SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30150.Seq
         (821 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA...    68   2e-10
UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:...    63   9e-09
UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3; Sophophora|...    62   2e-08
UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved ...    55   2e-06
UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2; ...    35   2.8  
UniRef50_Q090T6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.7  

>UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG13035-PA, isoform A - Tribolium castaneum
          Length = 548

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)
 Frame = +2

Query: 308 GPV-WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEFLA 484
           GP+ W +  + KAA +L +PP    F+DEQEMR VY++  DVFR+K VL QA++D  F  
Sbjct: 117 GPITWTVSDISKAACILAQPPAPTTFDDEQEMRRVYTLIYDVFRHKNVLTQALNDIAFFH 176

Query: 485 DYPQ 496
            YP+
Sbjct: 177 FYPE 180


>UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:
           ENSANGP00000011229 - Anopheles gambiae str. PEST
          Length = 667

 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 28/66 (42%), Positives = 40/66 (60%)
 Frame = +2

Query: 317 WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEFLADYPQ 496
           W +  +++A +LL +PP  V F+DE EMR VYS+  DV+R+K VL QA+ +  F   YP 
Sbjct: 121 WRLEDIVRAGKLLHQPPLPVQFDDEYEMRKVYSMIYDVYRFKLVLQQALRNIGFYESYPM 180

Query: 497 YTGNVT 514
                T
Sbjct: 181 LAHETT 186


>UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3;
           Sophophora|Rep: CG13035-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 739

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+  DVFRYK V+  A+ D  F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQ 496
           + +
Sbjct: 176 HTE 178


>UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 853

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/56 (46%), Positives = 35/56 (62%)
 Frame = +2

Query: 311 PVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEF 478
           P W +  +L AARLL    +  D+ DE EMR V+ +  DV RYK +LD+A+DD  F
Sbjct: 172 PGWRLRDILLAARLLMNERELDDYADEAEMRRVFGLVYDVLRYKQILDRALDDVGF 227


>UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2;
           Alteromonadales|Rep: Putative uncharacterized protein -
           Pseudoalteromonas haloplanktis (strain TAC 125)
          Length = 191

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 258 CLRXILMHHHRFPLKLP-AQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLXMTFS 434
           C R I +HHH   + LP  +F  SD + +       H   +I+ +N K    + L  T +
Sbjct: 48  CKRPIYLHHHPGEICLPGGKFEASDITLRTTALRELHEELNITPSNVKVFGQLPLYSTLT 107

Query: 435 DINVS-WTRPWTIXSSWLTTHSTPATSHSLAIPDGVSETS 551
             N+S +       + W   H+    S  L + D  +E +
Sbjct: 108 GFNISPFVGMLNKHTIWENDHNEVQASFLLPLRDLTNEAN 147


>UniRef50_Q090T6 Cluster: Putative uncharacterized protein; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Putative
           uncharacterized protein - Stigmatella aurantiaca DW4/3-1
          Length = 539

 Score = 34.3 bits (75), Expect = 3.7
 Identities = 25/68 (36%), Positives = 27/68 (39%), Gaps = 1/68 (1%)
 Frame = -1

Query: 647 PRQRSPFPLNGCXAPXNSCVARSCSALGLASQRRLANSIRNSQTM*RCRCTV-GSQPGTX 471
           PR RS  P         S  +RSCS    AS+R    S   S T     CT   S  GT 
Sbjct: 59  PRSRSRAPRCSMTWGCRSRASRSCSRRSSASRRSAGCSSARSGTPGMGTCTPRSSSTGTT 118

Query: 470 YRPWPGPR 447
              WP PR
Sbjct: 119 RTRWPAPR 126


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 674,012,016
Number of Sequences: 1657284
Number of extensions: 11526597
Number of successful extensions: 23926
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 23259
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23922
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 70914189703
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -