SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30151.Seq
         (892 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA...    75   2e-12
UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:...    70   7e-11
UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3; Sophophora|...    69   2e-10
UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved ...    62   2e-08
UniRef50_Q18H13 Cluster: Homolog to NADH dehydrogenase, subunit ...    35   2.4  
UniRef50_A0Z6K9 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2; ...    34   4.2  

>UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG13035-PA, isoform A - Tribolium castaneum
          Length = 548

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 1/64 (1%)
 Frame = +2

Query: 308 GPV-WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLA 484
           GP+ W +  + KAA +L +PP    F+DEQEMR VY++IYDVFR+K VL QA++DI F  
Sbjct: 117 GPITWTVSDISKAACILAQPPAPTTFDDEQEMRRVYTLIYDVFRHKNVLTQALNDIAFFH 176

Query: 485 DYPQ 496
            YP+
Sbjct: 177 FYPE 180


>UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:
           ENSANGP00000011229 - Anopheles gambiae str. PEST
          Length = 667

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 31/66 (46%), Positives = 43/66 (65%)
 Frame = +2

Query: 317 WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLADYPQ 496
           W +  +++A +LL +PP  V F+DE EMR VYS+IYDV+R+K VL QA+ +I F   YP 
Sbjct: 121 WRLEDIVRAGKLLHQPPLPVQFDDEYEMRKVYSMIYDVYRFKLVLQQALRNIGFYESYPM 180

Query: 497 YTGNVT 514
                T
Sbjct: 181 LAHETT 186


>UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3;
           Sophophora|Rep: CG13035-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 739

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 29/63 (46%), Positives = 42/63 (66%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+IYDVFRYK V+  A+ D+ F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQ 496
           + +
Sbjct: 176 HTE 178


>UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 853

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = +2

Query: 311 PVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEF 478
           P W +  +L AARLL    +  D+ DE EMR V+ ++YDV RYK +LD+A+DD+ F
Sbjct: 172 PGWRLRDILLAARLLMNERELDDYADEAEMRRVFGLVYDVLRYKQILDRALDDVGF 227


>UniRef50_Q18H13 Cluster: Homolog to NADH dehydrogenase, subunit L;
           n=1; Haloquadratum walsbyi DSM 16790|Rep: Homolog to
           NADH dehydrogenase, subunit L - Haloquadratum walsbyi
           (strain DSM 16790)
          Length = 528

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = -1

Query: 529 GIAKLCDVAGVLWVVSQELNIVHGLVQDTF-ISENVINNRI-NETHFLFVLEIDL 371
           GIA + ++ GV   V  EL I HG+V   F IS  VI   I   +H L+VL +++
Sbjct: 456 GIASIMEIGGVTPAVPTELTIAHGIVAGGFLISYVVIETEIYRRSHRLYVLLMNI 510


>UniRef50_A0Z6K9 Cluster: Putative uncharacterized protein; n=1;
           marine gamma proteobacterium HTCC2080|Rep: Putative
           uncharacterized protein - marine gamma proteobacterium
           HTCC2080
          Length = 454

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +3

Query: 474 SSWLTTHSTPATSHSLAIPXGVSETSLGGQTKGRARTRYTTIGKGAGQP 620
           S+  TTH  P+  H++A P      ++GGQT  RA T   + G  AG P
Sbjct: 76  SNSYTTHLWPSAPHTVATPLSFPIVNMGGQTTSRAYT--LSFGFEAGPP 122


>UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2;
           Alteromonadales|Rep: Putative uncharacterized protein -
           Pseudoalteromonas haloplanktis (strain TAC 125)
          Length = 191

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +3

Query: 258 CLRRILMHHHRFPLKLP-AQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFS 434
           C R I +HHH   + LP  +F  SD + +       H   +I+ +N K    + L+ T +
Sbjct: 48  CKRPIYLHHHPGEICLPGGKFEASDITLRTTALRELHEELNITPSNVKVFGQLPLYSTLT 107

Query: 435 DINVS 449
             N+S
Sbjct: 108 GFNIS 112


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 802,095,111
Number of Sequences: 1657284
Number of extensions: 15886509
Number of successful extensions: 38471
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 37119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38462
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 80342087756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -