SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8T5I1 Cluster: Transcription factor; n=3; Culicidae|Re...    36   1.6  
UniRef50_A6QAN0 Cluster: TonB-dependent receptor; n=1; Sulfurovu...    34   4.9  
UniRef50_Q892K1 Cluster: Spore germination protein KC; n=1; Clos...    33   8.6  

>UniRef50_Q8T5I1 Cluster: Transcription factor; n=3; Culicidae|Rep:
           Transcription factor - Anopheles gambiae (African
           malaria mosquito)
          Length = 391

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 9/82 (10%)
 Frame = +3

Query: 279 DPEQIKEINNYYDIETTVTVEFDTGQAYRDFVAGPYFRNRIEDQITESYRPTRSPA---- 446
           DP++ ++ N+    +TT+ +E  TGQ  R F+    F N I++++ ESY PT   A    
Sbjct: 241 DPKEAEDTNDKTSKKTTL-MEV-TGQYERTFIT---FENDIDNKLFESYFPTPDAARKHR 295

Query: 447 -----TTVPSAYDDPDPQLYFR 497
                T +P+ Y DP  QL +R
Sbjct: 296 QICAVTRLPARYYDPITQLPYR 317


>UniRef50_A6QAN0 Cluster: TonB-dependent receptor; n=1; Sulfurovum
           sp. NBC37-1|Rep: TonB-dependent receptor - Sulfurovum
           sp. (strain NBC37-1)
          Length = 624

 Score = 33.9 bits (74), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 318 IETTVTVEFDTGQAYRDFVAGPYFRNRIEDQITESYRP 431
           ++ + T  FD   AY+  ++  YF NR+ED I   Y P
Sbjct: 435 LKPSYTKGFDISAAYKKLISVSYFNNRVEDNIDYVYDP 472


>UniRef50_Q892K1 Cluster: Spore germination protein KC; n=1;
           Clostridium tetani|Rep: Spore germination protein KC -
           Clostridium tetani
          Length = 383

 Score = 33.1 bits (72), Expect = 8.6
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = +3

Query: 204 PPDSESSGSAGCQRRPEQIFSKRNIDPEQIKEINNYYDIETTVTVEFDTGQAYRDFVAGP 383
           P DS+ +G+   +    +   K N++ ++I  +N Y DI+T ++   D+G  Y +     
Sbjct: 243 PVDSDGNGTVSLEILGSKREIKVNLNEDKIV-MNTYIDIDTAISELADSGINYINEEERN 301

Query: 384 YFRNRIEDQI 413
             +NR E+QI
Sbjct: 302 KLKNRAEEQI 311


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 706,950,664
Number of Sequences: 1657284
Number of extensions: 12695699
Number of successful extensions: 34307
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 32951
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34292
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 70377768045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -