SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30142.Seq
         (600 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q758T8 Cluster: SWR1-complex protein 3; n=1; Eremotheci...    32   9.0  

>UniRef50_Q758T8 Cluster: SWR1-complex protein 3; n=1; Eremothecium
           gossypii|Rep: SWR1-complex protein 3 - Ashbya gossypii
           (Yeast) (Eremothecium gossypii)
          Length = 688

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = +1

Query: 112 YIILYTLTRNFFEF*QFKKKILM*VGTLKTKERKREREIQ-CIFN*LNKPKWP 267
           Y++ + +  N  E  QFK K+L   G  K K  + E E+Q C+FN    P  P
Sbjct: 551 YLMSWIVVHNKKEIEQFKLKVLK--GLNKNKPNEEETEVQPCLFNVYEHPNCP 601


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 408,989,825
Number of Sequences: 1657284
Number of extensions: 6973155
Number of successful extensions: 11331
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10946
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11329
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42317807226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -