SD-EFLHLPLDELNSIILEDEL 727
            D EF  LP++E+  ++  +E+
Sbjct: 160 VDVEFYRLPVEEVKHLLSSEEV 181


>UniRef50_Q9P2G3 Cluster: Kelch-like protein 14; n=31;
           Euteleostomi|Rep: Kelch-like protein 14 - Homo sapiens
           (Human)
          Length = 628

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  + A  G  F  H+A+L++CS YF +LF++
Sbjct: 33  CDVTLTAQ-GQQFHCHKAVLASCSQYFRSLFSS 64


>UniRef50_UPI00015B5958 Cluster: PREDICTED: similar to speckle-type
           poz protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to speckle-type poz protein - Nasonia
           vitripennis
          Length = 358

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 23/88 (26%), Positives = 34/88 (38%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R S  C  +V  D+    P HR +L+A SP F A+F   +   +   V I    +     
Sbjct: 195 RFSDVCLIVV--DEAVRLPAHRNVLAARSPVFAAMFEHDMRESQDGTVQIYDFDAETIRA 252

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYLA 503
                    +D  +    +LL  AD  A
Sbjct: 253 MLRYIYTGRLDDIELRADKLLGAADKYA 280


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 843,772,629
Number of Sequences: 1657284
Number of extensions: 17177243
Number of successful extensions: 48600
Number of sequences better than 10.0: 280
Number of HSP's better than 10.0 without gapping: 45988
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48528
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 78292544701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -