SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q14254 Cluster: Flotillin-2; n=66; Eumetazoa|Rep: Floti...   139   8e-32
UniRef50_Q4SUY2 Cluster: Chromosome undetermined SCAF13836, whol...   138   2e-31
UniRef50_UPI00015B63FC Cluster: PREDICTED: similar to ENSANGP000...   100   6e-20
UniRef50_O75955 Cluster: Flotillin-1; n=37; Eumetazoa|Rep: Floti...    97   4e-19
UniRef50_O13127 Cluster: Flotillin-1; n=33; Euteleostomi|Rep: Fl...    90   6e-17
UniRef50_UPI0000E2487B Cluster: PREDICTED: flotillin 2 isoform 3...    87   6e-16
UniRef50_Q036H0 Cluster: Membrane protease subunit, stomatin/pro...    82   2e-14
UniRef50_UPI00006A0CD3 Cluster: Flotillin-1.; n=1; Xenopus tropi...    78   3e-13
UniRef50_O32076 Cluster: Uncharacterized protein yuaG; n=23; Fir...    78   4e-13
UniRef50_Q67KD6 Cluster: Flottilin; n=3; Bacteria|Rep: Flottilin...    71   4e-11
UniRef50_A6G095 Cluster: Band 7 protein; n=1; Plesiocystis pacif...    70   7e-11
UniRef50_Q1EZZ0 Cluster: Band 7 protein:Flotillin; n=2; Clostrid...    66   9e-10
UniRef50_Q8YNN6 Cluster: Alr4528 protein; n=9; Cyanobacteria|Rep...    66   2e-09
UniRef50_Q030N2 Cluster: Membrane protease subunit, stomatin/pro...    64   5e-09
UniRef50_Q0IA68 Cluster: SPFH domain / Band 7 family protein; n=...    62   1e-08
UniRef50_A6G096 Cluster: Band 7 protein; n=1; Plesiocystis pacif...    61   3e-08
UniRef50_Q8YNN8 Cluster: Alr4526 protein; n=8; Cyanobacteria|Rep...    58   3e-07
UniRef50_Q1J186 Cluster: Band 7 protein; n=1; Deinococcus geothe...    56   2e-06
UniRef50_A6W9V0 Cluster: Band 7 protein precursor; n=2; Actinomy...    56   2e-06
UniRef50_A0JTU7 Cluster: Band 7 protein; n=4; Actinomycetales|Re...    55   2e-06
UniRef50_Q9K771 Cluster: Epidermal surface antigen; n=3; Bacilla...    54   4e-06
UniRef50_A0QSL1 Cluster: Spfh domain/band 7 family protein, puta...    53   1e-05
UniRef50_A1GA48 Cluster: Band 7 protein precursor; n=1; Salinisp...    52   3e-05
UniRef50_UPI000050FA53 Cluster: COG2268: Uncharacterized protein...    51   3e-05
UniRef50_Q0RTA5 Cluster: Putative membrane protein; putative sig...    51   3e-05
UniRef50_A7CTA1 Cluster: Band 7 protein; n=1; Opitutaceae bacter...    48   3e-04
UniRef50_A3CLK3 Cluster: Membrane protease subunits, stomatin/pr...    48   4e-04
UniRef50_A5FLN0 Cluster: Band 7 protein; n=3; cellular organisms...    46   0.001
UniRef50_A7B8N4 Cluster: Putative uncharacterized protein; n=1; ...    45   0.003
UniRef50_Q3A887 Cluster: Putative membrane protein; n=1; Pelobac...    44   0.004
UniRef50_Q8A001 Cluster: Flotillin-like protein; n=5; Bacteroide...    44   0.005
UniRef50_UPI00003825B5 Cluster: COG2268: Uncharacterized protein...    43   0.009
UniRef50_A6TQ61 Cluster: Band 7 protein; n=4; Bacteria|Rep: Band...    43   0.012
UniRef50_Q2QAP5 Cluster: Conserved hypothetical secreted protein...    41   0.037
UniRef50_A6PSW7 Cluster: Band 7 protein precursor; n=1; Victival...    40   0.086
UniRef50_A6KZP1 Cluster: Flotillin-like protein; n=1; Bacteroide...    40   0.086
UniRef50_Q8NSL8 Cluster: Uncharacterized BCR; n=5; Bacteria|Rep:...    38   0.46 
UniRef50_A7BLA5 Cluster: Band 7 protein; n=1; Beggiatoa sp. SS|R...    38   0.46 
UniRef50_UPI0000584725 Cluster: PREDICTED: similar to NPAS3 (MOP...    37   0.61 
UniRef50_A3ZTY8 Cluster: Flotillin-like protein; n=1; Blastopire...    36   1.4  
UniRef50_Q9VZI3 Cluster: Unc-112-related protein; n=9; Endoptery...    36   1.9  
UniRef50_A5TWU7 Cluster: Flotillin family protein; n=1; Fusobact...    35   2.4  
UniRef50_A6RUN0 Cluster: Predicted protein; n=1; Botryotinia fuc...    35   3.2  
UniRef50_Q4P0V7 Cluster: Putative uncharacterized protein; n=1; ...    34   4.3  
UniRef50_A7RK66 Cluster: Predicted protein; n=1; Nematostella ve...    34   5.7  
UniRef50_Q4RV90 Cluster: Chromosome 15 SCAF14992, whole genome s...    33   7.5  
UniRef50_Q15X74 Cluster: Sensor protein; n=1; Pseudoalteromonas ...    33   9.9  
UniRef50_A1SE82 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  

>UniRef50_Q14254 Cluster: Flotillin-2; n=66; Eumetazoa|Rep:
           Flotillin-2 - Homo sapiens (Human)
          Length = 379

 Score =  139 bits (337), Expect = 8e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>UniRef50_Q4SUY2 Cluster: Chromosome undetermined SCAF13836, whole
           genome shotgun sequence; n=6; Euteleostomi|Rep:
           Chromosome undetermined SCAF13836, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 435

 Score =  138 bits (334), Expect = 2e-31
 Identities = 80/161 (49%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +3

Query: 177 ADHETYH-SGWM-GMGLVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMN 350
           +D +TY   GW     L+S   R +   E+MTL P CE VETA+GV +TVTGVAQ K+M 
Sbjct: 22  SDSKTYVVGGWSWAWWLISDIKRISL--EIMTLQPRCEEVETAEGVAITVTGVAQVKVMT 79

Query: 351 EDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLR 530
           E +LL  ACEQFLGK+V EIK  VLQTLEGHLR+ILGTLTVE++Y+DRDQFA    +   
Sbjct: 80  ELDLLPVACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAA 139

Query: 531 RTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
                         ++         +SLGK  TA V+RDA+
Sbjct: 140 PDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDAD 180



 Score = 77.4 bits (182), Expect = 5e-13
 Identities = 31/48 (64%), Positives = 40/48 (83%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISLK 258
           MGN  TVGPNEAL+VSGGC G  +K  +VGGW+WAW L++D++RISL+
Sbjct: 1   MGNCLTVGPNEALVVSGGCCGSDSKTYVVGGWSWAWWLISDIKRISLE 48


>UniRef50_UPI00015B63FC Cluster: PREDICTED: similar to
           ENSANGP00000009431; n=2; Apocrita|Rep: PREDICTED:
           similar to ENSANGP00000009431 - Nasonia vitripennis
          Length = 433

 Score =  100 bits (239), Expect = 6e-20
 Identities = 49/83 (59%), Positives = 63/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNE-DELLTTACEQFLGKTVKEIKMTVLQTLE 437
           MTL      V T+QGVP++VTG+AQ KI  + +E+L+TACEQFLGKT  EI    L TLE
Sbjct: 50  MTLQVESPTVYTSQGVPISVTGIAQVKIQGQNEEMLSTACEQFLGKTEDEIHNIALVTLE 109

Query: 438 GHLRAILGTLTVEEVYKDRDQFA 506
           GH RAI+G++TVEE+YKDR +F+
Sbjct: 110 GHQRAIMGSMTVEEIYKDRKKFS 132



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEAL+VSG C+  +    + GG  + W +V  VQ+ISL
Sbjct: 8   TCGPNEALVVSGCCY--SKPLLVPGGRVFVWPIVQQVQKISL 47



 Score = 34.3 bits (75), Expect = 4.3
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = +2

Query: 512 VREVAAPDVGRMGIEILSFTIKDV----YDDVQYLGQLGEVRNGQ 634
           V EVA+ D+  MGI ++S+T+KD+    Y+   YL  LG  R  +
Sbjct: 135 VFEVASSDLVNMGITVVSYTLKDIRDEEYEQKGYLKALGMARTAE 179


>UniRef50_O75955 Cluster: Flotillin-1; n=37; Eumetazoa|Rep:
           Flotillin-1 - Homo sapiens (Human)
          Length = 427

 Score = 97.5 bits (232), Expect = 4e-19
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 1.1
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>UniRef50_O13127 Cluster: Flotillin-1; n=33; Euteleostomi|Rep:
           Flotillin-1 - Carassius auratus (Goldfish)
          Length = 423

 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 52/131 (39%), Positives = 72/131 (54%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   + V T  GVP++VTG+AQ KI  ++ ++L   C+ FLGK+  +I    L+TLE
Sbjct: 46  LTLNVKSDKVYTRHGVPVSVTGIAQMKIQGQNKQMLAAKCQMFLGKSESDIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  LTVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLFNMGISVVSYTLKDVHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 38.3 bits (85), Expect = 0.26
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +1

Query: 127 HTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           +T GPNEA++VSG C  P     I GG  + +  V  +QRISL
Sbjct: 3   YTCGPNEAMVVSGFCRSPPV--MISGGSVFVFPCVQQIQRISL 43


>UniRef50_UPI0000E2487B Cluster: PREDICTED: flotillin 2 isoform 3;
           n=2; Pan troglodytes|Rep: PREDICTED: flotillin 2 isoform
           3 - Pan troglodytes
          Length = 405

 Score = 87.0 bits (206), Expect = 6e-16
 Identities = 67/179 (37%), Positives = 86/179 (48%)
 Frame = +3

Query: 255 EVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTL 434
           E+MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLG              
Sbjct: 48  EIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLG-------------- 93

Query: 435 EGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASL 614
                    TLTVE++Y+DRDQFA    +                 ++         +SL
Sbjct: 94  ---------TLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSL 144

Query: 615 GKFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
           GK  TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 145 GKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 202



 Score = 79.0 bits (186), Expect = 2e-13
 Identities = 32/48 (66%), Positives = 38/48 (79%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISLK 258
           MGN HTVGPNEAL+VSGGC G   K+ + GGWAWAW  ++D QRISL+
Sbjct: 1   MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLE 48



 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 32/39 (82%), Positives = 34/39 (87%)
 Frame = +2

Query: 509 LVREVAAPDVGRMGIEILSFTIKDVYDDVQYLGQLGEVR 625
           LVREVAAPDVGRMGIEILSFTIKDVYD V YL  LG+ +
Sbjct: 110 LVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQ 148


>UniRef50_Q036H0 Cluster: Membrane protease subunit,
           stomatin/prohibitin family; n=1; Lactobacillus casei
           ATCC 334|Rep: Membrane protease subunit,
           stomatin/prohibitin family - Lactobacillus casei (strain
           ATCC 334)
          Length = 505

 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 48/121 (39%), Positives = 64/121 (52%)
 Frame = +3

Query: 288 VETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTL 467
           V T QGVP+ V G    KI +  E + TA EQFLGK  ++I     + LEGHLRAILGTL
Sbjct: 92  VYTQQGVPIIVNGTVILKIGSSQEEVATAAEQFLGKNDEQINSEATEILEGHLRAILGTL 151

Query: 468 TVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRD 647
           TVE+ Y++RD FA            +   +     ++     +    SLGK   A VK++
Sbjct: 152 TVEDTYQNRDAFAEKVQDVASSDLAKMGLQIISFTIKDIADKNGYLDSLGKKQIAEVKKN 211

Query: 648 A 650
           A
Sbjct: 212 A 212


>UniRef50_UPI00006A0CD3 Cluster: Flotillin-1.; n=1; Xenopus
           tropicalis|Rep: Flotillin-1. - Xenopus tropicalis
          Length = 414

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  E+    L+TLE
Sbjct: 47  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLE 106

Query: 438 GHLRAILGTLTVE 476
           GH RAI+  +TVE
Sbjct: 107 GHQRAIMAHMTVE 119



 Score = 37.9 bits (84), Expect = 0.35
 Identities = 20/43 (46%), Positives = 25/43 (58%)
 Frame = +1

Query: 127 HTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           +T GPNEA++VSG C  P     I GG  +    V  +QRISL
Sbjct: 4   YTCGPNEAMVVSGFCRSPPV--MIAGGRVFVLPCVQQIQRISL 44


>UniRef50_O32076 Cluster: Uncharacterized protein yuaG; n=23;
           Firmicutes|Rep: Uncharacterized protein yuaG - Bacillus
           subtilis
          Length = 509

 Score = 77.8 bits (183), Expect = 4e-13
 Identities = 45/122 (36%), Positives = 66/122 (54%)
 Frame = +3

Query: 288 VETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTL 467
           V T QGVP+   G A  KI      + TA EQFLGK+  + +    + LEGHLR+ILG++
Sbjct: 91  VYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSM 150

Query: 468 TVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRD 647
           TVEE+YK+R++F+    +   +   +         ++     +    SLGK   A VKRD
Sbjct: 151 TVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRD 210

Query: 648 AE 653
           A+
Sbjct: 211 AD 212


>UniRef50_Q67KD6 Cluster: Flottilin; n=3; Bacteria|Rep: Flottilin -
           Symbiobacterium thermophilum
          Length = 515

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 34/71 (47%), Positives = 46/71 (64%)
 Frame = +3

Query: 294 TAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTV 473
           T QGV +TV  VAQ K+ ++ E + TA EQFL KT KE    +   +EGHLR I+G LTV
Sbjct: 79  TVQGVAVTVEAVAQIKVKSDTESILTAAEQFLSKTTKEQNEILKLVMEGHLRGIIGQLTV 138

Query: 474 EEVYKDRDQFA 506
           E++ K+ +  A
Sbjct: 139 EQIVKEPEMVA 149



 Score = 37.5 bits (83), Expect = 0.46
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 512 VREVAAPDVGRMGIEILSFTIKDVYDDVQYLGQLG 616
           +R   A D+ +MG+E++SFTIK++ D   Y+  +G
Sbjct: 152 MRANVADDMSKMGLEVISFTIKEIKDKNDYINNMG 186


>UniRef50_A6G095 Cluster: Band 7 protein; n=1; Plesiocystis pacifica
           SIR-1|Rep: Band 7 protein - Plesiocystis pacifica SIR-1
          Length = 422

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 37/117 (31%), Positives = 66/117 (56%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           G+PL+V GVA  K+   + LL    E+FLGK+ +EI     +TLEG+LR +L  LT E+V
Sbjct: 100 GIPLSVQGVANIKVPGSEPLLNNCLERFLGKSREEIMKIARETLEGNLRGVLAGLTPEQV 159

Query: 483 YKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
            KD+++FA   A+   +   +        +++  +       ++G+  +A ++R+A+
Sbjct: 160 NKDKEEFAAKLAEEAEQDLSKLGLVMDTLKIQNVSDDVGYLDAIGRQISAQIRRNAQ 216


>UniRef50_Q1EZZ0 Cluster: Band 7 protein:Flotillin; n=2;
           Clostridium|Rep: Band 7 protein:Flotillin - Clostridium
           oremlandii OhILAs
          Length = 475

 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 4/137 (2%)
 Frame = +3

Query: 255 EVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQF-LGK---TVKEIKMTV 422
           E M +    +   T QGV +   GVA  K+ ++ E + +A EQF +G    T++ IK T 
Sbjct: 66  ENMKIEVRTDSALTEQGVDIRADGVAVLKVKSDMESILSAVEQFNMGTEKATIEFIKDTA 125

Query: 423 LQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSI 602
              LEG LR I+  ++VEE+Y+DR++FA    +       E         +R     +  
Sbjct: 126 KDVLEGKLREIISKMSVEEIYRDREKFASQVQEVAALDLAEMGLEIKAFTIRDINDDNGY 185

Query: 603 WASLGKFATANVKRDAE 653
             +LGK   A VKRDA+
Sbjct: 186 LIALGKSRIAEVKRDAQ 202



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 21/38 (55%), Positives = 28/38 (73%)
 Frame = +2

Query: 512 VREVAAPDVGRMGIEILSFTIKDVYDDVQYLGQLGEVR 625
           V+EVAA D+  MG+EI +FTI+D+ DD  YL  LG+ R
Sbjct: 156 VQEVAALDLAEMGLEIKAFTIRDINDDNGYLIALGKSR 193


>UniRef50_Q8YNN6 Cluster: Alr4528 protein; n=9; Cyanobacteria|Rep:
           Alr4528 protein - Anabaena sp. (strain PCC 7120)
          Length = 389

 Score = 65.7 bits (153), Expect = 2e-09
 Identities = 32/68 (47%), Positives = 44/68 (64%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           G+PLTV GVA  KI  E+  +  A E+ LGK+ K+I+     TLEG+LR +L  LT E+V
Sbjct: 58  GIPLTVEGVANIKIAGEEPTIHNAIERLLGKSRKDIEQLAKDTLEGNLRGVLANLTPEQV 117

Query: 483 YKDRDQFA 506
            +D+  FA
Sbjct: 118 NEDKITFA 125


>UniRef50_Q030N2 Cluster: Membrane protease subunit,
           stomatin/prohibitin family; n=3; Lactococcus lactis|Rep:
           Membrane protease subunit, stomatin/prohibitin family -
           Lactococcus lactis subsp. cremoris (strain SK11)
          Length = 503

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 EYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILG 461
           E V +   +P+TV   A  K+ +  + + TA EQFLGK  ++      Q L GHLRAI+G
Sbjct: 88  EKVLSKDKIPVTVEATAMIKVGSTLQDIATAAEQFLGKRDEQRDAMADQVLRGHLRAIVG 147

Query: 462 TLTVEEVYKDRDQFAG 509
           T+TV E+ +DR++F+G
Sbjct: 148 TMTVSELIEDRNKFSG 163


>UniRef50_Q0IA68 Cluster: SPFH domain / Band 7 family protein; n=1;
           Synechococcus sp. CC9311|Rep: SPFH domain / Band 7
           family protein - Synechococcus sp. (strain CC9311)
          Length = 451

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 3/134 (2%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQ---GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQT 431
           +TL P+   V+ A    G PL +  +A  K+  + ++   A E+FLG+  +EI     + 
Sbjct: 109 VTLLPVLVEVKNAYSNGGTPLNIQAIANVKVSTDPDVRNNAIERFLGRDSREIIQVAQEN 168

Query: 432 LEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWAS 611
           LEG+LR++L  LT EEV +DR +FA   AK +         +    ++++ +       S
Sbjct: 169 LEGNLRSVLAQLTPEEVNEDRLRFAEQIAKDVGDDLRRLGLQLDTLKIQSVSDDVDYLNS 228

Query: 612 LGKFATANVKRDAE 653
           + +   A + RDAE
Sbjct: 229 ISRRRVAQIVRDAE 242


>UniRef50_A6G096 Cluster: Band 7 protein; n=1; Plesiocystis pacifica
           SIR-1|Rep: Band 7 protein - Plesiocystis pacifica SIR-1
          Length = 503

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 37/131 (28%), Positives = 68/131 (51%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           ++++ + E   +A  +PL +  +A  KI ++  L+  A E+FLG+  +EI +   QTLEG
Sbjct: 113 LSIDIVVENAYSAGNIPLRIHAIANVKIHSDPTLIRNAIERFLGRERREIYVVAQQTLEG 172

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
            +R ++  +T E+V +DR  FA    +   +   +        +++     ++   SLG+
Sbjct: 173 AVREVVADMTPEQVNEDRLTFAEKLIESAVKDFNKLGLELDTLKIQNVADSTNYLDSLGR 232

Query: 621 FATANVKRDAE 653
              A V RDAE
Sbjct: 233 PQIARVLRDAE 243


>UniRef50_Q8YNN8 Cluster: Alr4526 protein; n=8; Cyanobacteria|Rep:
           Alr4526 protein - Anabaena sp. (strain PCC 7120)
          Length = 447

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 36/117 (30%), Positives = 60/117 (51%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           G PL +  +A  KI ++  ++  A E+FL +   E+     +TLEG+LR ++ TLT EE+
Sbjct: 123 GTPLNIQAIANVKISSDPVVVGNAIERFLDRDRSELARVSRETLEGYLRGVVATLTPEEL 182

Query: 483 YKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
            +DR  FA   A  + R   +   +    ++++ +       S G+   A V RDAE
Sbjct: 183 NEDRLSFAQRIASDVSRDLSKLGLQLDTLKIQSVSDDVDYLKSWGRKQIALVIRDAE 239


>UniRef50_Q1J186 Cluster: Band 7 protein; n=1; Deinococcus
           geothermalis DSM 11300|Rep: Band 7 protein - Deinococcus
           geothermalis (strain DSM 11300)
          Length = 538

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 28/68 (41%), Positives = 42/68 (61%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           G+PL +  VA  KI  ++  L+ A E+FL    + +   V  TLEG+LR ++ TLT EE+
Sbjct: 93  GIPLKIHAVANVKINAQEPQLSNAIERFLDVPRENVTNIVRDTLEGNLRGVVATLTPEEI 152

Query: 483 YKDRDQFA 506
            +DR +FA
Sbjct: 153 NEDRLRFA 160


>UniRef50_A6W9V0 Cluster: Band 7 protein precursor; n=2;
           Actinomycetales|Rep: Band 7 protein precursor -
           Kineococcus radiotolerans SRS30216
          Length = 513

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 29/69 (42%), Positives = 43/69 (62%)
 Frame = +3

Query: 300 QGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEE 479
           QG+ L V GVA  K+   ++ +  A ++FL +  KEI+    + L G LR ++GTLTVEE
Sbjct: 100 QGIRLNVDGVAIVKVGGTEDFVRAASQRFLQQQ-KEIEPFTQEVLAGSLRGVIGTLTVEE 158

Query: 480 VYKDRDQFA 506
           + +DR  FA
Sbjct: 159 IIRDRVAFA 167


>UniRef50_A0JTU7 Cluster: Band 7 protein; n=4; Actinomycetales|Rep:
           Band 7 protein - Arthrobacter sp. (strain FB24)
          Length = 477

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/69 (37%), Positives = 44/69 (63%)
 Frame = +3

Query: 294 TAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTV 473
           T+QG+ + V GV   KI +    +  A  +FLG+  K ++  V    EGHLR+I+G++T+
Sbjct: 94  TSQGIQVIVEGVVIYKIGDAPPFIANAARRFLGQQPK-MESQVYNVFEGHLRSIIGSMTM 152

Query: 474 EEVYKDRDQ 500
           EE+ ++RD+
Sbjct: 153 EEIIRERDK 161


>UniRef50_Q9K771 Cluster: Epidermal surface antigen; n=3;
           Bacillaceae|Rep: Epidermal surface antigen - Bacillus
           halodurans
          Length = 518

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 28/72 (38%), Positives = 42/72 (58%)
 Frame = +3

Query: 288 VETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTL 467
           V T  GVP+    VA   + +  + +    EQFLGK  KEI+  + + L  +LRAIL  +
Sbjct: 99  VFTNGGVPIIADAVAMVTVSDTLKGIAIYAEQFLGKEQKEIESEISEVLNANLRAILSKM 158

Query: 468 TVEEVYKDRDQF 503
           TVE++ +DR+ F
Sbjct: 159 TVEQINEDREGF 170


>UniRef50_A0QSL1 Cluster: Spfh domain/band 7 family protein,
           putative; n=2; Mycobacterium|Rep: Spfh domain/band 7
           family protein, putative - Mycobacterium smegmatis
           (strain ATCC 700084 / mc(2)155)
          Length = 526

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 34/116 (29%), Positives = 55/116 (47%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           GVP+ V  V   +I + DE + TA ++FL   + E++  + + L G LR I  T+TVE++
Sbjct: 85  GVPVNVEAVGLVRIGSADEAVQTAVQRFLTSDLNELQRQINEILAGSLRGITATMTVEDL 144

Query: 483 YKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
             +RD  A    +                ++   +  +    SLG+   A VKRDA
Sbjct: 145 NSNRDTLARSVVEEAGADLARIGMEVDVLKIAGISDRNGYLESLGQRRIAEVKRDA 200


>UniRef50_A1GA48 Cluster: Band 7 protein precursor; n=1; Salinispora
           arenicola CNS205|Rep: Band 7 protein precursor -
           Salinispora arenicola CNS205
          Length = 459

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 37/117 (31%), Positives = 56/117 (47%)
 Frame = +3

Query: 300 QGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEE 479
           QG+   + GVA  K+   +  +  A ++FL +   EI+    + L G LR+I+G LTVEE
Sbjct: 96  QGIRAELHGVAIVKVGGTENAIRAAAQRFL-RQQDEIEDFTREVLAGALRSIVGRLTVEE 154

Query: 480 VYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
           V +DR  FA   A+    +           +L+      S  A LG+   A V +DA
Sbjct: 155 VIRDRAAFASAVAEEAEHSMTNQGLVLDTFQLQDILAEGSYLADLGRPEAARVLKDA 211


>UniRef50_UPI000050FA53 Cluster: COG2268: Uncharacterized protein
           conserved in bacteria; n=1; Brevibacterium linens
           BL2|Rep: COG2268: Uncharacterized protein conserved in
           bacteria - Brevibacterium linens BL2
          Length = 600

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/68 (39%), Positives = 43/68 (63%)
 Frame = +3

Query: 303 GVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEV 482
           G+ L + GVAQ K+   +E +  A ++FL +   +I+    + L G LRA++GTLTVE++
Sbjct: 89  GIALRLHGVAQVKVGGTEEDVRKAAQRFLDQQ-DQIEPYSTEILSGTLRAVVGTLTVEQI 147

Query: 483 YKDRDQFA 506
            +DR  FA
Sbjct: 148 IQDRASFA 155


>UniRef50_Q0RTA5 Cluster: Putative membrane protein; putative
           signaling pathway G-protein coupled receptor protein;
           n=1; Frankia alni ACN14a|Rep: Putative membrane protein;
           putative signaling pathway G-protein coupled receptor
           protein - Frankia alni (strain ACN14a)
          Length = 386

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +3

Query: 294 TAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTV 473
           T QG+ L V  V   K+ N+ E +  A ++FL    +   +T  +   GHLR+I+G++TV
Sbjct: 61  THQGISLNVRAVIAFKVGNDSESIVNAGQRFLSDQGQMAVLTG-RIFSGHLRSIIGSMTV 119

Query: 474 EEVYKDRDQFA 506
           EE+ +DR + A
Sbjct: 120 EEIIRDRQKLA 130


>UniRef50_A7CTA1 Cluster: Band 7 protein; n=1; Opitutaceae bacterium
           TAV2|Rep: Band 7 protein - Opitutaceae bacterium TAV2
          Length = 641

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 34/155 (21%), Positives = 63/155 (40%), Gaps = 1/155 (0%)
 Frame = +3

Query: 192 YHSG-WMGMGLVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLT 368
           YH G    M  V  YG     P  ++++       ++Q + +         +  E  +  
Sbjct: 185 YHGGATFVMPFVQSYGYLDLTP--ISIDIELRGALSSQNIRIDAPASFTIGVSTEPTVTQ 242

Query: 369 TACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEW 548
            A  + LG+T+ E+K    + + G +R +  ++T+EE+  DR++      K +     + 
Sbjct: 243 NAATRLLGRTMDEVKQLASEIIMGQMRVVFASMTIEEINGDREKLIASITKGVEVELHKV 302

Query: 549 ESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
             R     +R     S    +LGK A A    DA+
Sbjct: 303 GLRMINGNIRDIKDQSGYIDALGKEAAAKAINDAQ 337


>UniRef50_A3CLK3 Cluster: Membrane protease subunits,
           stomatin/prohibitin-like protein (SPFH domain/band 7
           family), putative; n=6; Streptococcus|Rep: Membrane
           protease subunits, stomatin/prohibitin-like protein
           (SPFH domain/band 7 family), putative - Streptococcus
           sanguinis (strain SK36)
          Length = 492

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 23/75 (30%), Positives = 38/75 (50%)
 Frame = +3

Query: 282 EYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILG 461
           E V T   + +      + KI   DE++  A E FL     +I  +V   LEG+LR ++G
Sbjct: 78  EAVPTLDFINVRADAAVKLKIGTTDEMIARAAENFLNWNTTDISNSVQDVLEGNLREVIG 137

Query: 462 TLTVEEVYKDRDQFA 506
            + + ++  DR +FA
Sbjct: 138 QMELRKMVNDRQEFA 152



 Score = 33.9 bits (74), Expect = 5.7
 Identities = 14/48 (29%), Positives = 28/48 (58%)
 Frame = +2

Query: 473 RRGVQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDDVQYLGQLG 616
           R+ V  +      V++  APD+ +MG+E+++FT++   D+   +  LG
Sbjct: 142 RKMVNDRQEFASKVQDNVAPDLAKMGLEVIAFTVQSFSDEGGVIDNLG 189


>UniRef50_A5FLN0 Cluster: Band 7 protein; n=3; cellular
           organisms|Rep: Band 7 protein - Flavobacterium
           johnsoniae UW101
          Length = 504

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +3

Query: 342 IMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQF 503
           I  E + + TA E+ LG + ++++      L G LR ++ T+T+EE+  DRD+F
Sbjct: 97  ISTESDSMNTAAERLLGLSYEQVQELAKDILFGQLRLVIATMTIEEINSDRDKF 150


>UniRef50_A7B8N4 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus gnavus ATCC 29149|Rep: Putative
           uncharacterized protein - Ruminococcus gnavus ATCC 29149
          Length = 504

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 17/76 (22%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +3

Query: 282 EYVETAQGVPLTVTGVAQCKI-MNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAIL 458
           +Y+ T   + + V  +AQ  + ++ +++   A   FL +   +++  + ++L+G+LR I+
Sbjct: 91  DYIPTKDFINIKVDAIAQVAMEVSNNQVSAVAMRNFLNRKADDVRSMITESLQGNLREII 150

Query: 459 GTLTVEEVYKDRDQFA 506
           GT+ ++ + +D+ +F+
Sbjct: 151 GTMDLKSICQDKAKFS 166


>UniRef50_Q3A887 Cluster: Putative membrane protein; n=1; Pelobacter
           carbinolicus DSM 2380|Rep: Putative membrane protein -
           Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
          Length = 519

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 26/101 (25%), Positives = 49/101 (48%)
 Frame = +3

Query: 201 GWMGMGLVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACE 380
           G M   L+  Y   +  P  MT+N   +   + Q + + V       I  E +++T A E
Sbjct: 56  GTMVWPLIQDYAYLSLTP--MTINIPLQKALSMQNIRINVPSTFTVGISTESQIMTAAAE 113

Query: 381 QFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQF 503
           + L     +I+    + + G LR  + +LT+E++ +DR++F
Sbjct: 114 RLLHLGQHQIEEMAKEIIFGQLRLTVASLTIEQINQDRERF 154


>UniRef50_Q8A001 Cluster: Flotillin-like protein; n=5;
           Bacteroides|Rep: Flotillin-like protein - Bacteroides
           thetaiotaomicron
          Length = 552

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = +3

Query: 294 TAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTV 473
           +AQ + + V       I  + E++  A E+ LG T+ + +  +   + G +R ++  +T+
Sbjct: 85  SAQNIRVDVPTTITVAISTDPEVMQNAAERMLGLTMDDKQNLITDVVYGQMRLVIADMTI 144

Query: 474 EEVYKDRDQF 503
           EE+  DRD+F
Sbjct: 145 EELNSDRDKF 154


>UniRef50_UPI00003825B5 Cluster: COG2268: Uncharacterized protein
           conserved in bacteria; n=1; Magnetospirillum
           magnetotacticum MS-1|Rep: COG2268: Uncharacterized
           protein conserved in bacteria - Magnetospirillum
           magnetotacticum MS-1
          Length = 128

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 32/124 (25%), Positives = 63/124 (50%), Gaps = 3/124 (2%)
 Frame = +3

Query: 306 VPLTVTGVAQCKIMNEDELLTTACEQFLGK--TVKEIKMTVLQTLEGHLRAILGTLTVEE 479
           + + +      K+  ++E +  A ++FL +  T+ EI   + ++LEG LR+I+G +T+E+
Sbjct: 6   IKIAIKASINFKVRGDEEGVRRAAQRFLSQQGTLTEI---IKESLEGSLRSIVGDMTIEQ 62

Query: 480 VYKDRDQFAGWYAKWLRR-TSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAER 656
           +  DR   +    +  +   SE+       +    ST  S   A+LG+  +A  ++ AE 
Sbjct: 63  IISDRKGLSDRVVESTKADLSEQGLQVDLLNISDISTPGSDYLANLGRAESARARQVAES 122

Query: 657 PCRS 668
           P R+
Sbjct: 123 PSRA 126


>UniRef50_A6TQ61 Cluster: Band 7 protein; n=4; Bacteria|Rep: Band 7
           protein - Alkaliphilus metalliredigens QYMF
          Length = 477

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 27/105 (25%), Positives = 47/105 (44%)
 Frame = +3

Query: 342 IMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAK 521
           I  E  ++  A E+ LG  + EI+      + G LR ++ T+ +EE+  DRD+F    + 
Sbjct: 105 ISTEPGIMQNAAERLLGLGLAEIQELAKDIIFGQLRLVIATMDIEEINTDRDKFLEAVSS 164

Query: 522 WLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAER 656
            +    ++   R     +      S    +LGK A A    DA++
Sbjct: 165 NVESELKKIGLRLINVNVTDINDESGYIQALGKEAAAKAVNDAKK 209


>UniRef50_Q2QAP5 Cluster: Conserved hypothetical secreted protein;
           n=2; environmental samples|Rep: Conserved hypothetical
           secreted protein - uncultured marine group II
           euryarchaeote HF70_59C08
          Length = 465

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 26/110 (23%), Positives = 49/110 (44%)
 Frame = +3

Query: 174 RADHETYHSGWMGMGLVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNE 353
           RA    +    M   L+  Y + + +P  MT+        + Q + + V       I  +
Sbjct: 49  RASRCIHGGATMVWPLIQDYKKLSLVP--MTIQINLTNALSLQNIRIHVPSTFTVGISTD 106

Query: 354 DELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQF 503
             ++  A E+ L    +EI+    + + G LR  + +LT+E++ +DRD F
Sbjct: 107 PTIMNNAAERLLHLKTQEIENMASEIIFGQLRLTVASLTIEQINQDRDNF 156


>UniRef50_A6PSW7 Cluster: Band 7 protein precursor; n=1; Victivallis
           vadensis ATCC BAA-548|Rep: Band 7 protein precursor -
           Victivallis vadensis ATCC BAA-548
          Length = 525

 Score = 39.9 bits (89), Expect = 0.086
 Identities = 23/89 (25%), Positives = 42/89 (47%)
 Frame = +3

Query: 237 RPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKM 416
           RP  IP V   N +C+     Q + + V  +    +    E++  A E+  G+T + I  
Sbjct: 69  RPLQIP-VNLDNALCK-----QNIRINVPSIFTVGVSTSPEIMGNAAERLFGQTPEAIAE 122

Query: 417 TVLQTLEGHLRAILGTLTVEEVYKDRDQF 503
                + G LR ++ ++ +EE+  DR+ F
Sbjct: 123 LAKDIIFGQLRLVIASMLIEEINADRETF 151


>UniRef50_A6KZP1 Cluster: Flotillin-like protein; n=1; Bacteroides
           vulgatus ATCC 8482|Rep: Flotillin-like protein -
           Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC
           11154)
          Length = 566

 Score = 39.9 bits (89), Expect = 0.086
 Identities = 28/115 (24%), Positives = 53/115 (46%)
 Frame = +3

Query: 306 VPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVY 485
           VP T+T VA   +  E E++  A E+ LG  ++  +  +   + G +R ++  +T+E++ 
Sbjct: 92  VPTTIT-VA---VSTEPEVMQNAAERLLGLNIEAQQELIKDVVYGQMRLVIADMTIEQLN 147

Query: 486 KDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            DRD F     K +    +++        +      +    +LGK A A  K +A
Sbjct: 148 SDRDTFLENCRKNIDSELKKFGLYLMNINISDIRDEADYIVNLGKEAEAKAKNEA 202


>UniRef50_Q8NSL8 Cluster: Uncharacterized BCR; n=5; Bacteria|Rep:
           Uncharacterized BCR - Corynebacterium glutamicum
           (Brevibacterium flavum)
          Length = 460

 Score = 37.5 bits (83), Expect = 0.46
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +3

Query: 291 ETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLT 470
           ++   V L V  VA  KI +E E +  A ++F     KEI       LEG LR ++   T
Sbjct: 85  QSDDNVTLNVEAVALVKIGSEAEFIRRAAQRFASSD-KEIVRFTQDQLEGVLRGVVAQQT 143

Query: 471 VEEVYKDRDQFA 506
           V  + ++R +F+
Sbjct: 144 VTSLMRERKKFS 155


>UniRef50_A7BLA5 Cluster: Band 7 protein; n=1; Beggiatoa sp. SS|Rep:
           Band 7 protein - Beggiatoa sp. SS
          Length = 338

 Score = 37.5 bits (83), Expect = 0.46
 Identities = 27/118 (22%), Positives = 49/118 (41%)
 Frame = +3

Query: 300 QGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEE 479
           Q + + V       I   +E++  A  + LG T   I+    + + G LRA + T+ +E+
Sbjct: 17  QNIRVNVPSKFTFGIGTTEEMMMNAAIRLLGLTPSAIEEMAQEIILGQLRATIATMNIEQ 76

Query: 480 VYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
           +  DRD F     + +    ++   R     +   T  S    +LG+ A A     A+
Sbjct: 77  INADRDTFGQKVMENIEDELKKIGLRLINVNIADITDESGYLKALGEKAAAEAINQAK 134


>UniRef50_UPI0000584725 Cluster: PREDICTED: similar to NPAS3 (MOP6);
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to NPAS3 (MOP6) - Strongylocentrotus purpuratus
          Length = 933

 Score = 37.1 bits (82), Expect = 0.61
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 2/46 (4%)
 Frame = -2

Query: 221 QAHAHPPTMVRFV-VGPKQPPETIS-ASLGPTVWMLPILNPFTVTF 90
           Q + HPP ++ FV VG   PP TIS   L PT++M  +   FT+TF
Sbjct: 310 QYNHHPPNVLGFVAVGYSLPPPTISEVRLDPTMFMCKVDLDFTITF 355


>UniRef50_A3ZTY8 Cluster: Flotillin-like protein; n=1;
           Blastopirellula marina DSM 3645|Rep: Flotillin-like
           protein - Blastopirellula marina DSM 3645
          Length = 548

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = +3

Query: 294 TAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTV 473
           +++ + + V       I     ++  A  + LG TV EI+    + + G LR ++ ++ +
Sbjct: 100 SSENIRVNVPSCFTVAIGTSPGVMDNAAVRLLGLTVGEIRKHSEELIFGQLRQVIASMRI 159

Query: 474 EEVYKDRDQ 500
           EE+ +DRD+
Sbjct: 160 EEINRDRDK 168


>UniRef50_Q9VZI3 Cluster: Unc-112-related protein; n=9;
           Endopterygota|Rep: Unc-112-related protein - Drosophila
           melanogaster (Fruit fly)
          Length = 708

 Score = 35.5 bits (78), Expect = 1.9
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 147 GANSFRWLFRADHETYHSGWMGMGLVSGYGRP----TYIPEVMTLNPMCEYVETAQGVPL 314
           G NS  W+ R D+E  ++ WM    ++  GR     +Y  EV ++  + +  + AQG PL
Sbjct: 481 GPNSEVWV-RCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPL 539

Query: 315 TV 320
           TV
Sbjct: 540 TV 541


>UniRef50_A5TWU7 Cluster: Flotillin family protein; n=1;
           Fusobacterium nucleatum subsp. polymorphum ATCC
           10953|Rep: Flotillin family protein - Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953
          Length = 500

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = +2

Query: 482 VQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDDVQYLGQLG 616
           VQ +      V+E  APD+  MG++++SF +++  +D Q +  LG
Sbjct: 142 VQNRKNFNEKVQENVAPDLREMGLKVISFNVQNFQEDKQVIENLG 186


>UniRef50_A6RUN0 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 173

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = -1

Query: 723 RPLRFSQXRFPNTSISVSQSDTDVQRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPI 544
           +P+  SQ   P+T IS S+   D+  P +  P+  S S     TSS   L+   +IS+P 
Sbjct: 22  KPITPSQIPLPSTPISTSKPAADLTHPQT--PIPNSNS-----TSSIEKLVQAAQISLPD 74

Query: 543 LPTSGAATSRTNPRIGPCLCTP 478
             T  AATS   P + P   +P
Sbjct: 75  TLTPVAATSSDVPSLVPVPNSP 96


>UniRef50_Q4P0V7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1259

 Score = 34.3 bits (75), Expect = 4.3
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = +3

Query: 480 VYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAERP 659
           V K R    G  A+  RR   +  S +  S   TST+  +I +SLG  A++N +R  ERP
Sbjct: 52  VQKKRGPPKGCDARGGRRKKFKLPSPYAASLSSTSTSYPNISSSLGSIASSNPQRTVERP 111


>UniRef50_A7RK66 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1552

 Score = 33.9 bits (74), Expect = 5.7
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKI 874
           K+   +  R+T K+E QQ++ +  +RR      LN  L+  R F  Y  S Q KI
Sbjct: 364 KKQSLREARITEKLEKQQKMEQERKRRQKHQEYLNMILQHARDFKEYHRSVQSKI 418


>UniRef50_Q4RV90 Cluster: Chromosome 15 SCAF14992, whole genome
            shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome 15 SCAF14992, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 1310

 Score = 33.5 bits (73), Expect = 7.5
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +2

Query: 302  RSAAHGDRSRPVQDHERRRTSHNCLRAVPGQDRQRD*DDCPANVGGSFASYSRNSYSRRG 481
            RS +H   SR   +  +RR  H C + V G+ R  +      +V G  + +S    SRRG
Sbjct: 1070 RSKSHSGLSRSRGNGRQRRHQHACGQHVQGRRRSGERAQRQRHVTGHHSFFSGRCGSRRG 1129

Query: 482  VQRQGPIR 505
              R   +R
Sbjct: 1130 QDRSDTVR 1137


>UniRef50_Q15X74 Cluster: Sensor protein; n=1; Pseudoalteromonas
           atlantica T6c|Rep: Sensor protein - Pseudoalteromonas
           atlantica (strain T6c / BAA-1087)
          Length = 467

 Score = 33.1 bits (72), Expect = 9.9
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = +3

Query: 279 CEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 437
           CE+   +QG  LTV   +  KI  +++LLT+  E  L   VK     V  TL+
Sbjct: 334 CEFEAQSQGKTLTVDIDSDAKINADEDLLTSGIENVLRNAVKYANQQVSFTLK 386


>UniRef50_A1SE82 Cluster: Putative uncharacterized protein; n=1;
           Nocardioides sp. JS614|Rep: Putative uncharacterized
           protein - Nocardioides sp. (strain BAA-499 / JS614)
          Length = 434

 Score = 33.1 bits (72), Expect = 9.9
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 2/99 (2%)
 Frame = +3

Query: 252 PEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQT 431
           PE +TLN + E +  A G P  V GV +     E  +     ++    T+  +   V   
Sbjct: 194 PEALTLNELAERITAAAGTP--VLGVEETVAEAESRMRRDGFDE---DTIAYLTRIVESI 248

Query: 432 LEGHLRAILGTLTVEEVYKDR--DQFAGWYAKWLRRTSE 542
           +EGH   + G +     +  R  D F   +A+ LRRT +
Sbjct: 249 IEGHTANVTGDVERITGHPPRHFDSFLVDHARDLRRTGD 287


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 975,357,732
Number of Sequences: 1657284
Number of extensions: 21870820
Number of successful extensions: 64880
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 61316
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64822
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 81161904978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -