SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DB7BB2 Cluster: PREDICTED: similar to CG8494-PA;...   136   6e-31
UniRef50_UPI0000D566F5 Cluster: PREDICTED: similar to ubiquitin ...   134   3e-30
UniRef50_Q16V37 Cluster: Putative uncharacterized protein; n=1; ...   133   3e-30
UniRef50_Q9Y2K6 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...   130   2e-29
UniRef50_UPI00015B60BB Cluster: PREDICTED: similar to conserved ...   130   3e-29
UniRef50_Q8TEY7 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...   128   2e-28
UniRef50_Q8MSP3 Cluster: AT06247p; n=7; Diptera|Rep: AT06247p - ...   125   9e-28
UniRef50_UPI0000E45CA8 Cluster: PREDICTED: similar to ubiquitin ...   118   1e-25
UniRef50_Q80TK2 Cluster: MKIAA1097 protein; n=6; Euarchontoglire...    99   1e-19
UniRef50_UPI000065DEED Cluster: Ubiquitin carboxyl-terminal hydr...    77   3e-13
UniRef50_Q9Y6I4 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    63   5e-09
UniRef50_Q3TT00 Cluster: 8 days embryo whole body cDNA, RIKEN fu...    62   2e-08
UniRef50_A0E7E6 Cluster: Chromosome undetermined scaffold_81, wh...    61   2e-08
UniRef50_Q2I687 Cluster: Ubiquitin specific protease 18; n=3; Cy...    61   3e-08
UniRef50_A7SIY1 Cluster: Predicted protein; n=1; Nematostella ve...    60   4e-08
UniRef50_UPI00015A5F97 Cluster: Ubiquitin carboxyl-terminal hydr...    60   7e-08
UniRef50_Q93875 Cluster: Putative uncharacterized protein; n=2; ...    60   7e-08
UniRef50_Q17BE1 Cluster: Putative uncharacterized protein; n=1; ...    60   7e-08
UniRef50_Q4D6N2 Cluster: Ubiquitin hydrolase, putative; n=2; Try...    59   1e-07
UniRef50_Q382V7 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    58   2e-07
UniRef50_A7SFT1 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    58   2e-07
UniRef50_Q9C585 Cluster: Ubiquitin-specific protease-like protei...    58   2e-07
UniRef50_A2EWC5 Cluster: Clan CA, family C19, ubiquitin hydrolas...    57   4e-07
UniRef50_Q9YHZ0 Cluster: Ubiquitin specific protease 66; n=3; Ga...    57   5e-07
UniRef50_Q80U87 Cluster: Ubiquitin carboxyl-terminal hydrolase 8...    57   5e-07
UniRef50_P40818 Cluster: Ubiquitin carboxyl-terminal hydrolase 8...    57   5e-07
UniRef50_O75604 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    57   5e-07
UniRef50_UPI0000ECA21C Cluster: UPI0000ECA21C related cluster; n...    56   6e-07
UniRef50_Q9VVR1 Cluster: CG4166-PA; n=7; Endopterygota|Rep: CG41...    56   6e-07
UniRef50_Q4P3A5 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A4RQS8 Cluster: Predicted protein; n=1; Ostreococcus lu...    56   8e-07
UniRef50_Q6C1K8 Cluster: Yarrowia lipolytica chromosome F of str...    55   1e-06
UniRef50_Q4RYN3 Cluster: Chromosome 16 SCAF14974, whole genome s...    55   2e-06
UniRef50_Q0U5W3 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A7Q084 Cluster: Chromosome chr8 scaffold_41, whole geno...    54   3e-06
UniRef50_Q9Y4E8 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    54   3e-06
UniRef50_P39538 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    54   3e-06
UniRef50_Q9ZSB5 Cluster: F3H7.5 protein; n=5; Arabidopsis thalia...    53   6e-06
UniRef50_Q33AW7 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    53   6e-06
UniRef50_Q0DGV1 Cluster: Os05g0510300 protein; n=4; Oryza sativa...    53   6e-06
UniRef50_Q16MY5 Cluster: Ubiquitin specific protease; n=1; Aedes...    53   6e-06
UniRef50_A7S8P2 Cluster: Predicted protein; n=1; Nematostella ve...    53   6e-06
UniRef50_A7RVY4 Cluster: Predicted protein; n=2; Nematostella ve...    53   6e-06
UniRef50_Q0U4Z9 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_UPI00015B5DED Cluster: PREDICTED: similar to ubiquitin ...    53   8e-06
UniRef50_A7QJ40 Cluster: Chromosome chr2 scaffold_105, whole gen...    53   8e-06
UniRef50_A7RVV5 Cluster: Predicted protein; n=1; Nematostella ve...    53   8e-06
UniRef50_A5E220 Cluster: Putative uncharacterized protein; n=1; ...    53   8e-06
UniRef50_A5DB37 Cluster: Putative uncharacterized protein; n=1; ...    53   8e-06
UniRef50_Q6CEM1 Cluster: Yarrowia lipolytica chromosome B of str...    52   1e-05
UniRef50_Q752E9 Cluster: AFR627Cp; n=1; Eremothecium gossypii|Re...    52   1e-05
UniRef50_Q9SJA1 Cluster: Putative ubiquitin carboxyl terminal hy...    52   2e-05
UniRef50_Q54BB6 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q1DW30 Cluster: Putative uncharacterized protein; n=2; ...    52   2e-05
UniRef50_UPI0000E470C7 Cluster: PREDICTED: hypothetical protein,...    51   2e-05
UniRef50_UPI000065FAD0 Cluster: Ubiquitin carboxyl-terminal hydr...    51   2e-05
UniRef50_Q5DD02 Cluster: SJCHGC05186 protein; n=1; Schistosoma j...    51   2e-05
UniRef50_Q4DCS7 Cluster: Ubiquitin hydrolase, putative; n=2; Try...    51   2e-05
UniRef50_Q55ZS2 Cluster: Putative uncharacterized protein; n=2; ...    51   2e-05
UniRef50_A7TGT6 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q9P7V9 Cluster: Probable ubiquitin carboxyl-terminal hy...    51   3e-05
UniRef50_A7QK71 Cluster: Chromosome chr19 scaffold_111, whole ge...    50   4e-05
UniRef50_A0DVR1 Cluster: Chromosome undetermined scaffold_66, wh...    50   4e-05
UniRef50_A3LWQ3 Cluster: Predicted protein; n=1; Pichia stipitis...    50   4e-05
UniRef50_UPI0000DB72FC Cluster: PREDICTED: similar to ubiquitin-...    50   5e-05
UniRef50_Q0ILU8 Cluster: Os12g0621000 protein; n=4; Oryza sativa...    50   5e-05
UniRef50_Q0E2F9 Cluster: Os02g0244300 protein; n=4; Oryza sativa...    50   5e-05
UniRef50_Q9P987 Cluster: Ubiquitin carboxyl-terminal hydrolase; ...    50   5e-05
UniRef50_Q4PF40 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_UPI0000ECD19D Cluster: Ubiquitin carboxyl-terminal hydr...    50   7e-05
UniRef50_Q25AN5 Cluster: H0811D08.10 protein; n=6; Oryza sativa|...    50   7e-05
UniRef50_Q23JM8 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    50   7e-05
UniRef50_A7SNI6 Cluster: Predicted protein; n=1; Nematostella ve...    50   7e-05
UniRef50_A7SN67 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    50   7e-05
UniRef50_Q6FLQ2 Cluster: Candida glabrata strain CBS138 chromoso...    50   7e-05
UniRef50_Q70EL3 Cluster: Inactive ubiquitin carboxyl-terminal hy...    50   7e-05
UniRef50_UPI0000E4913D Cluster: PREDICTED: similar to Usp40 prot...    49   1e-04
UniRef50_UPI00006CB657 Cluster: Ubiquitin carboxyl-terminal hydr...    49   1e-04
UniRef50_Q9GRV2 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_Q5BWR2 Cluster: SJCHGC05197 protein; n=1; Schistosoma j...    49   1e-04
UniRef50_Q6C7Z0 Cluster: Yarrowia lipolytica chromosome D of str...    49   1e-04
UniRef50_Q6BHV0 Cluster: Debaryomyces hansenii chromosome G of s...    49   1e-04
UniRef50_Q4PHN7 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q8NFA0 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    49   1e-04
UniRef50_UPI0000F1DDC2 Cluster: PREDICTED: similar to Ubiquitin ...    49   1e-04
UniRef50_Q4RWH0 Cluster: Chromosome undetermined SCAF14988, whol...    49   1e-04
UniRef50_UPI00015B5024 Cluster: PREDICTED: similar to ENSANGP000...    48   2e-04
UniRef50_Q4SAB0 Cluster: Chromosome 19 SCAF14691, whole genome s...    48   2e-04
UniRef50_Q4RHB2 Cluster: Chromosome 3 SCAF15050, whole genome sh...    48   2e-04
UniRef50_Q9VCT9 Cluster: CG7023-PB, isoform B; n=2; Diptera|Rep:...    48   2e-04
UniRef50_Q293T5 Cluster: GA19137-PA; n=1; Drosophila pseudoobscu...    48   2e-04
UniRef50_Q22FY1 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    48   2e-04
UniRef50_A0D6V4 Cluster: Chromosome undetermined scaffold_4, who...    48   2e-04
UniRef50_P50102 Cluster: Ubiquitin carboxyl-terminal hydrolase 8...    48   2e-04
UniRef50_Q9FPT5 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    48   2e-04
UniRef50_UPI0000519A12 Cluster: PREDICTED: similar to CG30421-PA...    48   2e-04
UniRef50_UPI000049A299 Cluster: ubiquitin carboxyl-terminal hydr...    48   2e-04
UniRef50_A3BU50 Cluster: Putative uncharacterized protein; n=3; ...    48   2e-04
UniRef50_Q9VR54 Cluster: CG14619-PA, isoform A; n=4; Sophophora|...    48   2e-04
UniRef50_Q8IQ27 Cluster: CG14619-PC, isoform C; n=1; Drosophila ...    48   2e-04
UniRef50_Q5BY17 Cluster: SJCHGC08766 protein; n=1; Schistosoma j...    48   2e-04
UniRef50_UPI00015B4278 Cluster: PREDICTED: similar to CG7023-PA;...    48   3e-04
UniRef50_UPI00006CA72F Cluster: Ubiquitin carboxyl-terminal hydr...    48   3e-04
UniRef50_A3KQN0 Cluster: Novel protein similar to vertebrate ubi...    48   3e-04
UniRef50_Q0J140 Cluster: Os09g0464400 protein; n=3; Oryza sativa...    48   3e-04
UniRef50_Q9GRZ4 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_Q8ILU9 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q6BFI8 Cluster: Ubiquitin-specific protease, putative; ...    48   3e-04
UniRef50_Q5BXR8 Cluster: SJCHGC04287 protein; n=1; Schistosoma j...    48   3e-04
UniRef50_Q237F7 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    48   3e-04
UniRef50_Q1RPW0 Cluster: Zinc finger protein; n=1; Ciona intesti...    48   3e-04
UniRef50_Q1RL25 Cluster: Zinc finger protein; n=1; Ciona intesti...    48   3e-04
UniRef50_Q7RWU7 Cluster: Putative uncharacterized protein NCU004...    48   3e-04
UniRef50_Q6FQF0 Cluster: Candida glabrata strain CBS138 chromoso...    48   3e-04
UniRef50_O22207 Cluster: Ubiquitin carboxyl-terminal hydrolase 5...    48   3e-04
UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal hy...    48   3e-04
UniRef50_A7QXG5 Cluster: Chromosome undetermined scaffold_223, w...    47   4e-04
UniRef50_Q9TU68 Cluster: Ubiquitin-specific protease; n=5; Amnio...    47   4e-04
UniRef50_Q7QJP0 Cluster: ENSANGP00000009352; n=2; Culicidae|Rep:...    47   4e-04
UniRef50_A4I2S8 Cluster: Ubiquitin hydrolase, putative; n=3; Lei...    47   4e-04
UniRef50_Q7SGN8 Cluster: Putative uncharacterized protein NCU083...    47   4e-04
UniRef50_Q6BK50 Cluster: Similar to CA5333|CaDOA4 Candida albica...    47   4e-04
UniRef50_A3LW63 Cluster: Predicted protein; n=3; Saccharomycetac...    47   4e-04
UniRef50_Q9H0E7 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    47   4e-04
UniRef50_UPI0000E4767F Cluster: PREDICTED: hypothetical protein;...    47   5e-04
UniRef50_UPI0000F3362C Cluster: Ubiquitin carboxyl-terminal hydr...    47   5e-04
UniRef50_Q9FKP5 Cluster: Similarity to ubiquitin carboxyl-termin...    47   5e-04
UniRef50_Q8MQX4 Cluster: SD04548p; n=2; Drosophila melanogaster|...    47   5e-04
UniRef50_Q7Q848 Cluster: ENSANGP00000001119; n=2; Endopterygota|...    47   5e-04
UniRef50_Q4E407 Cluster: Ubiqitin hydrolase, putative; n=2; Tryp...    47   5e-04
UniRef50_Q4DS35 Cluster: Ubiquitin hydrolase, putative; n=2; Try...    47   5e-04
UniRef50_Q6FXS7 Cluster: Candida glabrata strain CBS138 chromoso...    47   5e-04
UniRef50_Q6FT56 Cluster: Candida glabrata strain CBS138 chromoso...    47   5e-04
UniRef50_O74442 Cluster: Probable ubiquitin carboxyl-terminal hy...    47   5e-04
UniRef50_UPI00015A75EB Cluster: Ubiquitin carboxyl-terminal hydr...    46   7e-04
UniRef50_UPI000069FAE8 Cluster: Ubiquitin carboxyl-terminal hydr...    46   7e-04
UniRef50_Q4S4W4 Cluster: Chromosome 2 SCAF14738, whole genome sh...    46   7e-04
UniRef50_Q9FPS9 Cluster: Ubiquitin-specific protease 15; n=3; Ar...    46   7e-04
UniRef50_A7NUN3 Cluster: Chromosome chr18 scaffold_1, whole geno...    46   7e-04
UniRef50_Q7JQI1 Cluster: LD36231p; n=3; Sophophora|Rep: LD36231p...    46   7e-04
UniRef50_Q555S8 Cluster: Putative uncharacterized protein; n=2; ...    46   7e-04
UniRef50_Q22E47 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    46   7e-04
UniRef50_A7S677 Cluster: Predicted protein; n=1; Nematostella ve...    46   7e-04
UniRef50_A2F7X4 Cluster: Clan CA, family C19, ubiquitin hydrolas...    46   7e-04
UniRef50_Q6FQK5 Cluster: Candida glabrata strain CBS138 chromoso...    46   7e-04
UniRef50_Q6CRK0 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    46   7e-04
UniRef50_Q59ZY4 Cluster: Putative uncharacterized protein DOA4; ...    46   7e-04
UniRef50_Q55SM8 Cluster: Putative uncharacterized protein; n=2; ...    46   7e-04
UniRef50_A6SC99 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A5DNK0 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A2QZ56 Cluster: Function: Ubiquitin-specific proteases;...    46   7e-04
UniRef50_Q70CQ4 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    46   7e-04
UniRef50_Q99K46 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    46   7e-04
UniRef50_P53874 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    46   7e-04
UniRef50_UPI00004996E1 Cluster: ubiquitin carboxyl-terminal hydr...    46   9e-04
UniRef50_UPI000023D7F3 Cluster: hypothetical protein FG06912.1; ...    46   9e-04
UniRef50_UPI00015A7FD8 Cluster: Novel ubiquitin specific proteas...    46   9e-04
UniRef50_Q16TQ0 Cluster: Ubiquitin specific protease; n=2; Culic...    46   9e-04
UniRef50_A7S0W3 Cluster: Predicted protein; n=1; Nematostella ve...    46   9e-04
UniRef50_A7RVS4 Cluster: Predicted protein; n=1; Nematostella ve...    46   9e-04
UniRef50_A5K182 Cluster: Putative uncharacterized protein; n=1; ...    46   9e-04
UniRef50_A0BPW6 Cluster: Chromosome undetermined scaffold_12, wh...    46   9e-04
UniRef50_Q7RZP4 Cluster: Putative uncharacterized protein NCU003...    46   9e-04
UniRef50_Q1E9B0 Cluster: Ubiquitin carboxyl-terminal hydrolase; ...    46   9e-04
UniRef50_A2QBW2 Cluster: Contig An02c0010, complete genome; n=4;...    46   9e-04
UniRef50_O60139 Cluster: Probable ubiquitin carboxyl-terminal hy...    46   9e-04
UniRef50_Q9UK80 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    46   9e-04
UniRef50_UPI000051AC84 Cluster: PREDICTED: similar to CG8830-PA,...    46   0.001
UniRef50_Q8VZF5 Cluster: AT3g14400/MLN21_18; n=3; Arabidopsis th...    46   0.001
UniRef50_Q7PDM1 Cluster: Putative Hydrolase; n=4; Plasmodium (Vi...    46   0.001
UniRef50_Q22KS8 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    46   0.001
UniRef50_A2F0I3 Cluster: Clan CA, family C19, ubiquitin hydrolas...    46   0.001
UniRef50_A0CWG6 Cluster: Chromosome undetermined scaffold_3, who...    46   0.001
UniRef50_Q754R5 Cluster: AFR007Wp; n=1; Eremothecium gossypii|Re...    46   0.001
UniRef50_Q5AAY9 Cluster: Potential ubiquitin-specific protease; ...    46   0.001
UniRef50_A7TI48 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A1DGE8 Cluster: Ubiquitin C-terminal hydrolase, putativ...    46   0.001
UniRef50_Q9UPU5 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    46   0.001
UniRef50_P51784 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    46   0.001
UniRef50_UPI00006D0117 Cluster: Ubiquitin carboxyl-terminal hydr...    45   0.002
UniRef50_Q86UV5-7 Cluster: Isoform 7 of Q86UV5 ; n=10; Mammalia|...    45   0.002
UniRef50_Q4SHQ3 Cluster: Chromosome 5 SCAF14581, whole genome sh...    45   0.002
UniRef50_Q54PQ7 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q381H6 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    45   0.002
UniRef50_A5DMF5 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q13107 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    45   0.002
UniRef50_Q86UV5 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    45   0.002
UniRef50_P38187 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    45   0.002
UniRef50_UPI00015A4023 Cluster: Ubiquitin carboxyl-terminal hydr...    45   0.002
UniRef50_UPI00015A4021 Cluster: Ubiquitin carboxyl-terminal hydr...    45   0.002
UniRef50_Q9FPS5 Cluster: Ubiquitin-specific protease 22; n=3; co...    45   0.002
UniRef50_A0CV10 Cluster: Chromosome undetermined scaffold_29, wh...    45   0.002
UniRef50_Q6CUN8 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    45   0.002
UniRef50_Q4P6R1 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A4QTP9 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_P39967 Cluster: Ubiquitin carboxyl-terminal hydrolase 9...    45   0.002
UniRef50_P39944 Cluster: Ubiquitin carboxyl-terminal hydrolase 5...    45   0.002
UniRef50_Q70EK9 Cluster: Ubiquitin carboxyl-terminal hydrolase 5...    45   0.002
UniRef50_Q3V0C5 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    45   0.002
UniRef50_UPI00015B620A Cluster: PREDICTED: similar to GA19137-PA...    44   0.003
UniRef50_UPI0000D55BC4 Cluster: PREDICTED: similar to CG5486-PA,...    44   0.003
UniRef50_UPI000049A01C Cluster: ubiquitin carboxyl-terminal hydr...    44   0.003
UniRef50_UPI000065E383 Cluster: Ubiquitin carboxyl-terminal hydr...    44   0.003
UniRef50_Q4RXP6 Cluster: Chromosome 11 SCAF14979, whole genome s...    44   0.003
UniRef50_Q9W117 Cluster: CG30421-PA; n=7; Drosophila|Rep: CG3042...    44   0.003
UniRef50_Q9VW49 Cluster: CG8334-PA; n=3; Eukaryota|Rep: CG8334-P...    44   0.003
UniRef50_Q54G37 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q386W6 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    44   0.003
UniRef50_Q16RT1 Cluster: Ubiquitin specific protease 2, putative...    44   0.003
UniRef50_Q74Z36 Cluster: AGR370Wp; n=1; Eremothecium gossypii|Re...    44   0.003
UniRef50_Q4PG60 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q24574 Cluster: Ubiquitin carboxyl-terminal hydrolase 6...    44   0.003
UniRef50_Q70CQ1 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    44   0.003
UniRef50_UPI000023D208 Cluster: hypothetical protein FG05462.1; ...    44   0.004
UniRef50_A7QTM4 Cluster: Chromosome chr11 scaffold_170, whole ge...    44   0.004
UniRef50_A4S4T8 Cluster: Predicted protein; n=2; Ostreococcus|Re...    44   0.004
UniRef50_Q7Q0X8 Cluster: ENSANGP00000018655; n=1; Anopheles gamb...    44   0.004
UniRef50_Q7JLZ7 Cluster: Putative uncharacterized protein; n=4; ...    44   0.004
UniRef50_Q4UE45 Cluster: Ubiquitin carboxy-terminal hydrolase, p...    44   0.004
UniRef50_Q4X0A7 Cluster: Ubiquitin C-terminal hydrolase, putativ...    44   0.004
UniRef50_Q2ULJ3 Cluster: Ubiquitin-specific protease; n=2; Peziz...    44   0.004
UniRef50_UPI00006CF33A Cluster: Ubiquitin carboxyl-terminal hydr...    44   0.005
UniRef50_UPI00006CCFDD Cluster: Ubiquitin carboxyl-terminal hydr...    44   0.005
UniRef50_Q0DAG6 Cluster: Os06g0654000 protein; n=5; Magnoliophyt...    44   0.005
UniRef50_Q7QD14 Cluster: ENSANGP00000018711; n=2; Culicidae|Rep:...    44   0.005
UniRef50_Q23DC1 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    44   0.005
UniRef50_A0C0G8 Cluster: Chromosome undetermined scaffold_14, wh...    44   0.005
UniRef50_Q6CU80 Cluster: Similar to sp|P50102 Saccharomyces cere...    44   0.005
UniRef50_Q4WQI1 Cluster: Ubiquitin C-terminal hydrolase CreB; n=...    44   0.005
UniRef50_Q0U5U1 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A7EWH8 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_O00507 Cluster: Probable ubiquitin carboxyl-terminal hy...    44   0.005
UniRef50_P70398 Cluster: Probable ubiquitin carboxyl-terminal hy...    44   0.005
UniRef50_Q5UQR3 Cluster: Probable ubiquitin carboxyl-terminal hy...    44   0.005
UniRef50_O24454 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    44   0.005
UniRef50_UPI0000E46730 Cluster: PREDICTED: similar to MGC81730 p...    43   0.006
UniRef50_A5ATZ4 Cluster: Putative uncharacterized protein; n=1; ...    43   0.006
UniRef50_Q9VC56 Cluster: CG5794-PD, isoform D; n=7; Eukaryota|Re...    43   0.006
UniRef50_Q55EJ1 Cluster: Putative uncharacterized protein; n=1; ...    43   0.006
UniRef50_A7SHS4 Cluster: Predicted protein; n=1; Nematostella ve...    43   0.006
UniRef50_A0BDA1 Cluster: Chromosome undetermined scaffold_10, wh...    43   0.006
UniRef50_A7TGY3 Cluster: Putative uncharacterized protein; n=1; ...    43   0.006
UniRef50_P32571 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    43   0.006
UniRef50_Q4RWF2 Cluster: Chromosome 2 SCAF14990, whole genome sh...    43   0.008
UniRef50_Q9TYY8 Cluster: Putative uncharacterized protein; n=2; ...    43   0.008
UniRef50_A1DNZ5 Cluster: Ubiquitin C-terminal hydrolase Ubp8, pu...    43   0.008
UniRef50_Q9USM5 Cluster: Probable ubiquitin carboxyl-terminal hy...    43   0.008
UniRef50_Q9UMW8 Cluster: Ubl carboxyl-terminal hydrolase 18; n=2...    43   0.008
UniRef50_UPI00015B618B Cluster: PREDICTED: similar to CG5486-PA;...    42   0.011
UniRef50_UPI0000DB6B1E Cluster: PREDICTED: similar to mule CG550...    42   0.011
UniRef50_UPI000051A2FA Cluster: PREDICTED: similar to Ubiquitin ...    42   0.011
UniRef50_Q9FPS8 Cluster: Ubiquitin-specific protease 16; n=2; Ar...    42   0.011
UniRef50_Q8I296 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    42   0.011
UniRef50_Q4QI02 Cluster: Ubiqitin hydrolase, putative; n=3; Leis...    42   0.011
UniRef50_Q38D83 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    42   0.011
UniRef50_A0DD02 Cluster: Chromosome undetermined scaffold_46, wh...    42   0.011
UniRef50_A0C7X6 Cluster: Chromosome undetermined scaffold_156, w...    42   0.011
UniRef50_Q6CMG8 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    42   0.011
UniRef50_A7TDU0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.011
UniRef50_UPI0000D559D5 Cluster: PREDICTED: similar to CG5505-PA,...    42   0.014
UniRef50_Q5CVE7 Cluster: Ubiquitin carboxyl-terminal hydrolase o...    42   0.014
UniRef50_Q553T4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.014
UniRef50_Q6FNI8 Cluster: Similar to sp|P53874 Saccharomyces cere...    42   0.014
UniRef50_Q5KN85 Cluster: Ubiquitin-specific protease, putative; ...    42   0.014
UniRef50_A7TP54 Cluster: Putative uncharacterized protein; n=1; ...    42   0.014
UniRef50_A6S3R4 Cluster: Putative uncharacterized protein; n=3; ...    42   0.014
UniRef50_A3LTL3 Cluster: Predicted protein; n=2; Saccharomycetac...    42   0.014
UniRef50_Q70EL4 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    42   0.014
UniRef50_UPI00015B58CA Cluster: PREDICTED: similar to LOC398480 ...    42   0.019
UniRef50_UPI0000DB7D14 Cluster: PREDICTED: similar to ubiquitin ...    42   0.019
UniRef50_UPI0000DB725B Cluster: PREDICTED: similar to ubiquitin ...    42   0.019
UniRef50_UPI00006CCC87 Cluster: Ubiquitin carboxyl-terminal hydr...    42   0.019
UniRef50_Q55BI4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.019
UniRef50_Q22240 Cluster: Putative uncharacterized protein; n=2; ...    42   0.019
UniRef50_A0E2I4 Cluster: Chromosome undetermined scaffold_75, wh...    42   0.019
UniRef50_A0CTQ8 Cluster: Chromosome undetermined scaffold_27, wh...    42   0.019
UniRef50_O75317 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    42   0.019
UniRef50_UPI0000E7FC50 Cluster: PREDICTED: similar to KIAA1372 p...    41   0.025
UniRef50_Q9FPS4 Cluster: Ubiquitin-specific protease 23; n=3; Ar...    41   0.025
UniRef50_Q7QAL3 Cluster: ENSANGP00000011820; n=2; Culicidae|Rep:...    41   0.025
UniRef50_Q16QX8 Cluster: Putative uncharacterized protein; n=1; ...    41   0.025
UniRef50_A4HKT3 Cluster: Ubiquitin hydrolase, putative; n=3; Lei...    41   0.025
UniRef50_A2DX39 Cluster: Clan CA, family C19, ubiquitin hydrolas...    41   0.025
UniRef50_Q9HFS7 Cluster: Deubiquitinating enzyme; n=1; Kluyverom...    41   0.025
UniRef50_Q75E18 Cluster: ABL145Wp; n=1; Eremothecium gossypii|Re...    41   0.025
UniRef50_Q0UVH3 Cluster: Putative uncharacterized protein; n=2; ...    41   0.025
UniRef50_P34547 Cluster: Probable ubiquitin carboxyl-terminal hy...    41   0.025
UniRef50_UPI0000DB703D Cluster: PREDICTED: similar to ubiquitin ...    41   0.033
UniRef50_Q93371 Cluster: Putative uncharacterized protein; n=2; ...    41   0.033
UniRef50_Q23G27 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    41   0.033
UniRef50_A5K9W8 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    41   0.033
UniRef50_A2DYQ2 Cluster: Clan CA, family C19, ubiquitin hydrolas...    41   0.033
UniRef50_A2D7N0 Cluster: Clan CA, family C19, ubiquitin hydrolas...    41   0.033
UniRef50_UPI00015B5539 Cluster: PREDICTED: similar to ENSANGP000...    40   0.044
UniRef50_UPI0000E8127B Cluster: PREDICTED: similar to ubiquitin ...    40   0.044
UniRef50_UPI0000D56D58 Cluster: PREDICTED: similar to CG4165-PA,...    40   0.044
UniRef50_Q22VZ8 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    40   0.044
UniRef50_A2F7B9 Cluster: Clan CA, family C19, ubiquitin hydrolas...    40   0.044
UniRef50_A0DX60 Cluster: Chromosome undetermined scaffold_68, wh...    40   0.044
UniRef50_A0CII8 Cluster: Chromosome undetermined scaffold_19, wh...    40   0.044
UniRef50_Q59PG8 Cluster: Putative uncharacterized protein UBP10;...    40   0.044
UniRef50_A1CEK2 Cluster: Ubiquitin C-terminal hydrolase, putativ...    40   0.044
UniRef50_Q96K76 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    40   0.044
UniRef50_UPI0000D5787A Cluster: PREDICTED: similar to ubiquitin ...    40   0.058
UniRef50_UPI0000D55A90 Cluster: PREDICTED: similar to CG8830-PA,...    40   0.058
UniRef50_UPI0000ECA92E Cluster: Ubiquitin carboxyl-terminal hydr...    40   0.058
UniRef50_Q802X0 Cluster: Usp42 protein; n=4; Danio rerio|Rep: Us...    40   0.058
UniRef50_Q0J0M6 Cluster: Os09g0505100 protein; n=2; Oryza sativa...    40   0.058
UniRef50_A7QYI7 Cluster: Chromosome undetermined scaffold_248, w...    40   0.058
UniRef50_A7Q739 Cluster: Chromosome chr5 scaffold_58, whole geno...    40   0.058
UniRef50_Q9VRP5 Cluster: CG5505-PA, isoform A; n=3; Drosophila m...    40   0.058
UniRef50_Q8IQ60 Cluster: CG5505-PD, isoform D; n=6; Sophophora|R...    40   0.058
UniRef50_Q7RQ61 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    40   0.058
UniRef50_Q5CTD7 Cluster: Ubiquitin C-terminal hydrolase of the c...    40   0.058
UniRef50_Q16UQ9 Cluster: Ubiquitin specific protease 9/faf; n=1;...    40   0.058
UniRef50_A7SNG5 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.058
UniRef50_A2F7W0 Cluster: Clan CA, family C19, ubiquitin hydrolas...    40   0.058
UniRef50_A6RAR6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.058
UniRef50_Q8NB14 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    40   0.058
UniRef50_Q8W4N3 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    40   0.058
UniRef50_UPI0000E4909D Cluster: PREDICTED: similar to Usp16 prot...    40   0.077
UniRef50_UPI0000E46B80 Cluster: PREDICTED: similar to Usp16 prot...    40   0.077
UniRef50_UPI00004993FE Cluster: ubiquitin carboxyl-terminal hydr...    40   0.077
UniRef50_Q4SZA9 Cluster: Chromosome undetermined SCAF11729, whol...    40   0.077
UniRef50_Q19132 Cluster: Putative uncharacterized protein; n=2; ...    40   0.077
UniRef50_A0BX42 Cluster: Chromosome undetermined scaffold_133, w...    40   0.077
UniRef50_Q4RL07 Cluster: Chromosome 1 SCAF15025, whole genome sh...    31   0.10 
UniRef50_UPI000155BF3A Cluster: PREDICTED: hypothetical protein,...    39   0.10 
UniRef50_Q4T8U8 Cluster: Chromosome undetermined SCAF7726, whole...    39   0.10 
UniRef50_Q4RFR1 Cluster: Chromosome 16 SCAF15113, whole genome s...    39   0.10 
UniRef50_Q8I3U1 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    39   0.10 
UniRef50_Q75JA6 Cluster: Similar to G-protein-coupled receptor a...    39   0.10 
UniRef50_Q554R2 Cluster: Putative uncharacterized protein; n=2; ...    39   0.10 
UniRef50_A5K9J2 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    39   0.10 
UniRef50_Q5KDK0 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    39   0.10 
UniRef50_UPI00015B51EC Cluster: PREDICTED: similar to CG8830-PA;...    39   0.13 
UniRef50_UPI00015B510E Cluster: PREDICTED: similar to CG4165-PA;...    39   0.13 
UniRef50_UPI00015B4BDF Cluster: PREDICTED: similar to ubiquitin ...    39   0.13 
UniRef50_UPI0000E48BD3 Cluster: PREDICTED: similar to MGC83063 p...    39   0.13 
UniRef50_Q4XU14 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    39   0.13 
UniRef50_A0DL05 Cluster: Chromosome undetermined scaffold_55, wh...    39   0.13 
UniRef50_A4D2N7 Cluster: Ubiquitin specific protease 42; n=5; Eu...    39   0.13 
UniRef50_Q5KC15 Cluster: Putative uncharacterized protein; n=2; ...    39   0.13 
UniRef50_Q9H9J4 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    39   0.13 
UniRef50_Q9P2H5 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    39   0.13 
UniRef50_P55824 Cluster: Probable ubiquitin carboxyl-terminal hy...    39   0.13 
UniRef50_Q9P7S5 Cluster: Probable ubiquitin carboxyl-terminal hy...    38   0.18 
UniRef50_UPI0000E812E7 Cluster: PREDICTED: similar to mKIAA1453 ...    38   0.18 
UniRef50_UPI00006CBA55 Cluster: Ubiquitin carboxyl-terminal hydr...    38   0.18 
UniRef50_UPI00006A1B98 Cluster: Ubiquitin carboxyl-terminal hydr...    38   0.18 
UniRef50_Q0J492 Cluster: Os08g0528000 protein; n=3; Oryza sativa...    38   0.18 
UniRef50_Q01B44 Cluster: Ubiquitin C-terminal hydrolase; n=3; Os...    38   0.18 
UniRef50_Q7PLZ8 Cluster: ENSANGP00000006100; n=1; Anopheles gamb...    38   0.18 
UniRef50_Q556A3 Cluster: Putative uncharacterized protein; n=2; ...    38   0.18 
UniRef50_Q4UDH1 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    38   0.18 
UniRef50_Q17HF1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.18 
UniRef50_O96612 Cluster: Ubiquitin hydrolase B; n=3; Dictyosteli...    38   0.18 
UniRef50_A0CZ34 Cluster: Chromosome undetermined scaffold_31, wh...    38   0.18 
UniRef50_UPI0000F309A3 Cluster: Ubiquitin carboxyl-terminal hydr...    38   0.24 
UniRef50_Q4E0K4 Cluster: Ubiquitin hydrolase, putative; n=3; Try...    38   0.24 
UniRef50_A7SHT5 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.24 
UniRef50_A0DMZ0 Cluster: Chromosome undetermined scaffold_57, wh...    38   0.24 
UniRef50_A0DAB1 Cluster: Chromosome undetermined scaffold_43, wh...    38   0.24 
UniRef50_A5DV64 Cluster: Putative uncharacterized protein; n=1; ...    38   0.24 
UniRef50_UPI0000E48922 Cluster: PREDICTED: similar to ubiquitin ...    38   0.31 
UniRef50_UPI00004D1042 Cluster: Ubiquitin carboxyl-terminal hydr...    38   0.31 
UniRef50_A0CZB9 Cluster: Chromosome undetermined scaffold_32, wh...    38   0.31 
UniRef50_A0BPD2 Cluster: Chromosome undetermined scaffold_12, wh...    38   0.31 
UniRef50_A5E4F3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.31 
UniRef50_O94782 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    38   0.31 
UniRef50_UPI0000D554DA Cluster: PREDICTED: similar to CG15817-PB...    37   0.41 
UniRef50_UPI00006CBDD3 Cluster: Ubiquitin carboxyl-terminal hydr...    37   0.41 
UniRef50_Q66J75 Cluster: MGC81700 protein; n=3; Tetrapoda|Rep: M...    37   0.41 
UniRef50_A7ANP5 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    37   0.41 
UniRef50_A0C651 Cluster: Chromosome undetermined scaffold_151, w...    37   0.41 
UniRef50_Q874X2 Cluster: Similar to ubiquitin specific protease ...    37   0.41 
UniRef50_Q6BQP9 Cluster: Debaryomyces hansenii chromosome E of s...    37   0.41 
UniRef50_Q59XT8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.41 
UniRef50_O94966 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    37   0.41 
UniRef50_UPI0000DB70AE Cluster: PREDICTED: similar to ubiquitin ...    37   0.54 
UniRef50_UPI00006CC8BD Cluster: Ubiquitin carboxyl-terminal hydr...    37   0.54 
UniRef50_UPI000061519F Cluster: PREDICTED: similar to Ubiquitin ...    37   0.54 
UniRef50_A3AAB3 Cluster: Putative uncharacterized protein; n=2; ...    37   0.54 
UniRef50_A2FZC5 Cluster: Clan CA, family C19, ubiquitin hydrolas...    37   0.54 
UniRef50_A0BJI9 Cluster: Chromosome undetermined scaffold_110, w...    37   0.54 
UniRef50_Q9P275 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    37   0.54 
UniRef50_UPI0000E47276 Cluster: PREDICTED: hypothetical protein,...    36   0.72 
UniRef50_Q7SYB6 Cluster: Usp40 protein; n=4; Danio rerio|Rep: Us...    36   0.72 
UniRef50_Q23KE7 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    36   0.72 
UniRef50_A4HMR5 Cluster: Ubiquitin hydrolase, putative; n=2; Lei...    36   0.72 
UniRef50_A0NBG4 Cluster: ENSANGP00000031576; n=1; Anopheles gamb...    36   0.72 
UniRef50_A0DM99 Cluster: Chromosome undetermined scaffold_56, wh...    36   0.72 
UniRef50_A0D0I9 Cluster: Chromosome undetermined scaffold_33, wh...    36   0.72 
UniRef50_A0BUD3 Cluster: Chromosome undetermined scaffold_129, w...    36   0.72 
UniRef50_Q70CQ2 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    36   0.72 
UniRef50_Q7ZVK6 Cluster: Ubiquitin specific protease 1; n=6; Eut...    36   0.95 
UniRef50_Q4RYR7 Cluster: Chromosome 16 SCAF14974, whole genome s...    36   0.95 
UniRef50_Q4RKN4 Cluster: Chromosome 18 SCAF15027, whole genome s...    36   0.95 
UniRef50_Q4RJ55 Cluster: Chromosome 1 SCAF15039, whole genome sh...    36   0.95 
UniRef50_Q9FPS7 Cluster: Ubiquitin-specific protease 20; n=20; E...    36   0.95 
UniRef50_A7QYJ5 Cluster: Chromosome undetermined scaffold_248, w...    36   0.95 
UniRef50_A3AC88 Cluster: Putative uncharacterized protein; n=3; ...    36   0.95 
UniRef50_Q7Q4T1 Cluster: ENSANGP00000013136; n=1; Anopheles gamb...    36   0.95 
UniRef50_Q5BW71 Cluster: SJCHGC08139 protein; n=1; Schistosoma j...    36   0.95 
UniRef50_Q23FG2 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    36   0.95 
UniRef50_Q16QH1 Cluster: Ubiquitin specific protease; n=1; Aedes...    36   0.95 
UniRef50_A7SR10 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.95 
UniRef50_A2FK80 Cluster: Clan CA, family C19, ubiquitin hydrolas...    36   0.95 
UniRef50_A0E984 Cluster: Chromosome undetermined scaffold_84, wh...    36   0.95 
UniRef50_A0CF28 Cluster: Chromosome undetermined scaffold_174, w...    36   0.95 
UniRef50_UPI000155BC69 Cluster: PREDICTED: hypothetical protein;...    36   1.3  
UniRef50_UPI0000D9E1F1 Cluster: PREDICTED: ubiquitin specific pr...    36   1.3  
UniRef50_UPI00005A2AE7 Cluster: PREDICTED: similar to Ubiquitin ...    36   1.3  
UniRef50_Q5XH15 Cluster: LOC398902 protein; n=2; Xenopus|Rep: LO...    36   1.3  
UniRef50_A7PC87 Cluster: Chromosome chr2 scaffold_11, whole geno...    36   1.3  
UniRef50_Q8WT44 Cluster: Cytokinesis defect protein 3, isoform b...    36   1.3  
UniRef50_Q4DYG8 Cluster: Ubiquitin hydrolase, putative; n=1; Try...    36   1.3  
UniRef50_Q22A34 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    36   1.3  
UniRef50_A2GAC0 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    36   1.3  
UniRef50_A0BTY8 Cluster: Chromosome undetermined scaffold_128, w...    36   1.3  
UniRef50_A5DYC5 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_A3LYP3 Cluster: Predicted protein; n=2; Saccharomycetal...    36   1.3  
UniRef50_Q61068 Cluster: Ubiquitin carboxyl-terminal hydrolase D...    36   1.3  
UniRef50_Q09738 Cluster: Probable ubiquitin carboxyl-terminal hy...    36   1.3  
UniRef50_Q9SCJ9 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    36   1.3  
UniRef50_UPI0000DB71F4 Cluster: PREDICTED: similar to CG15817-PB...    35   1.7  
UniRef50_UPI00006D0E1D Cluster: Ubiquitin carboxyl-terminal hydr...    35   1.7  
UniRef50_Q4KMK3 Cluster: Usp36 protein; n=8; Euteleostomi|Rep: U...    35   1.7  
UniRef50_Q0J496 Cluster: Os08g0527600 protein; n=3; Oryza sativa...    35   1.7  
UniRef50_Q9W4C3 Cluster: CG4165-PA, isoform A; n=1; Drosophila m...    35   1.7  
UniRef50_A2DJR2 Cluster: Clan CA, family C19, ubiquitin hydrolas...    35   1.7  
UniRef50_A0DRZ5 Cluster: Chromosome undetermined scaffold_61, wh...    35   1.7  
UniRef50_Q86T82 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    35   1.7  
UniRef50_P50101 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    35   1.7  
UniRef50_UPI0000F21153 Cluster: PREDICTED: hypothetical protein;...    35   2.2  
UniRef50_Q4T1P8 Cluster: Chromosome undetermined SCAF10513, whol...    35   2.2  
UniRef50_Q4RZ28 Cluster: Chromosome 8 SCAF14972, whole genome sh...    35   2.2  
UniRef50_Q9FPS6 Cluster: Ubiquitin-specific protease 21; n=2; Ar...    35   2.2  
UniRef50_Q29I81 Cluster: GA18000-PA; n=1; Drosophila pseudoobscu...    35   2.2  
UniRef50_A0DMS3 Cluster: Chromosome undetermined scaffold_57, wh...    35   2.2  
UniRef50_A0CRD7 Cluster: Chromosome undetermined scaffold_25, wh...    35   2.2  
UniRef50_A0BQX8 Cluster: Chromosome undetermined scaffold_121, w...    35   2.2  
UniRef50_Q9VYQ8 Cluster: Ubiquitin carboxyl-terminal hydrolase 7...    35   2.2  
UniRef50_Q70EL2 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    35   2.2  
UniRef50_Q9Y5T5 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    35   2.2  
UniRef50_UPI0000DB77AD Cluster: PREDICTED: similar to ubiquitin ...    34   2.9  
UniRef50_Q08BR8 Cluster: Zgc:153999; n=6; Euteleostomi|Rep: Zgc:...    34   2.9  
UniRef50_A7NZF0 Cluster: Chromosome chr6 scaffold_3, whole genom...    34   2.9  
UniRef50_Q9VAM3 Cluster: CG15817-PB, isoform B; n=3; Sophophora|...    34   2.9  
UniRef50_Q54H96 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q234S6 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    34   2.9  
UniRef50_Q6CEB0 Cluster: Yarrowia lipolytica chromosome B of str...    34   2.9  
UniRef50_Q6CCH1 Cluster: Similar to sp|P50102 Saccharomyces cere...    34   2.9  
UniRef50_A5DPK1 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q99MX1 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    34   2.9  
UniRef50_Q9UTT1 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    34   2.9  
UniRef50_UPI00005A9649 Cluster: PREDICTED: similar to deubiquiti...    34   3.8  
UniRef50_UPI00005A9646 Cluster: PREDICTED: similar to deubiquiti...    34   3.8  
UniRef50_Q4S9I0 Cluster: Chromosome undetermined SCAF14696, whol...    34   3.8  
UniRef50_A3HTR7 Cluster: Dihydrofolate reductase; n=1; Algoripha...    34   3.8  
UniRef50_A7R0I9 Cluster: Chromosome undetermined scaffold_310, w...    34   3.8  
UniRef50_A2YXA6 Cluster: Putative uncharacterized protein; n=2; ...    34   3.8  
UniRef50_Q94301 Cluster: Putative uncharacterized protein; n=3; ...    34   3.8  
UniRef50_Q4QAS1 Cluster: Ubiquitin hydrolase, putative; n=3; Lei...    34   3.8  
UniRef50_Q4FWM8 Cluster: Cysteine peptidase, Clan CA, family C19...    34   3.8  
UniRef50_A2DLP8 Cluster: Clan CA, family C19, ubiquitin hydrolas...    34   3.8  
UniRef50_A7TML1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.8  
UniRef50_P40453 Cluster: Ubiquitin carboxyl-terminal hydrolase 7...    34   3.8  
UniRef50_Q9NVE5 Cluster: Ubiquitin carboxyl-terminal hydrolase 4...    34   3.8  
UniRef50_P36026 Cluster: Ubiquitin carboxyl-terminal hydrolase 1...    34   3.8  
UniRef50_UPI0000D57470 Cluster: PREDICTED: similar to CG5798-PA;...    33   5.1  
UniRef50_UPI00006CC38B Cluster: Ubiquitin carboxyl-terminal hydr...    33   5.1  
UniRef50_UPI0000498593 Cluster: ubiquitin carboxyl-terminal hydr...    33   5.1  
UniRef50_Q8BWR4-2 Cluster: Isoform 2 of Q8BWR4 ; n=3; Murinae|Re...    33   5.1  
UniRef50_Q5CRJ9 Cluster: Ubiquitin C-terminal hydrolase of the c...    33   5.1  
UniRef50_Q38C23 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    33   5.1  
UniRef50_Q23DA4 Cluster: Ubiquitin carboxyl-terminal hydrolase f...    33   5.1  
UniRef50_Q2HF39 Cluster: Putative uncharacterized protein; n=2; ...    33   5.1  
UniRef50_A5E4L2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_A3LMS4 Cluster: Predicted protein; n=4; Saccharomycetal...    33   5.1  
UniRef50_UPI0000EBEAD2 Cluster: PREDICTED: similar to LOC402164 ...    33   6.7  
UniRef50_UPI00006CBA4B Cluster: Ubiquitin carboxyl-terminal hydr...    33   6.7  
UniRef50_A4S492 Cluster: Predicted protein; n=2; Ostreococcus|Re...    33   6.7  
UniRef50_Q4MZM2 Cluster: Ubiquitin carboxyl-terminal hydrolase, ...    33   6.7  
UniRef50_A2E6Q9 Cluster: Clan CA, family C19, ubiquitin hydrolas...    33   6.7  
UniRef50_A2DI27 Cluster: Clan CA, family C19, ubiquitin hydrolas...    33   6.7  
UniRef50_A0DF46 Cluster: Chromosome undetermined scaffold_49, wh...    33   6.7  
UniRef50_Q8SRQ2 Cluster: UBIQUITIN CARBOXYL-TERMINAL HYDROLASE; ...    33   6.7  
UniRef50_A3LW56 Cluster: Ubiquitin carboxyl-terminal hydrolase; ...    33   6.7  
UniRef50_Q9ES63 Cluster: Ubiquitin carboxyl-terminal hydrolase 2...    33   6.7  
UniRef50_UPI00015B47C7 Cluster: PREDICTED: similar to CG12717-PA...    33   8.8  
UniRef50_Q6PAW2 Cluster: MGC68701 protein; n=4; Xenopus|Rep: MGC...    33   8.8  
UniRef50_Q6ZKX9 Cluster: Ubiquitin-specific protease-like; n=2; ...    33   8.8  
UniRef50_A4H6T4 Cluster: Ubiquitin hydrolase, putative; n=1; Lei...    33   8.8  
UniRef50_A2DUQ7 Cluster: Clan CA, family C19, ubiquitin hydrolas...    33   8.8  
UniRef50_A4QRN8 Cluster: Putative uncharacterized protein; n=1; ...    33   8.8  
UniRef50_A2QUF5 Cluster: Catalytic activity: ubiquitin C-termina...    33   8.8  

>UniRef50_UPI0000DB7BB2 Cluster: PREDICTED: similar to CG8494-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG8494-PA
           - Apis mellifera
          Length = 959

 Score =  136 bits (328), Expect = 6e-31
 Identities = 64/111 (57%), Positives = 76/111 (68%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVVSL DCL+AFFSADELKGDNMYSC +C KLRNG+K S ++ LP +LCVHLKRFRH
Sbjct: 459 FWGPVVSLHDCLSAFFSADELKGDNMYSCEKCNKLRNGIKFSKVLELPEILCVHLKRFRH 518

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS+K+             R    K     V+ Y L +VI H GT GGG
Sbjct: 519 ELMFSSKIANYVSFPLEGLDMRPYLHKECVSKVTMYDLISVICHHGTAGGG 569



 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 40/56 (71%), Positives = 49/56 (87%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPM 222
           +K RSIISD+F GKLLS+VQCL CDR+STR+ETFQDLSLPIPSR+H+ +L  Q P+
Sbjct: 373 MKTRSIISDIFDGKLLSSVQCLTCDRISTRVETFQDLSLPIPSRDHIDMLH-QGPL 427


>UniRef50_UPI0000D566F5 Cluster: PREDICTED: similar to ubiquitin
           specific protease 20; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to ubiquitin specific protease 20 -
           Tribolium castaneum
          Length = 941

 Score =  134 bits (323), Expect = 3e-30
 Identities = 63/111 (56%), Positives = 74/111 (66%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           FYGPVV+L DCLAAFFS DELKGDNMYSC +C KLRNG+K S ++ LP VLC+HLKRFRH
Sbjct: 479 FYGPVVTLHDCLAAFFSTDELKGDNMYSCEKCNKLRNGIKFSKVLQLPEVLCIHLKRFRH 538

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS+K+             R          V+ Y L +VI H GT GGG
Sbjct: 539 ELMFSSKISSAVSFPLKGLDMRPYLHTDCISKVTTYELFSVICHYGTAGGG 589



 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 42/61 (68%), Positives = 50/61 (81%)
 Frame = +1

Query: 22  AKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAV 201
           + S +S +    KYRSIISD+F GKLLS+VQCL CDRVS+ +ETFQDLSLPIPSR+HL V
Sbjct: 385 SSSSASINKKQQKYRSIISDIFDGKLLSSVQCLTCDRVSSCVETFQDLSLPIPSRDHLVV 444

Query: 202 L 204
           L
Sbjct: 445 L 445


>UniRef50_Q16V37 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1214

 Score =  133 bits (322), Expect = 3e-30
 Identities = 63/111 (56%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GP V+L DC+AAFFSADELKGDNMYSC +C KLRNGVK S ++ LP +LCVHLKRFRH
Sbjct: 506 FWGPAVTLHDCMAAFFSADELKGDNMYSCEKCNKLRNGVKFSRVLALPEMLCVHLKRFRH 565

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           +L +S+K+             R    K     V+ Y L AVI H GTVGGG
Sbjct: 566 DLSYSSKISSPVNFPMNGLDMRPYLHKDCKSEVTSYDLGAVICHHGTVGGG 616



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 41/60 (68%), Positives = 48/60 (80%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHAAH 243
           RSIISD+F GKLLS+VQCL CDR+STR ETFQDLSLPIP ++HLAVL    P +   +AH
Sbjct: 404 RSIISDIFDGKLLSSVQCLTCDRISTREETFQDLSLPIPGKDHLAVLHQNHPGMPSPSAH 463


>UniRef50_Q9Y2K6 Cluster: Ubiquitin carboxyl-terminal hydrolase 20;
           n=54; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 20 - Homo sapiens (Human)
          Length = 914

 Score =  130 bits (315), Expect = 2e-29
 Identities = 60/111 (54%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+L+DCLAAFF+ADELKGDNMYSC RCKKLRNGVK   ++ LP +LC+HLKRFRH
Sbjct: 532 FWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRH 591

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E+++S K+             R    K     ++ Y L +VI H GT G G
Sbjct: 592 EVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSG 642



 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 39/67 (58%), Positives = 46/67 (68%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           V   A+  S  S      +YRS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP 
Sbjct: 422 VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPG 481

Query: 184 REHLAVL 204
           +E LA L
Sbjct: 482 KEDLAKL 488


>UniRef50_UPI00015B60BB Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 921

 Score =  130 bits (314), Expect = 3e-29
 Identities = 62/110 (56%), Positives = 73/110 (66%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +GP VSL DCL+AFFSADELKGDNMYSC +C KLRNG+K S ++ LP VLCVHLKRFRHE
Sbjct: 489 WGPTVSLHDCLSAFFSADELKGDNMYSCEKCNKLRNGIKFSKVLELPEVLCVHLKRFRHE 548

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           L+FS+K+             R    K      + Y L +VI H GT GGG
Sbjct: 549 LMFSSKIASYVSFPLEDLEMRPHLHKDCVSKETSYDLISVICHHGTAGGG 598



 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 38/50 (76%), Positives = 46/50 (92%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL 204
           +K RSIISD+F GKLLS+VQCL CDR+STRIETFQDLSLPIPSR+H+ ++
Sbjct: 402 MKTRSIISDIFDGKLLSSVQCLTCDRISTRIETFQDLSLPIPSRDHINMI 451


>UniRef50_Q8TEY7 Cluster: Ubiquitin carboxyl-terminal hydrolase 33;
           n=26; Tetrapoda|Rep: Ubiquitin carboxyl-terminal
           hydrolase 33 - Homo sapiens (Human)
          Length = 942

 Score =  128 bits (308), Expect = 2e-28
 Identities = 59/111 (53%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRH
Sbjct: 562 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRH 621

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 622 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 672



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 450 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 509

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 510 PGKEDLAKL 518


>UniRef50_Q8MSP3 Cluster: AT06247p; n=7; Diptera|Rep: AT06247p -
           Drosophila melanogaster (Fruit fly)
          Length = 990

 Score =  125 bits (302), Expect = 9e-28
 Identities = 59/110 (53%), Positives = 75/110 (68%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YGP V+L DC+A+FFSADELKGDNMYSC RC KLR G+K S ++ LP VLC+HLKRFR++
Sbjct: 404 YGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHLKRFRND 463

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           L +S+K+          +  R    K     V+ Y+L +VI H GTVGGG
Sbjct: 464 LSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAIYNLSSVICHHGTVGGG 513



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKY-RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           P   + K+ SS +   ++  RSIISDVF GKLLS+VQCL CDRVSTR ETFQDLSLPIP+
Sbjct: 301 PLQHQQKNVSSAEQKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPN 360

Query: 184 REHLAVL 204
           R+ L VL
Sbjct: 361 RDFLNVL 367


>UniRef50_UPI0000E45CA8 Cluster: PREDICTED: similar to ubiquitin
           specific protease 20, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ubiquitin specific
           protease 20, partial - Strongylocentrotus purpuratus
          Length = 536

 Score =  118 bits (285), Expect = 1e-25
 Identities = 60/113 (53%), Positives = 72/113 (63%), Gaps = 2/113 (1%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GP V+L +CLAAFFSADELKGDNMYSC +CKKLRNGVK   ++ LP VLC+HLKRFRH
Sbjct: 383 FWGPNVTLDNCLAAFFSADELKGDNMYSCEKCKKLRNGVKFVHVLELPEVLCIHLKRFRH 442

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLT--RTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E   S            + +  +T   +K      + Y L AVI H GT GGG
Sbjct: 443 ESFTSYCSKLNNYVSFPLDSLDMTPYLSKDCKNKCATYDLSAVICHHGTAGGG 495



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/34 (79%), Positives = 31/34 (91%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKK 395
           F+GP V+L +CLAAFFSADELKGDNMYSC +CKK
Sbjct: 347 FWGPNVTLDNCLAAFFSADELKGDNMYSCEKCKK 380



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/29 (68%), Positives = 26/29 (89%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVST 141
           ++YRSIISDVF GK+LS+VQCL C+ VS+
Sbjct: 306 LRYRSIISDVFDGKILSSVQCLTCENVSS 334


>UniRef50_Q80TK2 Cluster: MKIAA1097 protein; n=6;
           Euarchontoglires|Rep: MKIAA1097 protein - Mus musculus
           (Mouse)
          Length = 837

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 58/158 (36%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGRAALPAAHAEPPRGPQRTGXXXXXXXXXXXXXFYGPVVSLQDCLAA 335
           PRL A+ P PG+L     P  H +      +               F G V+S   CL  
Sbjct: 415 PRLSASPPKPGSLWPGLSPP-HKKAQSTSAKRKKQHKKYRSVISDIFDGTVISSVQCL-- 471

Query: 336 FFSADELK-GDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAKVXXXXX 512
             + D +  GDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRHEL+FS K+     
Sbjct: 472 --TCDRVSMGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKISTHVS 529

Query: 513 XXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
                   +    K +P  +  Y L +VI H GT   G
Sbjct: 530 FPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 567



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query: 1   LVPNSARAKSGSSG-DGSNVKYRSIISDVFXGKLLSAVQCLICDRVS 138
           L P   +A+S S+     + KYRS+ISD+F G ++S+VQCL CDRVS
Sbjct: 431 LSPPHKKAQSTSAKRKKQHKKYRSVISDIFDGTVISSVQCLTCDRVS 477


>UniRef50_UPI000065DEED Cluster: Ubiquitin carboxyl-terminal
           hydrolase 20 (EC 3.1.2.15) (Ubiquitin thioesterase 20)
           (Ubiquitin-specific-processing protease 20)
           (Deubiquitinating enzyme 20).; n=1; Takifugu
           rubripes|Rep: Ubiquitin carboxyl-terminal hydrolase 20
           (EC 3.1.2.15) (Ubiquitin thioesterase 20)
           (Ubiquitin-specific-processing protease 20)
           (Deubiquitinating enzyme 20). - Takifugu rubripes
          Length = 492

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = +1

Query: 34  SSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL 204
           SS       +RS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP +E LA L
Sbjct: 403 SSKKKKQFHFRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKL 459


>UniRef50_Q9Y6I4 Cluster: Ubiquitin carboxyl-terminal hydrolase 3;
           n=40; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 3 - Homo sapiens (Human)
          Length = 521

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 360 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 419

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 420 YLRNKVDTYVEFPLRGLDMKWYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 471



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 309 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 348


>UniRef50_Q3TT00 Cluster: 8 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:5730501K20
           product:ubiquitin specific protease 3, full insert
           sequence; n=4; Eutheria|Rep: 8 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:5730501K20 product:ubiquitin specific protease 3,
           full insert sequence - Mus musculus (Mouse)
          Length = 482

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 39/112 (34%), Positives = 52/112 (46%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP  LC+HLKRF    
Sbjct: 321 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTA 380

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 381 YLRNKVDTYVQFPLRGLDMKCYLLEPENSGPDSCLYDLAAVVVHHGSGVGSG 432



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 270 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 309


>UniRef50_A0E7E6 Cluster: Chromosome undetermined scaffold_81, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_81,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 503

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           LQ+C+  F   + LKGD  ++C+ C + R+  K   +  +P +L +HLKRF+    F AK
Sbjct: 261 LQECIEEFLKKETLKGDEGWNCTNCNQRRDSNKKIDLWSMPNILIIHLKRFKFNSQFRAK 320

Query: 495 V-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           +          +    L  TK   +    Y L AVI+H GT+  G
Sbjct: 321 IRSLVKYPLQNLSFENLVCTKQVEKPT--YDLYAVINHSGTLTSG 363



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           +SII D+F G++L  + CL C       E F  LS+P+ +RE
Sbjct: 217 QSIIVDLFQGQMLDTLSCLTCKSSRYCFEPFMYLSVPVLNRE 258


>UniRef50_Q2I687 Cluster: Ubiquitin specific protease 18; n=3;
           Cyprinidae|Rep: Ubiquitin specific protease 18 -
           Carassius auratus (Goldfish)
          Length = 339

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 6/111 (5%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L+ C+ +FF    L     + C +C+K +       +V LP +LCVHLKRFR++  F+ 
Sbjct: 174 TLESCINSFFQLQNLVDGEEWFCDQCEKKQPSTHELKLVSLPPILCVHLKRFRNDRGFTR 233

Query: 492 KVXXXXXXXXTIWT*RLTRTKS------APRXVSRYSLXAVISHMGTVGGG 626
           K+        T  T      +S      +PR    YSL AVI H+G+   G
Sbjct: 234 KLNSKVTFLETFSTDVFAAGQSENVANDSPRAGEHYSLYAVIVHIGSAMSG 284


>UniRef50_A7SIY1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 409

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 35/105 (33%), Positives = 55/105 (52%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+DC+  F  A+ + GD+M+ C RCK+ R   K   I  LP +L VHLKRF+++ ++  
Sbjct: 256 SLRDCIKLFTRAERMSGDDMWYCPRCKQHRVASKQLQIWRLPPILIVHLKRFQYDGMWRQ 315

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+         +    ++   + P     Y L  V +H GT+ GG
Sbjct: 316 KL--QTAVSFPVDGLDMSGYITGPTKRPAYHLYGVSNHYGTMHGG 358



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +1

Query: 43  DGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLR 207
           D    +  S++ ++F G   S V+CL+C + S   ETF +L+LP+P   +   LR
Sbjct: 204 DNHRKRNESLMLNLFDGMFKSTVRCLVCAKDSVTYETFSNLTLPLPGNSNHCSLR 258


>UniRef50_UPI00015A5F97 Cluster: Ubiquitin carboxyl-terminal
           hydrolase 8 (EC 3.1.2.15) (Ubiquitin thioesterase 8)
           (Ubiquitin-specific-processing protease 8)
           (Deubiquitinating enzyme 8) (hUBPy).; n=3;
           Deuterostomia|Rep: Ubiquitin carboxyl-terminal hydrolase
           8 (EC 3.1.2.15) (Ubiquitin thioesterase 8)
           (Ubiquitin-specific-processing protease 8)
           (Deubiquitinating enzyme 8) (hUBPy). - Danio rerio
          Length = 334

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SLQDCL  F   + L   N + C  CK  R+ +K   I  LP +L VHLKRF++E  +  
Sbjct: 188 SLQDCLKLFHKEERLTDGNRFYCRHCKTHRDAIKRMQIWKLPPILLVHLKRFKYEGRWRE 247

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
           K+         +    L++    P+  + +Y+L AV +H G + GG
Sbjct: 248 KL--QTLVDFPLDNLDLSQYVIGPKNNLKKYNLYAVSNHYGGMDGG 291



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           SII  +F G+  S VQC+ C   S   ETF  L+L + +    ++  C
Sbjct: 145 SIIVALFQGQFKSTVQCMSCQHKSRTFETFMYLTLEMTASSKCSLQDC 192


>UniRef50_Q93875 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 716

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/62 (45%), Positives = 37/62 (59%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+ CL  FF    L+ DN YSCS+C+ L +  K +    LP V+ + LKRFRH +  S 
Sbjct: 403 SLESCLDRFFQNSTLQDDNQYSCSKCEVLVDATKSTKAHRLPEVIIIQLKRFRHTMFGSC 462

Query: 492 KV 497
           KV
Sbjct: 463 KV 464



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++ IS +F G L + +QC  C   S  IE F DLS+PI
Sbjct: 320 KTAISAIFQGVLENQIQCHSCGFRSRTIENFLDLSIPI 357


>UniRef50_Q17BE1 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 626

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 27/65 (41%), Positives = 37/65 (56%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           PV ++ DCLA+F   +EL    +Y CS CK  +   K   I  LP VLC+H+KRFR    
Sbjct: 446 PVCNISDCLASFTEVEELTETELYYCSSCKCKQKSTKRFWIRRLPNVLCLHIKRFRWNNF 505

Query: 483 FSAKV 497
           +  K+
Sbjct: 506 YRTKI 510



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/40 (50%), Positives = 27/40 (67%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SI+++VF G L S V+CLIC   S + + F DLSL IP +
Sbjct: 388 SIVTNVFGGILQSEVRCLICGMESKKHDPFLDLSLDIPEK 427


>UniRef50_Q4D6N2 Cluster: Ubiquitin hydrolase, putative; n=2;
           Trypanosoma cruzi|Rep: Ubiquitin hydrolase, putative -
           Trypanosoma cruzi
          Length = 557

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/106 (31%), Positives = 54/106 (50%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           VS++DCL A+   + L  +++Y+C  CK+  N  K   I  LP +L + +KRFR    FS
Sbjct: 414 VSIEDCLKAYCKEEVLDSESLYTCPSCKQSVNASKQLLIYSLPRILFLTMKRFRSYGDFS 473

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            KV         +    ++    +P   + Y+L  V++H G + GG
Sbjct: 474 NKVLEPVVFQKEL---NMSSFMCSPGKNTNYTLVGVVNHRGNIHGG 516


>UniRef50_Q382V7 Cluster: Ubiquitin carboxyl-terminal hydrolase,
           putative; n=1; Trypanosoma brucei|Rep: Ubiquitin
           carboxyl-terminal hydrolase, putative - Trypanosoma
           brucei
          Length = 790

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/62 (41%), Positives = 34/62 (54%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           V+LQ+CL   F   ELKG NMY CS C   R   K   ++ +P  L +H+KRF     F+
Sbjct: 402 VTLQECLDIHFEPVELKGSNMYHCSTCNAKREATKQETLLTMPEYLLLHMKRFEQGKCFN 461

Query: 489 AK 494
            K
Sbjct: 462 TK 463



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           ++D F G++LS ++C  C R S  +E+F  L++ IPS
Sbjct: 305 VTDGFTGQILSEIRCHTCQRSSRIVESFSSLTIGIPS 341


>UniRef50_A7SFT1 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 452

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 25/65 (38%), Positives = 36/65 (55%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P   L+DC+  F + ++L    +Y C +CKK     K   I  LP VLC+HLKRFR +  
Sbjct: 288 PFCQLEDCMKHFVALEKLAESELYMCLKCKKKEQSTKKFWIQRLPNVLCLHLKRFRFQAF 347

Query: 483 FSAKV 497
             +K+
Sbjct: 348 LRSKI 352



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +I++ +F G L S V CL C   S +++ F DLSL IP
Sbjct: 237 TIVTGIFGGILQSEVTCLTCMTESRKLDPFLDLSLEIP 274


>UniRef50_Q9C585 Cluster: Ubiquitin-specific protease-like protein;
            n=5; Arabidopsis thaliana|Rep: Ubiquitin-specific
            protease-like protein - Arabidopsis thaliana (Mouse-ear
            cress)
          Length = 901

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/106 (31%), Positives = 50/106 (47%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            VSL  CL AF + + L  D+M+ C  CK+ R  +K   +  LP +L +HLKRF +     
Sbjct: 752  VSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMK 811

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                 +    +   RY L A+ +H G++GGG
Sbjct: 812  NKLEAYVDFPLDNLDLSSYISYKNGQTTYRYMLYAISNHYGSMGGG 857



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII DV  G+  S + C IC +VS   + F  LSLP+P
Sbjct: 451 SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLP 488


>UniRef50_A2EWC5 Cluster: Clan CA, family C19, ubiquitin
           hydrolase-like cysteine peptidase; n=2; Trichomonas
           vaginalis G3|Rep: Clan CA, family C19, ubiquitin
           hydrolase-like cysteine peptidase - Trichomonas
           vaginalis G3
          Length = 614

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 35/110 (31%), Positives = 53/110 (48%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YG V +L+D L+ F   DEL   N + C +CKK+    +  GI+ +  V+ VHLKRF  E
Sbjct: 467 YGSV-NLEDLLSNFSQDDELDDKNKWKCEKCKKMVRATRRIGILRVADVIIVHLKRFSDE 525

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             F+ K+         +    ++R  +       Y L   + H G +GGG
Sbjct: 526 GYFTTKIETEVKYPSLL---NMSR-YAKDGHTGFYKLVGAVFHSGGLGGG 571


>UniRef50_Q9YHZ0 Cluster: Ubiquitin specific protease 66; n=3;
           Gallus gallus|Rep: Ubiquitin specific protease 66 -
           Gallus gallus (Chicken)
          Length = 587

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 38/110 (34%), Positives = 50/110 (45%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YG V +L DCL  F   D L GD   +C RCK      K   I   P +L +HLKRF   
Sbjct: 229 YGEV-TLMDCLRLFTKEDVLDGDEKPTCCRCKARTRCTKKFSIQKFPKILVLHLKRFSEA 287

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            + ++K+             R   ++S    V  Y+L AV +H GT  GG
Sbjct: 288 RIRASKLTTFVNFPLKDLDLREFASQSCNHAV--YNLYAVANHSGTTMGG 335



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 19/40 (47%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S +SD+F G+L S++ C  C   ST  + F DLSLPIP +
Sbjct: 188 SRVSDLFVGQLKSSLTCSECGYCSTAFDPFWDLSLPIPKK 227


>UniRef50_Q80U87 Cluster: Ubiquitin carboxyl-terminal hydrolase 8;
            n=23; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
            hydrolase 8 - Mus musculus (Mouse)
          Length = 1080

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQDCL  F   ++L  +N + CS C+  R+ +K   I  LP VL VHLKRF ++  +  
Sbjct: 925  TLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ 984

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    L++    P+  + +Y+L +V +H G + GG
Sbjct: 985  KL--QTSVDFPLENLDLSQYVIGPKNSLKKYNLFSVSNHYGGLDGG 1028



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 21/48 (43%), Positives = 25/48 (52%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
            SII  +F G+  S VQCL C R S   E F  LSLP+ S     +  C
Sbjct: 882  SIIVALFQGQFKSTVQCLTCRRRSRTFEAFMYLSLPLASTSKCTLQDC 929


>UniRef50_P40818 Cluster: Ubiquitin carboxyl-terminal hydrolase 8;
            n=18; Amniota|Rep: Ubiquitin carboxyl-terminal hydrolase
            8 - Homo sapiens (Human)
          Length = 1118

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQDCL  F   ++L  +N + CS C+  R+ +K   I  LP VL VHLKRF ++  +  
Sbjct: 963  TLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ 1022

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    L++    P+  + +Y+L +V +H G + GG
Sbjct: 1023 KL--QTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGG 1066



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
            SII  +F G+  S VQCL C + S   E F  LSLP+ S     +  C
Sbjct: 920  SIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDC 967


>UniRef50_O75604 Cluster: Ubiquitin carboxyl-terminal hydrolase 2;
           n=37; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 2 - Homo sapiens (Human)
          Length = 605

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 451 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 510

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 511 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 556



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 409 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 448


>UniRef50_UPI0000ECA21C Cluster: UPI0000ECA21C related cluster; n=2;
           Gallus gallus|Rep: UPI0000ECA21C UniRef100 entry -
           Gallus gallus
          Length = 573

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 38/110 (34%), Positives = 50/110 (45%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YG V +L DCL  F   D L GD   +C RCK      K   I   P +L +HLKRF   
Sbjct: 418 YGEV-TLMDCLRLFTKEDVLDGDEKPTCCRCKARTRCTKKFSIQKFPKILVLHLKRFSEA 476

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            + ++K+             R   ++S    V  Y+L AV +H GT  GG
Sbjct: 477 RIRASKLTTFVNFPLKDLDLREFASQSCNHAV--YNLYAVSNHSGTTMGG 524


>UniRef50_Q9VVR1 Cluster: CG4166-PA; n=7; Endopterygota|Rep:
           CG4166-PA - Drosophila melanogaster (Fruit fly)
          Length = 735

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 32/105 (30%), Positives = 44/105 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  +  A+ L       CS CK  +   K   +  LP V+  HLKRF H  L   
Sbjct: 584 TLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR 643

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+                  K       R+SL AV++H+GT+  G
Sbjct: 644 KISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTG 688



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKY-----RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP 174
           NS+ + SG++   S+  +       II  +F G L S V C  C+ VST  + F D+SL 
Sbjct: 511 NSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLD 570

Query: 175 I 177
           +
Sbjct: 571 L 571


>UniRef50_Q4P3A5 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1198

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 28/63 (44%), Positives = 38/63 (60%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+LQ CL AF   + L   +M++CSRCK+ R   K   I  LP VL +HLKRF  +  F+
Sbjct: 1036 VALQQCLDAFVREEVLDKGDMWNCSRCKRPRKATKRLSISRLPRVLLIHLKRFSFKGPFT 1095

Query: 489  AKV 497
             K+
Sbjct: 1096 DKI 1098



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216
            S++ D F G+  + + CL C + ST  E F  LSLP+PS   +  +  QQ
Sbjct: 991  SLVVDWFQGQFRNKLTCLTCGKTSTTYEAFTYLSLPVPSGRGVGKVALQQ 1040


>UniRef50_A4RQS8 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 311

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +LQ CLAAF   + L G   Y C  C K+++  K + I  LP VLC+HLKRF
Sbjct: 162 TLQQCLAAFVRNETLSGHGRYFCDGCGKVQSATKSTRIAKLPPVLCLHLKRF 213



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/60 (38%), Positives = 31/60 (51%)
 Frame = +1

Query: 1   LVPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           L P S +   G       V    I+ ++F G  ++ V C+ C+R S R E F DLSLPIP
Sbjct: 84  LSPTSPKTPQGKCEQDDGVTGDKIM-EIFGGVAVTTVTCMKCERSSERREPFMDLSLPIP 142


>UniRef50_Q6C1K8 Cluster: Yarrowia lipolytica chromosome F of strain
            CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
            lipolytica|Rep: Yarrowia lipolytica chromosome F of
            strain CLIB122 of Yarrowia lipolytica - Yarrowia
            lipolytica (Candida lipolytica)
          Length = 992

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 39/118 (33%), Positives = 53/118 (44%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +L DC   F   + L+G+NM+ C  CKK R  +K   I  LP  L +HLKRF H   +  
Sbjct: 829  TLYDCFNQFTQPELLEGENMWQCPTCKKPRPTIKSMKISRLPETLIIHLKRFDHSRGYGD 888

Query: 492  KVXXXXXXXXTI-----WT*RLTR-----TKSAPRXVS---RYSLXAVISHMGTVGGG 626
            K+         +     W    +       K  PR  +   RYSL  V +H GT+ GG
Sbjct: 889  KLNTFVTYPLEMDLTRYWPPPTSEDEPFLKKLLPRGQTAPFRYSLFGVANHYGTLRGG 946



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S I D F G+  S +QC +C   ST    F  L+LPIP
Sbjct: 783 SFIVDEFQGQYQSKLQCTVCKMTSTTYTAFSSLTLPIP 820


>UniRef50_Q4RYN3 Cluster: Chromosome 16 SCAF14974, whole genome
            shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 16
            SCAF14974, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1669

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/54 (48%), Positives = 33/54 (61%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            +SL  CL AF S +EL  D +Y CS+CK  R   K   +  LP +L VHLKRF+
Sbjct: 1292 ISLDSCLKAFTSEEELGEDELYYCSKCKTHRLATKKLDLWRLPPILIVHLKRFQ 1345



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 64   RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
            RSI+ D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 908  RSIVVDLFHGQLKSQVKCKTCGHISARFDPFNFLSLPLPMDSYM 951


>UniRef50_Q0U5W3 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1620

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L +C      ++ L  DN + CSRCK+LR   K   I  +P +L +HLKRF     F 
Sbjct: 1269 ITLDECFTETSKSEILSEDNAWYCSRCKELRRAKKTLEIWTVPDILIIHLKRFSGHRTFR 1328

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVS-RYSLXAVISHMGTVGGG 626
             K+         +    L+     P      Y L AV +H G +GGG
Sbjct: 1329 DKI--EELIDFPVEGLDLSGKVGFPEGKDLTYDLFAVDNHFGGLGGG 1373


>UniRef50_A7Q084 Cluster: Chromosome chr8 scaffold_41, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_41, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 667

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 31/106 (29%), Positives = 47/106 (44%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           VSL  CL AF   + L  ++M++C  CKK R   K   +  LP +L +HLKRF +   + 
Sbjct: 514 VSLYKCLEAFLKEEPLGPEDMWNCPCCKKHRQASKKLDLWRLPEILVIHLKRFSYSRFWK 573

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                  +      + Y L A+ +H G +G G
Sbjct: 574 NKLETFIDFPIDDLDLSTYIAQKNSHLSNHYKLYAICNHYGGMGSG 619



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           SII ++  G+  S + C +C +VS   + F  LSLP+PS
Sbjct: 237 SIIVNLCQGQFRSMLVCPVCKKVSVTFDPFMYLSLPLPS 275


>UniRef50_Q9Y4E8 Cluster: Ubiquitin carboxyl-terminal hydrolase 15;
            n=50; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
            hydrolase 15 - Homo sapiens (Human)
          Length = 981

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 784  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 843

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 844  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 890



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 432 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 472


>UniRef50_P39538 Cluster: Ubiquitin carboxyl-terminal hydrolase 12;
            n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
            carboxyl-terminal hydrolase 12 - Saccharomyces cerevisiae
            (Baker's yeast)
          Length = 1254

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL  F   + L   + + C  CK+ R   K   +   P +L +HLKRF  +  FS
Sbjct: 962  ITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQIQLWNTPDILLIHLKRFESQRSFS 1021

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+        T +   R    K  PR +  Y L AV +H G +GGG
Sbjct: 1022 DKIDATVNFPITDLDLSRYVVYKDDPRGLI-YDLYAVDNHYGGLGGG 1067



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I+D+F G   S + C  C  VS   + + D++LP+P
Sbjct: 520 SVITDLFVGMYKSTLYCPECQNVSITFDPYNDVTLPLP 557


>UniRef50_Q9ZSB5 Cluster: F3H7.5 protein; n=5; Arabidopsis
            thaliana|Rep: F3H7.5 protein - Arabidopsis thaliana
            (Mouse-ear cress)
          Length = 1028

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF + + L  D+M+ C  CK+ R   K   +  LP +L  HLKRF +     
Sbjct: 777  ISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLK 836

Query: 489  AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +   +  + K+    +  Y L AV +H G +GGG
Sbjct: 837  NKIDTFVNFPVHDLDLSKYVKNKNGQSYL--YELYAVSNHYGGLGGG 881



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DV  G+  S + C +C ++S   + F  LS+P+PS
Sbjct: 475 SVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSVPLPS 513


>UniRef50_Q33AW7 Cluster: Ubiquitin carboxyl-terminal hydrolase family
            protein, expressed; n=7; Magnoliophyta|Rep: Ubiquitin
            carboxyl-terminal hydrolase family protein, expressed -
            Oryza sativa subsp. japonica (Rice)
          Length = 931

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 34/106 (32%), Positives = 46/106 (43%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L  CL AF   + L  D+M+ C RC + +   K   +  LP +L VHLKRF +     
Sbjct: 760  VNLFSCLDAFLKDEPLGPDDMWYCPRCTEHKQASKKLDLWRLPEILVVHLKRFSYSRFMK 819

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                   S       Y L AVI+H G +GGG
Sbjct: 820  NKLDTFVNFPIHDLDMSRYANHSRGDQPPIYELYAVINHYGGMGGG 865



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           SII D F G+  S + C  C ++S   + F  LSLP+PS
Sbjct: 453 SIIVDKFQGQYKSTLVCPDCKKISVTFDPFMYLSLPLPS 491


>UniRef50_Q0DGV1 Cluster: Os05g0510300 protein; n=4; Oryza
           sativa|Rep: Os05g0510300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 644

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+ D LA FF  + L+G N YSC RCKKL +  K   ++  P VL + LKRF
Sbjct: 200 SVADALARFFQPEILEGSNKYSCERCKKLTSARKQLFVLRAPKVLVIQLKRF 251



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = +1

Query: 28  SGSSGDGSNVKYR-----SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           S ++GD    + R      ++ + F G LLS V+CL C   S + +   D+SL +P    
Sbjct: 141 SNANGDAGEEEVRVQGPYMVMKETFGGALLSQVKCLTCKGESNKTDEIMDISLDLPGSNS 200

Query: 193 LA 198
           +A
Sbjct: 201 VA 202


>UniRef50_Q16MY5 Cluster: Ubiquitin specific protease; n=1; Aedes
           aegypti|Rep: Ubiquitin specific protease - Aedes aegypti
           (Yellowfever mosquito)
          Length = 803

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL--LF 485
           S+Q  L  + S+++L GDN Y C +CK+L +G +   I   P  L + LK FR++L    
Sbjct: 551 SVQKLLDFYCSSEKLIGDNQYYCDKCKQLCDGERSIRITKSPRNLILTLKHFRYDLHRHT 610

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            AK+        TI + R+T  +  P  V +YSL A + H GT
Sbjct: 611 RAKLMNQVQHNETI-SLRVTPEEGHP-FVVQYSLYAAVVHAGT 651



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHAA 240
           ++I  +F GKL    QC +CD  ST ++  +   L  P    +      Q +L+ + +
Sbjct: 504 TLIQRMFDGKLFVTYQCGVCDSKSTNLDAIRSFELSFPESNGIKTEYSVQKLLDFYCS 561


>UniRef50_A7S8P2 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1526

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/55 (41%), Positives = 36/55 (65%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
            + L +CL AF + +EL  + ++ C++CKK R  VK   I  LP +L +HLKRF++
Sbjct: 1179 IDLYECLRAFTNEEELGDEELWYCNKCKKHRLAVKKLEIWSLPPILVIHLKRFQY 1233



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +SII D+F G+L S V+C+ C  VS R + F  LSLP+P
Sbjct: 798 QSIIVDLFQGQLKSQVRCVECGYVSARFDPFTFLSLPLP 836


>UniRef50_A7RVY4 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 2450

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +LQD L  F + + L+GDN Y C +C K R  VK   I  LP VL + LKRF ++
Sbjct: 1695 NLQDSLEQFVNGEILEGDNAYFCEKCNKRRTTVKRMCIKTLPPVLVIQLKRFGYD 1749


>UniRef50_Q0U4Z9 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1057

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/61 (40%), Positives = 35/61 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            SL+DCL ++ +A+ L GD ++ C +CKK R  VK   +   P  L VH KRF      SA
Sbjct: 868  SLRDCLQSYCAAERLAGDELWRCPQCKKDREAVKKITLTRAPDTLVVHFKRFSASRTESA 927

Query: 492  K 494
            +
Sbjct: 928  R 928



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216
           S+I  +F G+  S + C  C   ST  E F  LSL IP+ E  ++  C Q
Sbjct: 825 SVIGGMFAGQHASQLTCQTCGVTSTTYEAFWSLSLEIPNVEACSLRDCLQ 874


>UniRef50_UPI00015B5DED Cluster: PREDICTED: similar to ubiquitin
           specific protease 41; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ubiquitin specific protease 41 -
           Nasonia vitripennis
          Length = 852

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 23/40 (57%), Positives = 30/40 (75%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I DVF G+L S+++C +CD VS  ++ F DLSLPIPSR
Sbjct: 626 STIVDVFVGQLRSSLRCTVCDHVSVTLDPFWDLSLPIPSR 665



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 34/107 (31%), Positives = 44/107 (41%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           V L  CL  F   + L GD   +CS+C+  R   K   I   P +L +HLKRF     F 
Sbjct: 669 VRLNQCLEHFTREEVLDGDEKPTCSKCQMRRKCTKSFAIQKFPKILVIHLKRFSPMERFR 728

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVS-RYSLXAVISHMGTVGGG 626
            K+        T          +APR     Y+L  V +H GT   G
Sbjct: 729 GKLSVLVDFPLTGLE---LSAFAAPRVQGCTYNLYGVANHSGTTHSG 772


>UniRef50_A7QJ40 Cluster: Chromosome chr2 scaffold_105, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr2 scaffold_105, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 743

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           ++L  CL AF   + L   +M+ C  CK+ R   K   +  LP +L  HLKRF +     
Sbjct: 576 ITLFSCLEAFLKEEPLGPQDMWYCPNCKEHRQATKKLDLWRLPDILVFHLKRFSYSRYLK 635

Query: 489 AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+         ++   +  + K A      Y L A+ +H G +GGG
Sbjct: 636 NKLDTLVNFPIHSLDLSQYVKCKDASSQSHVYELYAISNHYGGLGGG 682



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I DV  G+  S + C +C ++S   + F  LSLP+PS
Sbjct: 162 SLIVDVCQGQYKSTLVCPVCSKISITFDPFMYLSLPLPS 200


>UniRef50_A7RVV5 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1018

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 33/108 (30%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = +3

Query: 306  VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
            VV L DC+  F + ++L  ++ + C +CKK +   K   +  LP VL +HLKRF +  L+
Sbjct: 780  VVQLNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSYTSLW 839

Query: 486  SAKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
              K+          +        K  P  +  Y L  V +H G +GGG
Sbjct: 840  RDKIDTLVNFPLCGLDMSDYVIGKDGPPPL--YDLIGVSNHYGGMGGG 885



 Score = 33.9 bits (74), Expect = 3.8
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C+++S   +    LSLP+P ++
Sbjct: 434 SIIVDIFHGLFKSTLVCPECNKISVTFDPLCYLSLPLPVKK 474


>UniRef50_A5E220 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 829

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HE 476
           V+L DCL  F + + L  DN + C RCKKL    K   I  LP +L ++ KRF+ HE
Sbjct: 646 VTLNDCLEEFITTELLDEDNKWHCPRCKKLTKSTKRIAITRLPQILILYFKRFKLHE 702



 Score = 40.7 bits (91), Expect = 0.033
 Identities = 20/40 (50%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII D F G+ LS ++CL C   ST    F  LSLPIP +
Sbjct: 598 SIIVDKFQGQYLSQLKCLECKFTSTSYNAFSILSLPIPEK 637


>UniRef50_A5DB37 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 879

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           PV+ L DCL AF + + L  DN + C +CKK     K   I  LP VL VH KRF+
Sbjct: 693 PVLLLDDCLDAFVTTELLDDDNKWFCPQCKKRTKLTKKLTITRLPQVLIVHFKRFK 748



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII D F G+  S ++CLIC   ST    F  LSLPIP+R
Sbjct: 648 SIIVDFFQGQYSSQLRCLICGATSTTYNAFLILSLPIPTR 687


>UniRef50_Q6CEM1 Cluster: Yarrowia lipolytica chromosome B of strain
            CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
            lipolytica|Rep: Yarrowia lipolytica chromosome B of
            strain CLIB122 of Yarrowia lipolytica - Yarrowia
            lipolytica (Candida lipolytica)
          Length = 1449

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            + L +CL  F +++ L  D+++ C  CK  R   K   +   P +L +HLKRF     F 
Sbjct: 1105 IDLSECLDLFSASEVLSDDDLWYCPVCKDFRQATKKIELWKCPEILVIHLKRFSSSRNFR 1164

Query: 489  AKV--XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+             T R+   K++   +  Y L  V +HMG +GGG
Sbjct: 1165 DKISEVVHFPIEGLDLTERVGEAKASDSPLI-YDLIGVDNHMGGLGGG 1211



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +1

Query: 37  SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S D   ++  S I D+F G   S V C +  + S   + F DL+LP+P
Sbjct: 662 SWDVHRLRNDSPILDLFTGMYKSTVVCPVSQQASITFDPFSDLTLPLP 709


>UniRef50_Q752E9 Cluster: AFR627Cp; n=1; Eremothecium gossypii|Rep:
            AFR627Cp - Ashbya gossypii (Yeast) (Eremothecium
            gossypii)
          Length = 1287

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/106 (29%), Positives = 46/106 (43%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL  F + + L   + + C  CK+ R   K   +   P +L +HLKRF ++  FS
Sbjct: 962  ITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQATKQIELWNAPDILLIHLKRFENQRSFS 1021

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+        T                  Y L AV +H G +GGG
Sbjct: 1022 DKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGG 1067



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I+D+F G   S + C +C + S   + + DL+LP+P
Sbjct: 499 SVITDLFVGLYKSTLICPVCKKTSVTFDPYNDLTLPLP 536


>UniRef50_Q9SJA1 Cluster: Putative ubiquitin carboxyl terminal
           hydrolase; n=5; Arabidopsis thaliana|Rep: Putative
           ubiquitin carboxyl terminal hydrolase - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 672

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G  VSL++CL  F + + L+GDN+Y C RC       K   I   P +L + LKRF+
Sbjct: 330 HGDAVSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQ 387


>UniRef50_Q54BB6 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1085

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+ C+  F + ++L  ++ + CS+CK+ +   K   I   P +L VHLKRF ++    
Sbjct: 833  VNLEQCIKLFTTEEQLGPEDPWYCSKCKEHQRATKKFDIWSSPPILVVHLKRFSYKRSHR 892

Query: 489  AKV-XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +   +    K  P  +  Y L AV +H G++GGG
Sbjct: 893  DKLDTLVKFPFKDLDLSQYVLNKDQPAPI--YDLFAVSNHYGSLGGG 937



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I D F  +L S + C +C  +S   + F  LSLP+PS
Sbjct: 481 SVIVDWFQSQLKSKLVCPVCQNISITFDPFMYLSLPLPS 519


>UniRef50_Q1DW30 Cluster: Putative uncharacterized protein; n=2;
            Onygenales|Rep: Putative uncharacterized protein -
            Coccidioides immitis
          Length = 1671

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL +CL  F   + L  ++ + C RCK+ R   K   +  +P +L +HLKRF     F 
Sbjct: 1309 ISLAECLDEFGREEILSENDAWYCPRCKEHRRASKKFELWTVPDILVMHLKRFSANRGFR 1368

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPR--XVSRYSLXAVISHMGTVGGG 626
             K+         +    +T    AP       Y L AV +H GT+GGG
Sbjct: 1369 DKLDVLVDFPLEL---DMTGRAQAPNDGKSMMYDLIAVDNHYGTLGGG 1413



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I+D+F G   S V C  CD+VS   + F +L+L +P
Sbjct: 804 SVITDLFAGMYKSTVVCPACDKVSIIFDPFSNLTLQLP 841


>UniRef50_UPI0000E470C7 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 159

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 37/107 (34%), Positives = 48/107 (44%), Gaps = 2/107 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF--RHELLF 485
           +L D L  +   + L GDN + C +CK LR+G K   I   P VL + LKRF   H  L 
Sbjct: 4   NLADALELYTKPETLTGDNKFRCEKCKTLRSGTKKMEIERCPKVLIIQLKRFSSSHSGL- 62

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           + KV                 ++ A    SRY L AV +H G   GG
Sbjct: 63  TRKVETHVDVPLRGLDLSNNMSQDAD-PSSRYQLQAVCNHYGGTAGG 108


>UniRef50_UPI000065FAD0 Cluster: Ubiquitin carboxyl-terminal hydrolase
            11 (EC 3.1.2.15) (Ubiquitin thioesterase 11)
            (Ubiquitin-specific-processing protease 11)
            (Deubiquitinating enzyme 11).; n=1; Takifugu
            rubripes|Rep: Ubiquitin carboxyl-terminal hydrolase 11
            (EC 3.1.2.15) (Ubiquitin thioesterase 11)
            (Ubiquitin-specific-processing protease 11)
            (Deubiquitinating enzyme 11). - Takifugu rubripes
          Length = 898

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 3/109 (2%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V LQ+C+  F + + L+ +N + C  CKK +   K   +  LP VL +HLKRF +  L  
Sbjct: 784  VQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKLTR 843

Query: 489  AK---VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K   V              L +T S+    S Y L AV +H G +  G
Sbjct: 844  EKLESVVEFPLRDLDFSGFLLRKTVSSEEPPSCYDLIAVSNHYGGLRDG 892



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP-SREHL 195
           S+I D F G   S + C  C ++S   + F  LS+P+P S+E +
Sbjct: 408 SVIVDTFHGLFKSTLICPECQKISVTFDPFCYLSVPLPVSKERI 451


>UniRef50_Q5DD02 Cluster: SJCHGC05186 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05186 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 666

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 19/55 (34%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L DC+  +   ++L GDN Y+CS+C + R+G++   I   P +LC+   RF ++
Sbjct: 222 TLPDCIRDYLKEEQLIGDNQYACSQCGRKRDGIRRVYITRAPPLLCIQFLRFTYD 276


>UniRef50_Q4DCS7 Cluster: Ubiquitin hydrolase, putative; n=2;
            Trypanosoma cruzi|Rep: Ubiquitin hydrolase, putative -
            Trypanosoma cruzi
          Length = 1207

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 32/106 (30%), Positives = 52/106 (49%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L++CL + +S D L GDN   CS+CK  R+        ++P  L + LKRFR  +  +
Sbjct: 1045 VTLEECLESTYSPDILAGDNARECSKCKARRDSKIERRPFLMPPCLIISLKRFRVHMEEA 1104

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +K          +        +S P   ++YSL  V++H G +  G
Sbjct: 1105 SKNNTRVAFPMELDMAPYMDPES-PVQNAKYSLRGVVTHRGGINHG 1149


>UniRef50_Q55ZS2 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 659

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   LA F   D L+GDN Y C RCK+  N  K   I   P +L +HLKRF
Sbjct: 325 SVLGMLAGFTKEDRLEGDNKYHCERCKRKANATKSFKIDQAPPILTLHLKRF 376


>UniRef50_A7TGT6 Cluster: Putative uncharacterized protein; n=1;
            Vanderwaltozyma polyspora DSM 70294|Rep: Putative
            uncharacterized protein - Vanderwaltozyma polyspora DSM
            70294
          Length = 1223

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/106 (28%), Positives = 48/106 (45%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL  F   + L  ++ + C  CK+ R   K   +   P +L +HLKRF ++  FS
Sbjct: 909  ITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQATKQLQLWSTPDILLIHLKRFENQSSFS 968

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+        T          +     + Y L +V +H G +GGG
Sbjct: 969  DKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLVSVDNHYGGLGGG 1014



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII+D+F G   S + C  CD +S   + + DL+LP+P
Sbjct: 495 SIITDIFVGLYKSTLHCPECDNLSVTFDPYNDLTLPLP 532


>UniRef50_Q9P7V9 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 9; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 9 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 585

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 30/100 (30%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL +F +++ L   N + C  CK L+   K   I  LP +L +HLKRF++      
Sbjct: 269 SVTSCLRSFSASEMLSSKNKFHCDVCKSLQEAEKRMKIKKLPKILSLHLKRFKYNETQEG 328

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                     T      T T+ A      Y L +VI H+G
Sbjct: 329 HDKLFYTIVFTNEMRLFTTTEDAENAERMYYLSSVIVHVG 368



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 40  GDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           G+ S+V +   +  +F G L S  +CL C+ +++R E+F DLS+ I    H +V  C
Sbjct: 219 GNHSDVMHPKWVHSLFEGTLTSETKCLTCENITSRDESFLDLSIDI--ENHTSVTSC 273


>UniRef50_A7QK71 Cluster: Chromosome chr19 scaffold_111, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome chr19 scaffold_111, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 562

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 33/100 (33%), Positives = 45/100 (45%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+  L  FF  + L G+N Y C  CKKL +  K   I+  P VL + LKRF  E L+  
Sbjct: 189 SLKQALQNFFQPEVLDGNNKYKCDNCKKLVSARKQMSILQAPNVLVIQLKRF--EGLYGG 246

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+         +        K++      Y+L A I H G
Sbjct: 247 KIDKLIAFEEVL-VLSSYMNKASQDSHPEYNLFATIVHSG 285



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +1

Query: 25  KSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + G++ +G +    S++ D+F G L S V+CL C   S + +   D+SL +
Sbjct: 136 RKGNNDNGPSTT--SVVKDIFGGALQSQVKCLSCGAESNKTDEIMDISLDV 184


>UniRef50_A0DVR1 Cluster: Chromosome undetermined scaffold_66, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_66,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 472

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L  C++ +   +EL   N + CS+CK ++   K   +  LP +L +HLKRF+    F+A 
Sbjct: 238 LIQCISEYLREEELDEANQWHCSKCKSVKKSKKGIKLWKLPNILVIHLKRFK----FTAN 293

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
                          L  +  + +  + Y L  VI+H GT+  G
Sbjct: 294 YRCKLRWLINFPMYNLDLSNYSEQEQATYDLYGVINHSGTLHSG 337



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           RSII D+F G+ ++ +QC++C+  S + ETF  LSLPI
Sbjct: 195 RSIIVDLFQGQSINMLQCMVCNTKSYKFETFMYLSLPI 232


>UniRef50_A3LWQ3 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 848

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           VSL DCL  F + + L  +N + C RCK+     K   I  LP +L +H KRF+
Sbjct: 664 VSLDDCLKEFTTTELLDDNNKWHCPRCKRFTKSTKKITITRLPQILIIHFKRFK 717



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/40 (50%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII D F G+ LS ++CL C   ST    F  LSLPIP +
Sbjct: 616 SIIVDYFQGQYLSQLKCLECGMTSTTYNAFSVLSLPIPEK 655


>UniRef50_UPI0000DB72FC Cluster: PREDICTED: similar to
           ubiquitin-specific protease 2 isoform Usp2-69; n=2;
           Coelomata|Rep: PREDICTED: similar to ubiquitin-specific
           protease 2 isoform Usp2-69 - Apis mellifera
          Length = 643

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 22/40 (55%), Positives = 29/40 (72%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S+I DVF G+L S++ C  CD VS  ++ F DLSLPIP+R
Sbjct: 448 SMIVDVFVGQLRSSLHCTSCDHVSVTLDPFWDLSLPIPAR 487



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/107 (31%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           V L  CL  F   + L GD   +CS+C+  R   K   I   P +L +HLKRF     F 
Sbjct: 491 VKLSQCLEHFTREEVLDGDEKPTCSKCQMRRKCTKSFSIQKFPKILVIHLKRFSPMERFR 550

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVS-RYSLXAVISHMGTVGGG 626
           +K+        T          +APR     Y+L  V +H GT   G
Sbjct: 551 SKLNVMVDFPLTGLD---LSAFAAPRVPGCTYNLYGVANHSGTTHSG 594


>UniRef50_Q0ILU8 Cluster: Os12g0621000 protein; n=4; Oryza sativa|Rep:
            Os12g0621000 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 893

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 30/105 (28%), Positives = 46/105 (43%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            SL  CL AF   + L  ++M+ C  CK+ R   K   +  LP +L +HLKRF +      
Sbjct: 725  SLYACLEAFIKEEPLGPEDMWYCPGCKEHRQASKKLDLWRLPEILIIHLKRFSYSRYTKN 784

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                      +  + Y L A+ +H G++GGG
Sbjct: 785  KLETCVDFPVHDLDLSKYIGSRGQQISNHYRLYAISNHYGSMGGG 829


>UniRef50_Q0E2F9 Cluster: Os02g0244300 protein; n=4; Oryza
           sativa|Rep: Os02g0244300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 975

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/58 (41%), Positives = 33/58 (56%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G V SLQD L  F + ++L G+NMY C RC       K   +  +P +L V LKRF+
Sbjct: 597 HGWVESLQDALTQFTAPEDLDGENMYKCGRCSAYVKARKQLSVHEVPNILTVVLKRFQ 654



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++++  ++I  +F G+L S V+CL C   S R E   DL+L I
Sbjct: 554 ASLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEI 596


>UniRef50_Q9P987 Cluster: Ubiquitin carboxyl-terminal hydrolase;
           n=1; Pichia anomala|Rep: Ubiquitin carboxyl-terminal
           hydrolase - Hansenula anomala (Yeast) (Candida
           pelliculosa)
          Length = 443

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           +L+ CL  F +++ L G N + C  C  L+   K  G+  LP +L +HLKRF++
Sbjct: 113 TLETCLKQFSASEMLNGSNKFYCDNCHSLQEAEKKMGLRKLPKILALHLKRFKY 166



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 18/44 (40%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           ++ + D+F G L +  +CL C+ VS+R ETF DLS+ +   E L
Sbjct: 71  KNALHDLFEGLLTNQTKCLTCENVSSRDETFLDLSIDLTDNETL 114


>UniRef50_Q4PF40 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 756

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 32/101 (31%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL D   AF + D+L G   Y C +CK+  +  K   I   P  L VHLKRF     F  
Sbjct: 368 SLTDAFRAFVAKDQLTGSEKYKCDKCKRKVDATKQFTIETAPPALTVHLKRFSP---FGG 424

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
           K+         +    +    S      RY L AV+ H G+
Sbjct: 425 KISRQVAFDEKL---NIAPYLSVNHGPVRYKLYAVVHHYGS 462



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++  S +  +F GKL S V C  C   S   + F DLSL +
Sbjct: 322 IRATSFVQKIFGGKLRSRVTCHKCGHNSDTFDPFMDLSLDV 362


>UniRef50_UPI0000ECD19D Cluster: Ubiquitin carboxyl-terminal
           hydrolase 44 (EC 3.1.2.15) (Ubiquitin thioesterase 44)
           (Ubiquitin-specific-processing protease 44)
           (Deubiquitinating enzyme 44).; n=1; Gallus gallus|Rep:
           Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)
           (Ubiquitin thioesterase 44)
           (Ubiquitin-specific-processing protease 44)
           (Deubiquitinating enzyme 44). - Gallus gallus
          Length = 521

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 21/42 (50%), Positives = 28/42 (66%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           ++++++F G+LLS V CL CD  S  IE F DLSL  P R H
Sbjct: 282 NVVNNIFHGQLLSQVTCLACDNKSNTIEPFWDLSLEFPERYH 323



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKK-LRNGVKLSGIVVLPXVLCVHLKRFR 470
           L + LA F   + L+G  +Y+C +C   L    K   +  LP VL +HLKRFR
Sbjct: 337 LTEMLAKFTETEALEG-KIYACDQCNIILTEAQKQLMVCRLPQVLRLHLKRFR 388


>UniRef50_Q25AN5 Cluster: H0811D08.10 protein; n=6; Oryza
           sativa|Rep: H0811D08.10 protein - Oryza sativa (Rice)
          Length = 562

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 22/56 (39%), Positives = 30/56 (53%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V +L  CL  F  A+ L  +  + C RCK+ +  +K   I  LP V C H+KRF H
Sbjct: 381 VSTLMRCLERFTRAERLDAEQKFFCERCKERQESLKQMSIRRLPLVSCFHIKRFEH 436


>UniRef50_Q23JM8 Cluster: Ubiquitin carboxyl-terminal hydrolase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ubiquitin carboxyl-terminal hydrolase family protein -
           Tetrahymena thermophila SB210
          Length = 1170

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 19/45 (42%), Positives = 34/45 (75%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++ +SI+ D+F G+L S ++CL+C+ VS + +TF  LS+PIP ++
Sbjct: 234 LRNKSIVVDLFQGQLKSTLKCLVCETVSHKFDTFMYLSVPIPQQD 278



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           ++S++DC+  F   ++L     + C+ CKK     K   +   P +L +HLKRF
Sbjct: 285 IISIEDCIEEFTKEEKLDKSEWWLCTSCKKRTPSTKKIDLWKTPNILIIHLKRF 338


>UniRef50_A7SNI6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 632

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNG-VKLSGIVVLPXVLCVHLKRFRHELLF 485
           V+L +C   +   + L  D+ + C RCKKL+ G VK   +  LP VL +HLKRFR +LLF
Sbjct: 430 VNLDNCFELYTKDETLGLDDAWLCPRCKKLQQGTVKKLSLWSLPEVLIIHLKRFR-QLLF 488



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S + D+F  +  SA+ C  C + ST  + F  LSLPIP R
Sbjct: 149 SFVLDLFQAQYRSALSCPKCKQKSTTFDPFLCLSLPIPQR 188


>UniRef50_A7SN67 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 359

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 2/111 (1%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           G  V ++DC+  F   + L GD   +C +CKK R   K   +   P +L +HLKRF    
Sbjct: 202 GGDVDIRDCMELFTKEEVLDGDERPTCEKCKKKRKSTKKFTVQRFPRILVIHLKRF-SGY 260

Query: 480 LFSAKVXXXXXXXXTIWT*RLTRTKSAPR--XVSRYSLXAVISHMGTVGGG 626
            F +K+        T     L    + P     + YSL AV +H G+  GG
Sbjct: 261 GFRSKLQTNVVFPVTS-PQELGEFAADPSEGQSAVYSLYAVSNHSGSTYGG 310



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 19/40 (47%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S+I+D+F G L S + CL C   S   + F DLSLPIP +
Sbjct: 150 SLITDLFVGVLKSTLICLECGFKSVTFDPFWDLSLPIPRK 189


>UniRef50_Q6FLQ2 Cluster: Candida glabrata strain CBS138 chromosome L
            complete sequence; n=1; Candida glabrata|Rep: Candida
            glabrata strain CBS138 chromosome L complete sequence -
            Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 1147

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 30/107 (28%), Positives = 47/107 (43%)
 Frame = +3

Query: 306  VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
            +++L  CL  F   + L  ++ + C +CK+ R   K   +   P +L +HLKRF ++  F
Sbjct: 844  IITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQATKQLELWNTPEILLIHLKRFENQRSF 903

Query: 486  SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            S K+                   S       Y L AV +H G +GGG
Sbjct: 904  SDKIDAVVDFPIEGLDMTPYVVDSVVEDGCIYDLFAVDNHYGGLGGG 950



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 16/57 (28%), Positives = 31/57 (54%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           N+ +  +  + D    +  S+I+D+F G   S ++C  C  +S   + + DL+LP+P
Sbjct: 425 NAVKQLAKKTWDAHLARNDSVINDLFVGMYKSTLKCPTCKNISITFDPYNDLTLPLP 481


>UniRef50_Q70EL3 Cluster: Inactive ubiquitin carboxyl-terminal
           hydrolase 50; n=21; Mammalia|Rep: Inactive ubiquitin
           carboxyl-terminal hydrolase 50 - Homo sapiens (Human)
          Length = 339

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+DCL  FF  D L  +N   CS C+  +     + I   P ++  HLKRF  ++  + 
Sbjct: 223 SLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRF--DIQGTT 280

Query: 492 KVXXXXXXXXTIWT*RLT-RTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K          +    LT    S  R   +Y+L AV++H G + GG
Sbjct: 281 KRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGG 326



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216
           SII+ +F  +L  ++ CL C++ + + E F   SLPIPS+   ++  C Q
Sbjct: 180 SIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQ 229


>UniRef50_UPI0000E4913D Cluster: PREDICTED: similar to Usp40
           protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Usp40 protein - Strongylocentrotus
           purpuratus
          Length = 1301

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 1/110 (0%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADE-LKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           G  + + D L A++  +E ++G N Y C RCKKL N  K + +  LP +L + L RF ++
Sbjct: 197 GGYIGVVDTLRAYYVEEERMEGSNQYRCDRCKKLVNARKGAKLRSLPPILTISLLRFSYD 256

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +   +          +        + A +  + Y L +V+ H G+  GG
Sbjct: 257 FVKLERFKETGHYTFPLELDMAPYCEQA-KEEALYELYSVVLHSGSTHGG 305


>UniRef50_UPI00006CB657 Cluster: Ubiquitin carboxyl-terminal
           hydrolase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: Ubiquitin carboxyl-terminal hydrolase family
           protein - Tetrahymena thermophila SB210
          Length = 807

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L D L AF   + L  D  Y CS+CK      +   +  LP +L +HLKRF     +  K
Sbjct: 648 LVDLLKAFLKEENLDDD--YYCSKCKARTKSRRQFELYKLPQILVIHLKRFNFGRSYRNK 705

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXV--SRYSLXAVISHMGTVGGG 626
           +        T +  +     S    V  S+Y L  +++H G++ GG
Sbjct: 706 ISSNVSFPVTNFDVQQFIQSSTDNSVKNSKYELFGIVNHSGSLSGG 751



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSL 171
           S+++D F G+LLS V C  C   S   + F DLSL
Sbjct: 602 SVVTDFFSGQLLSKVICSKCKNESLAFDNFMDLSL 636


>UniRef50_Q9GRV2 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 699

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           V L DCL+ FF  + L+      C++CK  +   K   I  LP VLC+H+KRFR
Sbjct: 550 VRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQMFIRKLPQVLCLHMKRFR 603



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLR 207
           IS  F G L S+V C  C   S +I+ F DLSL IP++ + + +R
Sbjct: 507 ISKYFEGTLQSSVICQTCRNCSNKIDEFMDLSLDIPAQRNASKVR 551


>UniRef50_Q5BWR2 Cluster: SJCHGC05197 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05197 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 202

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 30/87 (34%), Positives = 40/87 (45%)
 Frame = +3

Query: 366 NMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAKVXXXXXXXXTIWT*RLT 545
           +++ C+RCK  +   K   +  LP VL V LKRFR  L F  K+        T       
Sbjct: 5   DLWYCNRCKAEKPATKKFDLWKLPDVLVVQLKRFRSHLRFHDKIDTLLEFPLTGLNLTSR 64

Query: 546 RTKSAPRXVSRYSLXAVISHMGTVGGG 626
             +  P     Y L AV +HMG +GGG
Sbjct: 65  VLEKKPDEKFIYDLVAVSNHMGYLGGG 91


>UniRef50_Q6C7Z0 Cluster: Yarrowia lipolytica chromosome D of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome D of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 464

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           +SL+ C+  FF  ++++  + Y C  C+K  +  K S I   P  L VH+KRF+      
Sbjct: 256 ISLKRCITRFFEEEQIQKKDGYKCDECQKTTSAKKTSRIHEFPEHLVVHVKRFKFVNDQP 315

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG-TVGGG 626
            K+         +     +R K     V  Y L  VI+H G T G G
Sbjct: 316 RKMGAPLDYPADLDLGHYSRDKQRAGVVP-YKLIGVIAHCGRTTGSG 361


>UniRef50_Q6BHV0 Cluster: Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii; n=1; Debaryomyces
            hansenii|Rep: Debaryomyces hansenii chromosome G of
            strain CBS767 of Debaryomyces hansenii - Debaryomyces
            hansenii (Yeast) (Torulaspora hansenii)
          Length = 1266

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 32/106 (30%), Positives = 46/106 (43%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            VSL DCL +F + + L   +++ C  CK  +   K   I     +L +HLKRF+    FS
Sbjct: 935  VSLYDCLRSFSTPEILGDQDLWYCPNCKDHKQATKTIQIWSTGDLLTIHLKRFQSARTFS 994

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                 +K        Y L AV +H G +GGG
Sbjct: 995  DKINMVVDFPVEGLDMSSFVSKEKDNSDLIYDLIAVDNHYGGLGGG 1040



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D+F G   S + C  C + S   + F DL+LP+P
Sbjct: 455 SVIVDLFTGLYQSTLICPDCSKTSITFDPFNDLTLPLP 492


>UniRef50_Q4PHN7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1066

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 1/101 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F +++ L+  N + C  C  L+   K   I  LP VL +HLKRF++E     
Sbjct: 475 SVTSCLRQFSASEMLRSRNKFFCDSCSGLQEAEKRMKIKKLPNVLALHLKRFKYEETVQR 534

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMG 611
            V         +   RL  T        R Y L A++ H+G
Sbjct: 535 YVKLAYRVVFPLEL-RLFNTSDDAEDPDRLYELCAIVVHIG 574



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++ +  +F G L +  +CL C+ V++R E F DLS+ I
Sbjct: 433 KTCVHRLFEGVLTNETRCLTCETVTSRDECFLDLSIDI 470


>UniRef50_Q8NFA0 Cluster: Ubiquitin carboxyl-terminal hydrolase 32;
            n=59; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
            hydrolase 32 - Homo sapiens (Human)
          Length = 1604

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            ++L  CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 1233 INLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 1286



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 64   RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
            RSI+ D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 876  RSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 919


>UniRef50_UPI0000F1DDC2 Cluster: PREDICTED: similar to Ubiquitin
           specific peptidase 15; n=1; Danio rerio|Rep: PREDICTED:
           similar to Ubiquitin specific peptidase 15 - Danio rerio
          Length = 634

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L+DC+  F + ++L  D+ + C  CK+ +   K   +  LP VL VHLKRF +      K
Sbjct: 438 LRDCIQLFTTKEKLGADDPWYCPSCKQHQQATKQLDLWSLPPVLVVHLKRFSYSRYMRDK 497

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
           +         +    ++     P   V  Y L AV +H G +GGG
Sbjct: 498 L--DTLVEFPLRDLDMSEFLINPHAGVCLYDLIAVSNHYGGMGGG 540


>UniRef50_Q4RWH0 Cluster: Chromosome undetermined SCAF14988, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF14988, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1000

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 3/109 (2%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V LQ+C+  F + + L+ +N + C  CKK +   K   +  LP VL +HLKRF +     
Sbjct: 757  VQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTR 816

Query: 489  AK---VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K   V              L +   +    SRY L AV +H G +  G
Sbjct: 817  EKLESVVDFPLRNLDFSGFLLRKNVPSQEPPSRYDLIAVSNHYGGLRDG 865


>UniRef50_UPI00015B5024 Cluster: PREDICTED: similar to
           ENSANGP00000009352; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000009352 - Nasonia
           vitripennis
          Length = 1007

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +G  V+L++C   +  A+ L  ++ + C  C + +  VK  G+  LP +L +HLKRFR +
Sbjct: 639 FGGTVTLEECFDLYTRAETLGVEDAWHCPHCNRKQEVVKKLGLWSLPAILVIHLKRFRQQ 698


>UniRef50_Q4SAB0 Cluster: Chromosome 19 SCAF14691, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 19
           SCAF14691, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 333

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+ CL  +F   EL+G+N   C +C         + ++ LP +LC+  KRFR     + 
Sbjct: 165 SLEGCLTTYFELQELRGENCCFCPKCGTQTPSKWGAKLLSLPQILCISFKRFRASRSGTR 224

Query: 492 KVXXXXXXXXTIWT*RLTR---TKSAPRXVSRYSLXAVISHMG 611
           K+        +     + R     S PR    Y L AV+ H G
Sbjct: 225 KLDCRVTFPESFDFAAVVRDAFAPSFPRSHCTYKLFAVVVHSG 267


>UniRef50_Q4RHB2 Cluster: Chromosome 3 SCAF15050, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF15050, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 890

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNG-VKLSGIVVLPXVLCVHLKRFRHE 476
           +L  CL  +   ++L  D+ + C  CK+L+ G +KLS +  LP VL +HLKRFR E
Sbjct: 152 TLAQCLQLYTKEEQLAPDDAWRCPHCKQLQQGRIKLS-LWTLPDVLILHLKRFRQE 206


>UniRef50_Q9VCT9 Cluster: CG7023-PB, isoform B; n=2; Diptera|Rep:
           CG7023-PB, isoform B - Drosophila melanogaster (Fruit
           fly)
          Length = 424

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/101 (25%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L  DN + C  C   +   K   +  LP +L +HLKRF++   F+ 
Sbjct: 263 SITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNR 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            +         +       +  A      Y L AV+ H G+
Sbjct: 323 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGS 363


>UniRef50_Q293T5 Cluster: GA19137-PA; n=1; Drosophila
            pseudoobscura|Rep: GA19137-PA - Drosophila pseudoobscura
            (Fruit fly)
          Length = 945

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 5/109 (4%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL----L 482
            L  C+  +FS + ++G   ++C  CK  R  +K   I  LP VL VHLKRF  +      
Sbjct: 785  LNQCMDMYFSGERIQG---WNCPNCKTKRAAIKKLDISKLPPVLVVHLKRFYADTSNTGS 841

Query: 483  FSAKVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++ K          +  +  + R +S       Y L AV +H GT+ GG
Sbjct: 842  YAKKQNFLSFPLQNLEMSPYIARAESRAAKPKTYQLYAVSNHYGTMEGG 890



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII  +F G++ S V+C+ C++ S   E F +LSL +P
Sbjct: 740 SIILHLFYGQMKSTVKCVTCNKESATYECFSNLSLELP 777


>UniRef50_Q22FY1 Cluster: Ubiquitin carboxyl-terminal hydrolase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ubiquitin carboxyl-terminal hydrolase family protein -
           Tetrahymena thermophila SB210
          Length = 680

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 29/105 (27%), Positives = 47/105 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SLQ C+  F   ++L+   ++ C +CKK +   K   +  +P +L +HLKRF        
Sbjct: 306 SLQRCIQEFTKEEKLERGELWFCPKCKKHQESTKKIDLWKMPNILIIHLKRFEFNKDRRC 365

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+          +    + T    R +  Y L AV +H GT+  G
Sbjct: 366 KLSNKIDFPIKNFD-ISSLTAGKQRDIPIYDLFAVSNHGGTLSSG 409



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/45 (46%), Positives = 31/45 (68%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++ RSII D+F G+  S ++CL C+ VS + ETF  LS+PIP  +
Sbjct: 243 MRNRSIIVDLFQGQTKSTLRCLKCNTVSHKFETFMYLSVPIPDSQ 287


>UniRef50_A0D6V4 Cluster: Chromosome undetermined scaffold_4, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_4, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1160

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            ++L DCL  F S + L   N + CS+CKK +   K   I   P ++ +HLKRFR
Sbjct: 1000 ITLNDCLNQFCSEEVLGAGNEWYCSKCKKHQKAKKQMQIYKAPQIMIMHLKRFR 1053



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +1

Query: 43  DGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           D    +  S I+D+F G+  S V+C  C+ VS   + F  +SLPIPS+E
Sbjct: 691 DNHKKRNDSKITDLFTGQFKSRVECPECNFVSITFDPFVTISLPIPSKE 739


>UniRef50_P50102 Cluster: Ubiquitin carboxyl-terminal hydrolase 8;
           n=5; Saccharomycetales|Rep: Ubiquitin carboxyl-terminal
           hydrolase 8 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 471

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 35/112 (31%), Positives = 48/112 (42%), Gaps = 8/112 (7%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L +CL +F   ++LK  N Y C  C   ++ +K  GI  LP VL + LKRF H L  S +
Sbjct: 316 LYECLDSFHKKEQLKDFN-YHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNR 374

Query: 495 VXXXXXXXXTIWT*R-LTRTKSAPRXVSR-------YSLXAVISHMGTVGGG 626
                    T    +    TK   +           Y L  ++SH GTV  G
Sbjct: 375 KLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEG 426


>UniRef50_Q9FPT5 Cluster: Ubiquitin carboxyl-terminal hydrolase 1;
           n=1; Arabidopsis thaliana|Rep: Ubiquitin
           carboxyl-terminal hydrolase 1 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 1083

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 10  NSARAKSG--SSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           +S R K G   S D S  +  ++I  VF G++ S V CL C   S   E F DLSLP+PS
Sbjct: 303 SSLRKKLGVSDSNDSSTYQKPTLIDSVFGGEISSTVSCLECGHFSKVYEPFMDLSLPVPS 362


>UniRef50_UPI0000519A12 Cluster: PREDICTED: similar to CG30421-PA
           isoform 1; n=2; Endopterygota|Rep: PREDICTED: similar to
           CG30421-PA isoform 1 - Apis mellifera
          Length = 928

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           G  V+L++C   +  A+ L  ++ + C  C K +  VK  G+  LP +L +HLKRFR +
Sbjct: 600 GGAVTLEECFDLYTRAEILGAEDAWHCPYCNKKQEVVKKLGLWSLPDILVIHLKRFRQQ 658


>UniRef50_UPI000049A299 Cluster: ubiquitin carboxyl-terminal
           hydrolase; n=2; Entamoeba histolytica HM-1:IMSS|Rep:
           ubiquitin carboxyl-terminal hydrolase - Entamoeba
           histolytica HM-1:IMSS
          Length = 1477

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           SL + L +  + DEL G+N Y C +CKK  + ++ + I   P  L +HLKRF  +
Sbjct: 449 SLTESLQSLVNGDELTGENKYFCEKCKKKVDAIRRTCIKTPPNTLILHLKRFEFD 503


>UniRef50_A3BU50 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1035

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/57 (42%), Positives = 30/57 (52%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + SL+  L  F S + L GDN Y CSRCK      K   I   P VL + LKR++
Sbjct: 525 GDISSLEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKRYQ 581


>UniRef50_Q9VR54 Cluster: CG14619-PA, isoform A; n=4; Sophophora|Rep:
            CG14619-PA, isoform A - Drosophila melanogaster (Fruit
            fly)
          Length = 856

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 711  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 768

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 769  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 812



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 667 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 714


>UniRef50_Q8IQ27 Cluster: CG14619-PC, isoform C; n=1; Drosophila
            melanogaster|Rep: CG14619-PC, isoform C - Drosophila
            melanogaster (Fruit fly)
          Length = 938

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 793  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 850

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 851  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 894



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 749 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 796


>UniRef50_Q5BY17 Cluster: SJCHGC08766 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08766 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 217

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/63 (36%), Positives = 33/63 (52%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           + L DC   F   ++L   +++ C+RCK  +   K   +  LP VL V LKRFR  L F 
Sbjct: 127 LQLSDCFERFTDVEQLGSRDLWYCNRCKAEKPATKKFDLWKLPDVLVVQLKRFRSHLRFH 186

Query: 489 AKV 497
            K+
Sbjct: 187 DKI 189


>UniRef50_UPI00015B4278 Cluster: PREDICTED: similar to CG7023-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG7023-PA - Nasonia vitripennis
          Length = 687

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/101 (24%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L  DN + C  C   +   K   +  LP +L +HLKRF++   ++ 
Sbjct: 526 SITHCLKCFSNTETLCSDNKFKCDHCSSYQEAQKRMMLKKLPMILALHLKRFKYVEQYNR 585

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            +         +       +  A      Y L AV+ H G+
Sbjct: 586 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLVAVVIHCGS 626



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +1

Query: 10  NSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           N ++   G  +GD       + + ++F G L S  +CL C+ VS++ E F DL + +   
Sbjct: 465 NQSKPAGGKGAGDAGTPPEPTWVHEIFQGILTSETRCLNCETVSSKDEDFFDLQVDVDQN 524

Query: 187 EHLA-VLRC 210
             +   L+C
Sbjct: 525 TSITHCLKC 533


>UniRef50_UPI00006CA72F Cluster: Ubiquitin carboxyl-terminal
           hydrolase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: Ubiquitin carboxyl-terminal hydrolase family
           protein - Tetrahymena thermophila SB210
          Length = 778

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/57 (40%), Positives = 34/57 (59%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           S+Q     FF  ++L+G+N Y CS+CKKL    K   I  LP VL + +KRF + ++
Sbjct: 213 SVQKSFELFFRKEKLEGNNKYRCSKCKKLVEAQKGYVIHQLPNVLTLQIKRFNNFMM 269



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSL 171
           I  +F GKL S V+C +C+  S  IE F DLSL
Sbjct: 176 IYKMFAGKLKSQVECSVCNYRSENIEAFYDLSL 208


>UniRef50_A3KQN0 Cluster: Novel protein similar to vertebrate
           ubiquitin specific protease 43; n=3; Danio rerio|Rep:
           Novel protein similar to vertebrate ubiquitin specific
           protease 43 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1122

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +L DC   +   ++L  D+ + C  CK+++ G+    +  LP +L +HLKRFR
Sbjct: 554 TLDDCFQLYTKEEQLAPDDAWKCPHCKQMQQGMVKMSLWTLPDILILHLKRFR 606


>UniRef50_Q0J140 Cluster: Os09g0464400 protein; n=3; Oryza
           sativa|Rep: Os09g0464400 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 937

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/57 (38%), Positives = 32/57 (56%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + +L++ L  F S + L GDN Y+CSRCK      K   I   P +L + LKR++
Sbjct: 548 GDINTLEEALHRFTSTEILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQ 604


>UniRef50_Q9GRZ4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 357

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           SL  CL + FS  +L GD+ ++C +CK+ R   + S +   P V+ +HLKRF
Sbjct: 210 SLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRF 261


>UniRef50_Q8ILU9 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium falciparum 3D7|Rep: Putative uncharacterized
            protein - Plasmodium falciparum (isolate 3D7)
          Length = 1384

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/52 (42%), Positives = 30/52 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            +L+D L  F S + L G+N Y C +CKK +   K   I  LP VL + +KRF
Sbjct: 881  NLEDALKHFLSKEMLAGENGYYCEKCKKKKKATKQCVINKLPRVLTIQIKRF 932


>UniRef50_Q6BFI8 Cluster: Ubiquitin-specific protease, putative;
           n=2; Paramecium tetraurelia|Rep: Ubiquitin-specific
           protease, putative - Paramecium tetraurelia
          Length = 326

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           P  SL  CL      ++L G N + C +C+  ++  K   +  LP VL +HLKRF+++
Sbjct: 171 PNYSLNTCLQQMSKEEQLNGQNQFFCDKCQSKQDASKRLLLNTLPNVLVIHLKRFKYD 228



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +1

Query: 58  KYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           K  + I  +F G+ L+  +CL C  +S R E + DLSL +
Sbjct: 130 KQNNWIRQIFQGQQLTQTECLNCHTISQREEMYCDLSLDL 169


>UniRef50_Q5BXR8 Cluster: SJCHGC04287 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04287 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 222

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 30/105 (28%), Positives = 48/105 (45%), Gaps = 1/105 (0%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L DCL  F   +E+ G   + C  C   R+  K   +  LP  L +HLKRFR+E  +   
Sbjct: 62  LTDCLKLFLEKEEMVGQCRWHCPTCNTRRDASKWIELWKLPTYLIIHLKRFRYE--YDTW 119

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
                     + +  ++     P+   S Y+L +V++H GT+  G
Sbjct: 120 RKQTTNVDFPVESLDMSPFIVGPKLHSSEYALYSVLNHRGTMESG 164



 Score = 33.9 bits (74), Expect = 3.8
 Identities = 19/48 (39%), Positives = 22/48 (45%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           SII   F G L S V+C  C   ST  + F  LSLPI       +  C
Sbjct: 18  SIIVSSFQGLLRSTVKCNNCHVTSTTFDVFMVLSLPIEQNNTCQLTDC 65


>UniRef50_Q237F7 Cluster: Ubiquitin carboxyl-terminal hydrolase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ubiquitin carboxyl-terminal hydrolase family protein -
           Tetrahymena thermophila SB210
          Length = 528

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/106 (25%), Positives = 46/106 (43%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           +++QDC+  F   + L GD  + C  CK  +   K   +  LP +L + +KRF++     
Sbjct: 358 INIQDCIEQFTEKEILDGDEKWFCPECKDFQKSEKKIDLWKLPPILMICMKRFQYTAQSK 417

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+          +       K+  +    Y L +VISH G +  G
Sbjct: 418 KKITTKVQFPVQHFDMSEFIPKTLQKEKPIYDLFSVISHKGYLNFG 463



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           +S+I D+F G+L + ++CL C     + E F  L++PIP +
Sbjct: 313 KSVIVDLFQGQLKNTLKCLKCKTAKYQFEPFMYLTVPIPQK 353


>UniRef50_Q1RPW0 Cluster: Zinc finger protein; n=1; Ciona
            intestinalis|Rep: Zinc finger protein - Ciona
            intestinalis (Transparent sea squirt)
          Length = 1145

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 3/111 (2%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE-L 479
            P   L +CL+ F   + L  D  + C +CKK R  +K   +  LP VL + LKRF  +  
Sbjct: 831  PKYDLLECLSLFTEPEILTQDEAWYCPQCKKHRQAMKKMSLWDLPDVLIIQLKRFSFKNY 890

Query: 480  LFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR--YSLXAVISHMGTVGGG 626
            L+  K+        + +   +T   + P+      Y L AVI+H G + GG
Sbjct: 891  LWRDKINMFIDLPVSNFD--MTSYCNNPKTSKSLCYDLFAVINHHGGILGG 939



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I + F G L S ++CL+C   S + + F  LS+P+P +
Sbjct: 507 SFIIENFHGLLKSQLKCLVCKTKSVKFDPFLFLSVPLPKK 546


>UniRef50_Q1RL25 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 993

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +1

Query: 43  DGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           +G   +   ++  VF GKL S V+CL C  +S+ IE F DLSL  P R H+
Sbjct: 717 NGLATRISKVVHAVFEGKLHSMVKCLECGNISSTIEPFWDLSLEFPQRYHV 767



 Score = 26.2 bits (55), Expect(2) = 9.2
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRC 389
           +L + L  F  A++L G  +Y+C++C
Sbjct: 780 TLSEMLEKFTEAEQLDGGCVYNCAKC 805



 Score = 25.0 bits (52), Expect(2) = 9.2
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +3

Query: 390 KKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +KL    K   I  LP +L  HLKRFR
Sbjct: 829 QKLTEAEKQIKISKLPQILRFHLKRFR 855


>UniRef50_Q7RWU7 Cluster: Putative uncharacterized protein NCU00480.1;
            n=2; Sordariales|Rep: Putative uncharacterized protein
            NCU00480.1 - Neurospora crassa
          Length = 1806

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 35/108 (32%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL DCLA F   + L   + + C RCK+ R   K   +   P +L VHLKRF       
Sbjct: 1397 ISLDDCLAEFEKEEILSEQDTWYCPRCKEHRRASKKFDLWKTPDILVVHLKRFSSVGWRR 1456

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  V           T R+   +   + +  Y L AV  H G +GGG
Sbjct: 1457 DKLDVLVDFPIEGLDLTERVIDKEDGKQEI--YDLIAVDDHWGGLGGG 1502



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 16/38 (42%), Positives = 26/38 (68%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SII+D+F G   S + C +CD++S   + F +L+LP+P
Sbjct: 880 SIIADLFTGLYKSTLHCPVCDKISITFDPFNNLTLPLP 917


>UniRef50_Q6FQF0 Cluster: Candida glabrata strain CBS138 chromosome
           I complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome I complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 887

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           SII D+F G+  S ++C +C+R ST  + F  LS+P+PS +   +L C
Sbjct: 682 SIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVPSGKSCGLLDC 729



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 21/56 (37%), Positives = 26/56 (46%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           G    L DC   F   + L+ D  + C  CKK +   K   I  LP  L +HLKRF
Sbjct: 721 GKSCGLLDCFIEFTKTENLEVDEQWFCPSCKKKQPSTKKLTITRLPRNLIIHLKRF 776


>UniRef50_O22207 Cluster: Ubiquitin carboxyl-terminal hydrolase 5;
            n=1; Arabidopsis thaliana|Rep: Ubiquitin
            carboxyl-terminal hydrolase 5 - Arabidopsis thaliana
            (Mouse-ear cress)
          Length = 924

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 3/109 (2%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            +SL  CL AF   + L  D M+ C +C + R   K   +  LP VL +HLKRF +    S
Sbjct: 768  LSLYACLEAFLREEPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSR--S 825

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR---YSLXAVISHMGTVGGG 626
             K          I    LT+   A + +S+   Y L A+ +H G +G G
Sbjct: 826  MKHKLETFVNFPIHDLDLTK-YVANKNLSQPQLYELYALTNHYGGMGSG 873



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           SII DV  G+  S + C IC++VS   + F  LSLP+
Sbjct: 459 SIIVDVCQGQYKSTLVCPICNKVSVTFDPFMYLSLPL 495


>UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal
            hydrolase 12; n=1; Schizosaccharomyces pombe|Rep:
            Probable ubiquitin carboxyl-terminal hydrolase 12 -
            Schizosaccharomyces pombe (Fission yeast)
          Length = 979

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 6/112 (5%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL  F   ++L  ++ + C  CK+ R   K   I   P +L  HLKRF  E  F 
Sbjct: 825  ITLNDCLDEFEKTEQLGEEDPWYCPTCKEFRQASKQMEIWRCPEILIFHLKRFSSERRFR 884

Query: 489  AKVXXXXXXXXTIWT*RL------TRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+              +         K  P+ +  Y L AV +H G +GGG
Sbjct: 885  DKIDDLVEFPIDNLDMSMRTGSYKLSEKENPKLI--YELYAVDNHYGGLGGG 934



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S+I D+F G   S + C +C+ VS   + F DL+LP+P ++
Sbjct: 457 SLIVDLFQGMYRSTLVCPVCNTVSITFDPFMDLTLPLPVKQ 497


>UniRef50_A7QXG5 Cluster: Chromosome undetermined scaffold_223,
           whole genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_223, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 912

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/58 (39%), Positives = 32/58 (55%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G V SL+D L  F + ++L G+NMY C RC       K   I   P +L + LKRF+
Sbjct: 582 FGWVESLEDALTQFTTPEDLDGENMYRCRRCTTYVRARKQLSIHEAPNILTIVLKRFQ 639



 Score = 32.7 bits (71), Expect = 8.8
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + I   F G+L S V+CL C   S R E   DL+L I
Sbjct: 545 TFIQHTFGGRLRSKVKCLRCHLESERYENIMDLTLEI 581


>UniRef50_Q9TU68 Cluster: Ubiquitin-specific protease; n=5;
           Amniota|Rep: Ubiquitin-specific protease - Sus scrofa
           (Pig)
          Length = 321

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL G +   C  C +     ++  +  LP  L +HL RF  + L
Sbjct: 154 PLKTLEDALHCFFQPRELSGRDKCFCENCGRKTCWKQVLKLSRLPQTLTLHLMRFSIKNL 213

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAP-----RXVSRYSLXAVISHMGTVGGG 626
            + KV        ++    L  T+  P     +   RY L AVI+HMG    G
Sbjct: 214 RTEKVCHSLYFPQSLDLNPLLETEEEPCAAEGQPGGRYELFAVIAHMGLADFG 266


>UniRef50_Q7QJP0 Cluster: ENSANGP00000009352; n=2; Culicidae|Rep:
           ENSANGP00000009352 - Anopheles gambiae str. PEST
          Length = 1029

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           ++L+ C   +  A+ L  DN + C  C++    VK  G+  LP ++ +HLKRFR + L
Sbjct: 443 LTLEQCFEHYTKAETLGQDNAWKCPHCQEYLPVVKTLGLWSLPDIMVIHLKRFRQQQL 500


>UniRef50_A4I2S8 Cluster: Ubiquitin hydrolase, putative; n=3;
           Leishmania|Rep: Ubiquitin hydrolase, putative -
           Leishmania infantum
          Length = 575

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR--HELL 482
           VSL DC AA+   + L   +MY C  C +  N  K       P VL + LKRFR   +  
Sbjct: 432 VSLDDCFAAYCREEILDDSSMYMCPNCHQKVNARKQLLFYSAPPVLFITLKRFRCYGDFT 491

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++KV        T+    +     +    ++Y L  +I+H G + GG
Sbjct: 492 TASKVNSSVFFSKTL---NIASYMCSSFSKTKYHLVGIINHQGNMYGG 536


>UniRef50_Q7SGN8 Cluster: Putative uncharacterized protein
           NCU08378.1; n=3; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU08378.1 - Neurospora crassa
          Length = 941

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 31/100 (31%), Positives = 42/100 (42%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L   N + C RC  L+   K   I  LP VL +HLKRF++   +S 
Sbjct: 396 SVTSCLRKFSAEEMLCERNKFHCDRCGGLQEAEKRMKIKKLPKVLALHLKRFKYTEDYSR 455

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                       +      T  A      Y L AVI H+G
Sbjct: 456 LQKLFHRVVYPYYLRMFNTTDDAEDPDRIYELYAVIVHIG 495



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/48 (45%), Positives = 30/48 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S + D+F G L+S  +CL C+ VS R ETF DLS+ +   EH +V  C
Sbjct: 355 SWVHDIFEGVLVSETRCLTCETVSQRDETFLDLSIDL--EEHSSVTSC 400


>UniRef50_Q6BK50 Cluster: Similar to CA5333|CaDOA4 Candida albicans
           CaDOA4 ubiquitin-specific isopeptidase; n=1;
           Debaryomyces hansenii|Rep: Similar to CA5333|CaDOA4
           Candida albicans CaDOA4 ubiquitin-specific isopeptidase
           - Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 913

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/54 (40%), Positives = 28/54 (51%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           V L DCL  F + + L  DN + C  CK+     K   I  LP VL +H KRF+
Sbjct: 729 VLLHDCLEGFVTTELLDDDNKWHCPSCKRFTKLTKKITITRLPQVLIIHFKRFK 782



 Score = 40.7 bits (91), Expect = 0.033
 Identities = 20/40 (50%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII D F G+ LS ++CL C   ST    F  LSLPIP +
Sbjct: 683 SIIVDFFQGQYLSQLKCLECGLTSTTYNAFLILSLPIPEK 722


>UniRef50_A3LW63 Cluster: Predicted protein; n=3;
           Saccharomycetaceae|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 565

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/61 (39%), Positives = 32/61 (52%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           G  + L DCL  F S ++L  D MY+C  C      +K   +  LP VL + LKRF+H  
Sbjct: 408 GSQIDLYDCLDLFTSDEKL--DVMYTCQSCGDKTKAIKSLSVKSLPPVLSIQLKRFKHNS 465

Query: 480 L 482
           L
Sbjct: 466 L 466



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           I    F G+L S+++CL C+ V+  I+   DLSL I
Sbjct: 364 ITHSTFSGELQSSIRCLSCESVTKTIDPMVDLSLEI 399


>UniRef50_Q9H0E7 Cluster: Ubiquitin carboxyl-terminal hydrolase 44;
           n=37; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 44 - Homo sapiens (Human)
          Length = 712

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/40 (50%), Positives = 27/40 (67%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++++F G+LLS V CL CD  S  IE F DLSL  P R
Sbjct: 463 NVVNNIFHGQLLSQVTCLACDNKSNTIEPFWDLSLEFPER 502


>UniRef50_UPI0000E4767F Cluster: PREDICTED: hypothetical protein; n=1;
            Strongylocentrotus purpuratus|Rep: PREDICTED:
            hypothetical protein - Strongylocentrotus purpuratus
          Length = 1337

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 29/106 (27%), Positives = 42/106 (39%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L+DC  AF  ++ L   N + C  CKK +   K   +   P  L V+LKRF      S
Sbjct: 1070 ITLRDCFQAFTESETLDEHNPWFCPECKKPQPASKTISVCRFPDTLIVYLKRFVFHQAMS 1129

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                   + P+    Y L   +SH G V  G
Sbjct: 1130 TKLDNKVLFPVEDMDVGEYMGVATPQEDLVYDLQGAVSHFGGVNAG 1175



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +S++ D F G+  S V C +C  VS   E F  LS+P+P
Sbjct: 551 QSVVIDTFQGQFKSTVVCAVCGHVSIMFEPFMYLSVPLP 589


>UniRef50_UPI0000F3362C Cluster: Ubiquitin carboxyl-terminal hydrolase
            24 (EC 3.1.2.15) (Ubiquitin thioesterase 24)
            (Ubiquitin-specific-processing protease 24)
            (Deubiquitinating enzyme 24).; n=1; Bos taurus|Rep:
            Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15)
            (Ubiquitin thioesterase 24)
            (Ubiquitin-specific-processing protease 24)
            (Deubiquitinating enzyme 24). - Bos Taurus
          Length = 1820

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/52 (44%), Positives = 30/52 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+  L  F   + L+G N Y C +CK+ R  VK + I  LP VL +HL RF
Sbjct: 1597 SLEISLDQFVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKSLPSVLVIHLMRF 1648


>UniRef50_Q9FKP5 Cluster: Similarity to ubiquitin carboxyl-terminal
           hydrolase; n=1; Arabidopsis thaliana|Rep: Similarity to
           ubiquitin carboxyl-terminal hydrolase - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 731

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           G + SL++ LA F + + L G+N Y C RCK  +   K   I+  P +L V LKRF+ +
Sbjct: 483 GDIGSLEEALAQFTAYEVLDGENRYFCGRCKSYQKAKKKLMILEGPNILTVVLKRFQSD 541


>UniRef50_Q8MQX4 Cluster: SD04548p; n=2; Drosophila melanogaster|Rep:
            SD04548p - Drosophila melanogaster (Fruit fly)
          Length = 896

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 5/112 (4%)
 Frame = +3

Query: 306  VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF----RH 473
            V  L  C+  +FS + + G   + C  CK  R+ +K   I  LP VL VHLKRF     +
Sbjct: 738  VCQLNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSN 794

Query: 474  ELLFSAKVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               +  K          +     + R +S       Y L AV +H GT+ GG
Sbjct: 795  SGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGG 846



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL-RCQQPMLNHHAAH 243
           S+I  +F G++ S V+C+ C + S   E+F +LSL +P   ++  L +C     +    H
Sbjct: 696 SMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIH 755


>UniRef50_Q7Q848 Cluster: ENSANGP00000001119; n=2;
           Endopterygota|Rep: ENSANGP00000001119 - Anopheles
           gambiae str. PEST
          Length = 253

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 29/95 (30%), Positives = 42/95 (44%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAKVXXX 506
           L + F  +EL    +Y C+ CK  +   K   I  LP VLC+H+KRFR    +  K+   
Sbjct: 127 LISHFQVEELAETELYYCNSCKCKQKSTKRFWIRRLPNVLCLHIKRFRWNNFYRTKIDLR 186

Query: 507 XXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                      L  ++ +    + Y L AVI H G
Sbjct: 187 IAFPIN----ALDMSQRSNSSCNIYDLAAVIVHHG 217



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 4/51 (7%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP----SREHLAVLR 207
           SI+++VF G L S V+CLIC   S + + F DLSL IP    S+EH+ +LR
Sbjct: 77  SIVTNVFGGVLQSEVRCLICGMESKKHDPFLDLSLDIPEKYYSKEHV-ILR 126


>UniRef50_Q4E407 Cluster: Ubiqitin hydrolase, putative; n=2;
           Trypanosoma cruzi|Rep: Ubiqitin hydrolase, putative -
           Trypanosoma cruzi
          Length = 761

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           ++L++CL   F    LKG N Y C+ C  +    K   ++ LP  L + +KRF +   F+
Sbjct: 403 ITLKECLDIHFEPVVLKGSNSYHCASCNNVSEATKREFLLSLPEYLLLQMKRFEYGTCFN 462

Query: 489 AK 494
            K
Sbjct: 463 TK 464


>UniRef50_Q4DS35 Cluster: Ubiquitin hydrolase, putative; n=2;
           Trypanosoma cruzi|Rep: Ubiquitin hydrolase, putative -
           Trypanosoma cruzi
          Length = 465

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query: 333 AFFSADE-LKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +F  A+E L+G N   C+RC++LRNG +   I+  P +L +HLKRF
Sbjct: 334 SFDEAEEKLRGGNQLLCARCRRLRNGTRSVKIIRWPKILVLHLKRF 379



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP-IPSREHLAVL 204
           SII D+F G + S   C  C +VS   + F DLSLP IP     A +
Sbjct: 281 SIIYDLFGGVMRSRCVCSSCGKVSLTFDPFLDLSLPMIPGARKAATI 327


>UniRef50_Q6FXS7 Cluster: Candida glabrata strain CBS138 chromosome
           A complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome A complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 770

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/101 (24%), Positives = 48/101 (47%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           + +Q+ L +F   + L G N + C  C  L+   ++ G+  LP  L +HLKRF++    +
Sbjct: 525 IDIQEILESFHQKEMLHGPNKFYCDECCGLQEAERVVGLKQLPKTLALHLKRFKYSEQQN 584

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           + +         +   +++ T + P     Y L  ++ HMG
Sbjct: 585 SNIKLFDKVSYPL-DLKVSSTFN-PSISKNYELSGIVVHMG 623



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 18/63 (28%), Positives = 35/63 (55%)
 Frame = +1

Query: 13  SARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++    S G  ++   ++ +SD+F G L + ++CL CD  + R E F  L  PI  +E+
Sbjct: 465 NSKIYDSSQGRRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDEPF--LDFPIEVQEN 522

Query: 193 LAV 201
           + +
Sbjct: 523 VDI 525


>UniRef50_Q6FT56 Cluster: Candida glabrata strain CBS138 chromosome G
            complete sequence; n=1; Candida glabrata|Rep: Candida
            glabrata strain CBS138 chromosome G complete sequence -
            Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 947

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 36/119 (30%), Positives = 53/119 (44%), Gaps = 13/119 (10%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L DC   F   ++L+ D  ++C  CKK +   K   I  LP  L +HLKRF + +  +
Sbjct: 782  VNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPSTKQLTITRLPRNLIIHLKRFDNRMNKN 841

Query: 489  AKV--XXXXXXXXTIWT----*RLTRTKSAPRXVSR-------YSLXAVISHMGTVGGG 626
             K+          + W      RL    S     +R       YSL AV +H G++ GG
Sbjct: 842  TKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGG 900



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+I D+F G+  S ++C +C   ST  + F  LS+P+P+
Sbjct: 738 SVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPT 776


>UniRef50_O74442 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 16; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 16 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 457

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 31/100 (31%), Positives = 41/100 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL D L  F  A++L   N Y C  CK+L +  K   I   P +L +H KRF      S+
Sbjct: 285 SLADSLKHFVHAEKLTKQNKYRCENCKQLVDASKQMTIYRAPNILTIHFKRFTFNGFQSS 344

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+        +     L    S P     Y L  V+ H G
Sbjct: 345 KISKQISYPESF---NLGPYMSDPNCSCWYELIGVLVHAG 381


>UniRef50_UPI00015A75EB Cluster: Ubiquitin carboxyl-terminal
           hydrolase 4 (EC 3.1.2.15) (Ubiquitin thioesterase 4)
           (Ubiquitin-specific-processing protease 4)
           (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein
           homolog).; n=1; Danio rerio|Rep: Ubiquitin
           carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin
           thioesterase 4) (Ubiquitin-specific-processing protease
           4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear
           protein homolog). - Danio rerio
          Length = 619

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           V+L++C+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 445 VALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWR 504

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGTVGGG 626
            K+         I    ++     P+     Y L AV +H G +GGG
Sbjct: 505 DKL--DTVVDFPIRDLNMSEFVCDPKADPYIYDLIAVSNHYGGMGGG 549



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C +VS   + F  L+LP+P ++
Sbjct: 148 SIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKK 188


>UniRef50_UPI000069FAE8 Cluster: Ubiquitin carboxyl-terminal
           hydrolase 35 (EC 3.1.2.15) (Ubiquitin thioesterase 35)
           (Ubiquitin-specific-processing protease 35)
           (Deubiquitinating enzyme 35).; n=3; Tetrapoda|Rep:
           Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)
           (Ubiquitin thioesterase 35)
           (Ubiquitin-specific-processing protease 35)
           (Deubiquitinating enzyme 35). - Xenopus tropicalis
          Length = 334

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +1

Query: 16  ARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           A+  S S    +   +R+++  +F G++ + ++CL C  VS+R E F DLSL  P     
Sbjct: 116 AQTNSSSGVKKTMASHRTLLEQMFGGRITTKIRCLKCHSVSSREEVFTDLSLAFPPTNEA 175

Query: 196 AVLRCQQPMLNH 231
           A    +Q ++NH
Sbjct: 176 A----KQHLINH 183


>UniRef50_Q4S4W4 Cluster: Chromosome 2 SCAF14738, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 2
           SCAF14738, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 850

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNG-VKLSGIVVLPXVLCVHLKRFRHE 476
           SL  C   +   ++L  D+ + C  CK+L+ G +KLS +  LP +L +HLKRFR +
Sbjct: 153 SLAQCFQLYTKEEQLAPDDAWRCPHCKQLQQGSIKLS-LWTLPDILILHLKRFRQD 207


>UniRef50_Q9FPS9 Cluster: Ubiquitin-specific protease 15; n=3;
           Arabidopsis thaliana|Rep: Ubiquitin-specific protease 15
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 924

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 36/107 (33%), Positives = 46/107 (42%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YG V   QD L  F   ++L G+NMY CSRC       K   I   P +L + LKRF+ E
Sbjct: 594 YGWVEFFQDALIQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQ-E 652

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTV 617
             +                  +TRT   P     Y L AVI H+ T+
Sbjct: 653 GRYGKINKCISFPEMLDMIPFMTRTGDVP---PLYMLYAVIVHLDTL 696



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +++  +F G+L S V+CL CD  S R E   DL+L I
Sbjct: 557 TLVQHMFGGRLHSKVKCLRCDHESERYENIMDLTLEI 593


>UniRef50_A7NUN3 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1090

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           G + +L++ L  F S + L G+N Y CSRCK      K   +   P +L + LKRF+
Sbjct: 706 GDIGTLEEALHKFTSTEILDGENKYQCSRCKSYEKAKKKLTVSEAPNILTIALKRFQ 762


>UniRef50_Q7JQI1 Cluster: LD36231p; n=3; Sophophora|Rep: LD36231p -
           Drosophila melanogaster (Fruit fly)
          Length = 852

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+QD +  + S ++L GDN Y C +CKKL +  +  G+   P  L + LK+F+++
Sbjct: 588 SVQDLIEYYCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYD 642


>UniRef50_Q555S8 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 919

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 30/100 (30%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL   L  F  ++ L G N Y CS+CKKL    K   I + P +L   +KRF     +  
Sbjct: 394 SLTKGLTNFVKSELLDGSNKYKCSKCKKLVKAQKRLQIHIAPPILTCQIKRFSFLGSYGG 453

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+        ++    L+   +     S Y L AV+ H+G
Sbjct: 454 KINRQIQFDQSL---NLSPFMTQSNNHSIYDLYAVLVHLG 490


>UniRef50_Q22E47 Cluster: Ubiquitin carboxyl-terminal hydrolase family
            protein; n=1; Tetrahymena thermophila SB210|Rep:
            Ubiquitin carboxyl-terminal hydrolase family protein -
            Tetrahymena thermophila SB210
          Length = 2585

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +L +CL +F   + L GDN Y C +C K    +K   I  LP  L + LKRF  +L    
Sbjct: 1751 TLYECLQSFVQGEMLDGDNSYFCEKCDKKVPTLKRQSIKKLPNQLIIVLKRFHFDLDVMQ 1810

Query: 492  KV 497
            K+
Sbjct: 1811 KI 1812


>UniRef50_A7S677 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 981

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           P +SL++ L  FF  + L+G N Y C RC+ L++  +   I   P  L + LKRF + +
Sbjct: 672 PSISLEEMLGYFFEPEMLEGSNQYHCERCQGLQDAERSVVIANAPMFLVLTLKRFSYNV 730



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 23/60 (38%), Positives = 31/60 (51%)
 Frame = +1

Query: 19  RAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLA 198
           R+ SG+ G G ++   +II D F G+L+    C  C  VS R E F DL L  P +   A
Sbjct: 541 RSMSGA-GLGQDM-ISNIIEDTFSGRLIVCHSCRRCRHVSCREEAFTDLPLAFPHQRDAA 598


>UniRef50_A2F7X4 Cluster: Clan CA, family C19, ubiquitin
            hydrolase-like cysteine peptidase; n=1; Trichomonas
            vaginalis G3|Rep: Clan CA, family C19, ubiquitin
            hydrolase-like cysteine peptidase - Trichomonas vaginalis
            G3
          Length = 1201

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L  C   F + + L  DN + C  C++     K   +  +P  L +HLKRF     +S
Sbjct: 885  VTLDKCFEYFCTEEVLDEDNEWRCPNCEQFVCATKKMDLWSVPKCLVIHLKRFSAGEYYS 944

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
             K          I    + +    P    ++Y L AV  HMG++GGG
Sbjct: 945  HKDERYVDYPDVI---DIGKYIVGPHPGCTKYQLYAVSEHMGSLGGG 988


>UniRef50_Q6FQK5 Cluster: Candida glabrata strain CBS138 chromosome
           I complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome I complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 724

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 20/63 (31%), Positives = 36/63 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           +++QD   +F+  + L G N + C+ C  L+   K  G   LP  L +HLKRF+ + + +
Sbjct: 497 INIQDTFRSFYQREILCGPNKFYCNECCGLQEAEKTVGFEKLPKTLALHLKRFKCDGIVN 556

Query: 489 AKV 497
           +K+
Sbjct: 557 SKL 559



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAV 201
           + D F G LL+ ++CL CD VS   E F D  + I + E + +
Sbjct: 457 VKDQFEGVLLNRIKCLTCDCVSANEEPFLDFPIEIQNDEAINI 499


>UniRef50_Q6CRK0 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome D of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 750

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 3/103 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKG-DNM--YSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           S++  +  FF+ + +K  DN   Y+C +CKK+ N +K + I+  P  L VHLK+FR    
Sbjct: 548 SIEKSIRDFFNPELIKRVDNKEGYTCEKCKKVTNALKSNKIIRAPETLVVHLKKFRFNGT 607

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
            S+K+         +          +   V RY L +V+ H G
Sbjct: 608 SSSKMKQAVSYPMFLDLTEYCHESISSLPV-RYQLISVVVHEG 649



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII DVF G L  +V+C  C  +ST  +   DLSL +  R+
Sbjct: 478 SIIYDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLHLKGRK 518


>UniRef50_Q59ZY4 Cluster: Putative uncharacterized protein DOA4;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein DOA4 - Candida albicans (Yeast)
          Length = 811

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/54 (38%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           VSL +CL  F + + L  +N + C  CKK     K   I  LP VL ++ KRF+
Sbjct: 631 VSLDECLQEFVTTELLDDNNKWYCPNCKKFTKSTKKIAITRLPQVLIINFKRFK 684



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 20/40 (50%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII D F G+ LS ++CL C   ST    F  LSLPIP +
Sbjct: 585 SIIVDYFQGQYLSQLKCLECGFTSTTYNAFSILSLPIPEK 624


>UniRef50_Q55SM8 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 802

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 1/101 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F S + + G   +SC  C   +   +   I  LP +L VHLKRF H   + A
Sbjct: 406 SITSCLRQFSSDEMMSGREKFSCESCSGHQEAKRSIRIKRLPPILAVHLKRFAHNESYRA 465

Query: 492 -KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
            K+        T+     T     P  +  Y L A++ H+G
Sbjct: 466 IKLFYRVNHPTTLIPPNTTDNCENPDQI--YDLVAIMVHIG 504



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           ++ +  +F G   S  +CL C+ +S+R E F DLS+ I   +H ++  C
Sbjct: 364 KTFVEALFQGITTSETKCLSCETISSRDEEFIDLSVDI--EQHCSITSC 410


>UniRef50_A6SC99 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1613

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            SL++ L A+   + ++GDN Y C  C +  N VK + +  +P  L  HLKRF   L
Sbjct: 1408 SLEESLQAYVEGEAMEGDNKYKCGTCDRHVNAVKRACLTDVPDNLIFHLKRFDFNL 1463


>UniRef50_A5DNK0 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 589

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 3/57 (5%)
 Frame = +3

Query: 336 FFSADELKGDNM---YSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAKV 497
           FFS + ++ D     Y C +CK+L N  K+S I   P  L VHLKRF+ +   S+KV
Sbjct: 443 FFSNEVIRADKKDAGYMCEKCKQLTNAHKISTIETAPETLTVHLKRFKFDGNSSSKV 499



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           II D+F G L   V C  C+ VS   + F DLSL I  R
Sbjct: 361 IIYDIFGGLLRQKVTCKKCNHVSETKQEFYDLSLGIKKR 399


>UniRef50_A2QZ56 Cluster: Function: Ubiquitin-specific proteases; n=1;
            Aspergillus niger|Rep: Function: Ubiquitin-specific
            proteases - Aspergillus niger
          Length = 2578

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/57 (36%), Positives = 35/57 (61%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            SL+D L A+   + ++GDN YSC+ C +  + VK + +  +P  L  HLKRF  +++
Sbjct: 1764 SLEDSLQAYVEGEIMQGDNKYSCTSCGRHVDAVKRACLKDVPDNLIFHLKRFDFDMV 1820


>UniRef50_Q70CQ4 Cluster: Ubiquitin carboxyl-terminal hydrolase 31;
           n=28; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 31 - Homo sapiens (Human)
          Length = 1352

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L  C   +   + L  D+ + C  CK+L+ G     +  LP VL +HLKRFR E
Sbjct: 597 TLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQE 651


>UniRef50_Q99K46 Cluster: Ubiquitin carboxyl-terminal hydrolase 11;
           n=13; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 11 - Mus musculus (Mouse)
          Length = 921

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 20/53 (37%), Positives = 33/53 (62%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           V L++C+  F + + L+ +N + CS CK+ +   K   + +LP VL +HLKRF
Sbjct: 738 VQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRF 790


>UniRef50_P53874 Cluster: Ubiquitin carboxyl-terminal hydrolase 10;
           n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
           carboxyl-terminal hydrolase 10 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 792

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 3/103 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNM---YSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           S++  +  FF+ + +K D     Y C +C K  N VK S I+  P  L VHLK+FR    
Sbjct: 585 SIEKSIKDFFNPELIKVDKEQKGYVCEKCHKTTNAVKHSSILRAPETLLVHLKKFRFNGT 644

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
            S+K+         +       +K  P    +Y L +V+ H G
Sbjct: 645 SSSKMKQAVSYPMFLDLTEYCESKELP---VKYQLLSVVVHEG 684



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SII D+F G L   V C  C  +S   + F DLSL +  ++ L
Sbjct: 484 SIIYDIFGGLLKQIVTCKSCGSISKTEQPFYDLSLHLKGKKKL 526


>UniRef50_UPI00004996E1 Cluster: ubiquitin carboxyl-terminal
            hydrolase; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
            ubiquitin carboxyl-terminal hydrolase - Entamoeba
            histolytica HM-1:IMSS
          Length = 880

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 2/111 (1%)
 Frame = +3

Query: 300  GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            G  V+L++C  AF   + +  +N   CS+CK+ +   K   +     +L +HLKRF +  
Sbjct: 691  GDPVTLEECFEAFEVEELMDENNKVYCSKCKEHQPSHKKVDLWSTNQILIIHLKRFGNSN 750

Query: 480  LFSAKVXXXXXXXXTIWT*RLTR--TKSAPRXVSRYSLXAVISHMGTVGGG 626
             +S +          I +  LTR      P     Y+L  V +HMG++GGG
Sbjct: 751  GYS-RDKITTFVDFPIESLDLTRFVKHYDPTTPPIYNLYGVTNHMGSLGGG 800



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH-LAVLRCQQPMLN 228
           SII+D+F  +L S V C +C   + R + +  LSL IP++++ +++  C +   N
Sbjct: 417 SIITDLFAAQLKSKVICDVCHNTNMRFDPYVFLSLAIPNKQNSVSIYVCDKNYQN 471


>UniRef50_UPI000023D7F3 Cluster: hypothetical protein FG06912.1; n=1;
            Gibberella zeae PH-1|Rep: hypothetical protein FG06912.1
            - Gibberella zeae PH-1
          Length = 1618

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L +CL  F  A+ L   +M+ C RCK+ R   K   +   P +L  HLKRF       
Sbjct: 1252 ITLDECLDEFERAEVLSEQDMWYCPRCKEHRRASKKFDLWKSPDILVAHLKRFSSSGYRR 1311

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  V           T R+ + +     +  Y L AV  H G +GGG
Sbjct: 1312 DKLDVMVDFPIEGLDLTSRVIQKEDGKDEI--YDLIAVDDHYGGLGGG 1357



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           P + +  +    D +  +  S+I+D+F G   S ++C  C ++S   + F +L+LPIP
Sbjct: 723 PEAIKEMADKVWDITRCRDDSVIADLFTGLYKSTLKCPECGKISITFDPFNNLTLPIP 780


>UniRef50_UPI00015A7FD8 Cluster: Novel ubiquitin specific protease;
            n=1; Danio rerio|Rep: Novel ubiquitin specific protease -
            Danio rerio
          Length = 1938

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 23/52 (44%), Positives = 29/52 (55%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+  L  F   + L G N Y C +CK+ R  VK + I  LP VL +HL RF
Sbjct: 1621 SLEISLDQFVRGEVLDGSNAYYCEKCKEKRTTVKRTCIKSLPSVLVIHLMRF 1672


>UniRef50_Q16TQ0 Cluster: Ubiquitin specific protease; n=2;
            Culicidae|Rep: Ubiquitin specific protease - Aedes
            aegypti (Yellowfever mosquito)
          Length = 1801

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 25/53 (47%), Positives = 30/53 (56%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            V L  CL AF S ++L  +  Y CS CK+ +   K   I  LP VL VHLKRF
Sbjct: 1479 VDLDHCLRAFTSEEKL--EQWYHCSHCKQKKPATKKLQIWKLPPVLIVHLKRF 1529



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +1

Query: 52   NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
            + + +SII D+F G+L S V C  C R S R + F  LSLP+P
Sbjct: 891  HARNQSIIVDLFYGQLKSKVTCTGCGRDSVRFDPFSLLSLPLP 933


>UniRef50_A7S0W3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 462

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 29/97 (29%), Positives = 44/97 (45%)
 Frame = +3

Query: 336 FFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAKVXXXXXX 515
           F   + L  ++   C++C+  +   K   +  LP V+C HLKRF H    S K+      
Sbjct: 329 FTRPESLGSESKIKCNKCQSYQESTKQLSMRKLPIVVCFHLKRFEHSKK-SKKISTYIPF 387

Query: 516 XXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
              +          AP   S+YSL AV++H GT+  G
Sbjct: 388 PQEL--------DMAPFLSSKYSLFAVVNHSGTLEVG 416



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 19/48 (39%), Positives = 28/48 (58%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQ 213
           II  +F G L S V C  C+ VST ++ F D+SL +   +H  V+ C+
Sbjct: 281 IIDRIFTGGLQSDVICQTCNCVSTTVDPFWDISLDLGHGDHKLVIFCR 328


>UniRef50_A7RVS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 775

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE-LLFS 488
           +L++C   F   + L  D+ + C +CKK R   K   +  LP  L +HLKRF  + +LF 
Sbjct: 496 TLRECFELFTEPETLGEDDAWHCPKCKKHREATKQMSLWRLPDTLIIHLKRFSFKNILFR 555

Query: 489 AKV 497
            K+
Sbjct: 556 DKI 558



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SII D+F G+L S + C +C  +S + + F +LS+P+P    L
Sbjct: 178 SIIVDMFQGQLKSKLTCPVCKTISIKYDPFMNLSVPLPKENKL 220


>UniRef50_A5K182 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 1210

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +L++ L  + S + L GDN Y C +C+K +   K   I  LP VL + +KRF
Sbjct: 776 NLEEALRKYLSKETLMGDNGYYCDKCRKKKKATKQCVINKLPRVLTIQIKRF 827


>UniRef50_A0BPW6 Cluster: Chromosome undetermined scaffold_12, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_12, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1032

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 25/53 (47%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +3

Query: 315  LQDCLAAFFSADEL-KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            L DCL AF   + L KGD  Y C+RCKK     K   I   P +L +HLKRF+
Sbjct: 867  LDDCLKAFTKEEILGKGDEWY-CNRCKKHVQASKKMEIYKAPQILIIHLKRFK 918



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           ++ +S I ++  G+  S + C IC R+S   + F  LSLPIPS
Sbjct: 563 LRNQSKIQELMVGQYKSTLVCPICSRISKTFDPFMSLSLPIPS 605


>UniRef50_Q7RZP4 Cluster: Putative uncharacterized protein NCU00320.1;
            n=1; Neurospora crassa|Rep: Putative uncharacterized
            protein NCU00320.1 - Neurospora crassa
          Length = 2450

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 6/111 (5%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL--LF 485
            +LQ+ L A+   + ++G+N Y CS C +  + VK + +  +P  L  HLKRF   L  L 
Sbjct: 1656 TLQESLQAYVDGEIMEGENKYKCSECNRHVDAVKRACLKDIPDNLIFHLKRFDFNLRTLQ 1715

Query: 486  SAKVXXXXXXXXTI----WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             +K+        TI    +T    +     +    + L  V+ H GT   G
Sbjct: 1716 RSKINDFFSFPDTIDMRPYTMEHLKNPDEDQQEDIFELVGVLVHSGTAESG 1766


>UniRef50_Q1E9B0 Cluster: Ubiquitin carboxyl-terminal hydrolase;
           n=1; Coccidioides immitis|Rep: Ubiquitin
           carboxyl-terminal hydrolase - Coccidioides immitis
          Length = 1173

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 6/110 (5%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL--LFS 488
           L+D L A+   + ++GDN YSC+ C +  + VK + +  +P  L  HLKRF  ++  +  
Sbjct: 398 LEDSLRAYVEGEMMQGDNKYSCTSCNRHVDAVKRACLKDIPDNLIFHLKRFDFDVSSMMR 457

Query: 489 AKVXXXXXXXXTI----WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           +K+         I    +         AP     + L  V+ H GT   G
Sbjct: 458 SKINDEFHFPERIDMAPFKVEHLSNADAPVEADIFELVGVLVHSGTAESG 507


>UniRef50_A2QBW2 Cluster: Contig An02c0010, complete genome; n=4;
            Trichocomaceae|Rep: Contig An02c0010, complete genome -
            Aspergillus niger
          Length = 1661

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 33/108 (30%), Positives = 48/108 (44%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L +CL  F   + L  ++ + C RCK+ R   K   +   P +L +HLKRF     F 
Sbjct: 1281 VTLYECLDEFNKEEVLSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKRFSASRGFR 1340

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  V           T R+   +     +  Y L AV +H G +GGG
Sbjct: 1341 DKLDVLVDFPVEGLDMTGRVEAPEEGKSQI--YDLFAVDNHYGGLGGG 1386



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I+D+F G   S + C  CD+VS   + F +L+L +P
Sbjct: 848 SVITDLFAGMYKSTLVCPACDKVSIIFDPFNNLTLQLP 885


>UniRef50_O60139 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 4; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 438

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 3/110 (2%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           VVSLQ+CL  F + + L+G + + C  CK  R+  K+  I  LP  L + ++RF+  ++ 
Sbjct: 265 VVSLQECLLKFSAPELLQGHDGWHCPVCKVQRSAKKVIMISKLPEYLIIQIQRFKISVMG 324

Query: 486 SAKVXXXXXXXXTIWT*RLT--RTKSAPRXV-SRYSLXAVISHMGTVGGG 626
             K+         I +  L     +S    + S Y+L A I H G +  G
Sbjct: 325 RKKIDTPLGLSLQIPSKMLVPPSFQSGIGYIPSNYNLFAFICHYGQLENG 374



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLR 207
           +SI+ + F G+L S  QC+ C R ST    F  L++PI    H+  L+
Sbjct: 222 KSIVVNNFVGQLCSRTQCMTCGRTSTTFAPFTSLAIPIDDVSHVVSLQ 269


>UniRef50_Q9UK80 Cluster: Ubiquitin carboxyl-terminal hydrolase 21;
           n=31; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 21 - Homo sapiens (Human)
          Length = 565

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 409 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 466



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 368 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 407


>UniRef50_UPI000051AC84 Cluster: PREDICTED: similar to CG8830-PA,
           isoform A; n=2; Apis mellifera|Rep: PREDICTED: similar
           to CG8830-PA, isoform A - Apis mellifera
          Length = 833

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 2/103 (1%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL--L 482
           VS+QD +  + + ++L G+N Y C +C KL +  ++  I+  P  L + LK FR++    
Sbjct: 603 VSVQDLINYYLTPEKLTGENKYRCDKCMKLCDAQRIIKILHAPTYLILILKHFRYDFDTR 662

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
              K+        TI   +L  + S       Y L A + H G
Sbjct: 663 LRTKLRHKVMYNETI---QLPVSTSLCTTTENYQLYAAVVHSG 702


>UniRef50_Q8VZF5 Cluster: AT3g14400/MLN21_18; n=3; Arabidopsis
           thaliana|Rep: AT3g14400/MLN21_18 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 661

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/100 (28%), Positives = 45/100 (45%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+++ L  FF ++ L G+N Y C  C+KL    K   I+  P +L + LKRF    +F  
Sbjct: 191 SVKESLQKFFQSEILDGNNKYRCESCEKLVTARKQMSILQAPNILVIQLKRFGG--IFGG 248

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+         +       +K++      Y L  +I H G
Sbjct: 249 KIDKAISFGEILVLSNF-MSKASKDPQPEYKLFGIIVHSG 287



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S++ ++F G L S V+CL C   S + +   D+SL I
Sbjct: 150 SVVKEIFGGALQSQVKCLSCGAESNKADEIMDISLEI 186


>UniRef50_Q7PDM1 Cluster: Putative Hydrolase; n=4; Plasmodium
           (Vinckeia)|Rep: Putative Hydrolase - Plasmodium yoelii
           yoelii
          Length = 1046

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           V +L++ L  F S + L GDN Y C +C+K +   K   I  LP VL + +KRF
Sbjct: 594 VNNLEEALKNFLSNEMLIGDNGYYCEKCRKKKKATKQCVINKLPRVLTIQIKRF 647


>UniRef50_Q22KS8 Cluster: Ubiquitin carboxyl-terminal hydrolase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ubiquitin carboxyl-terminal hydrolase family protein -
           Tetrahymena thermophila SB210
          Length = 686

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L  C+  FF  +E+ G+  Y C +C K    +K   +  +P  L +HLKRF+    +  K
Sbjct: 546 LNSCMDLFFKPEEIDGE--YKCEKCTKTSRAIKSCQLGNIPKYLVIHLKRFK-MFPYKTK 602

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           +        T+   +     ++    ++YSL  VI H G+   G
Sbjct: 603 IKQQISYPSTLDISKY--YANSGNESTKYSLNGVIIHQGSADIG 644



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYR---SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP 174
           +PN   A+   S   S   ++   SI+  +F G+L+S VQC  C  +S+  + F DLSLP
Sbjct: 478 LPNKRPAEFKDSQQASKFYFKYHTSIVDRLFCGQLISKVQCQKCKYISSTFDPFLDLSLP 537

Query: 175 IPSR 186
           I S+
Sbjct: 538 IESK 541


>UniRef50_A2F0I3 Cluster: Clan CA, family C19, ubiquitin
           hydrolase-like cysteine peptidase; n=1; Trichomonas
           vaginalis G3|Rep: Clan CA, family C19, ubiquitin
           hydrolase-like cysteine peptidase - Trichomonas
           vaginalis G3
          Length = 813

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/106 (30%), Positives = 43/106 (40%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           + L  C   F + D L   N + C  C +     K   I   P VL +HLKRF  E  + 
Sbjct: 667 IPLDRCFNLFSTVDTLDEQNQWHCPHCGQFVCADKKMEIWRCPEVLVIHLKRFSGEGYYV 726

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K          +      R K+     + Y L AV  HMG++GGG
Sbjct: 727 KKDSTLVDFPEELDMAPYIRGKTDQS--THYKLYAVSEHMGSMGGG 770


>UniRef50_A0CWG6 Cluster: Chromosome undetermined scaffold_3, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_3, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1036

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +3

Query: 312  SLQDCLAAFFSADEL-KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            +L+DCL +F   + L KGD  Y C+RCK+     K   I   P +L +HLKRFR
Sbjct: 867  TLEDCLRSFAKEEVLGKGDEWY-CNRCKQHVQATKQMEIYRAPQLLIIHLKRFR 919



 Score = 33.9 bits (74), Expect = 3.8
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           ++ +S I  +  G+  S + C  C RVS   + +  LSLPIPS
Sbjct: 571 LRNQSKIQQLMVGQYKSTLVCPNCHRVSKTFDPYMSLSLPIPS 613


>UniRef50_Q754R5 Cluster: AFR007Wp; n=1; Eremothecium gossypii|Rep:
           AFR007Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 848

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/48 (39%), Positives = 28/48 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S+I D+F G+  S +QC +C R ST  + F  LS+P+PS     +  C
Sbjct: 647 SVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVPVPSTRTCTLTDC 694



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/56 (37%), Positives = 29/56 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           +L DC   F   + L+ +  +SC  CKK +   K   I  LP  L +HLKRF + L
Sbjct: 690 TLTDCFTEFTKIETLEQEEQWSCPSCKKRQPSTKKITITRLPRNLIIHLKRFDNML 745


>UniRef50_Q5AAY9 Cluster: Potential ubiquitin-specific protease; n=4;
            cellular organisms|Rep: Potential ubiquitin-specific
            protease - Candida albicans (Yeast)
          Length = 1372

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L DCL +F + + L   +++ C RC + +   K   +     +L +HLKRF     FS
Sbjct: 1012 ITLSDCLKSFSTPEILGEHDLWYCPRCTEHKRATKTIQLWSTGDILTIHLKRFHSARAFS 1071

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  V           +  +  T   P     Y L AV +H G +GGG
Sbjct: 1072 DKIDVLVDFPIEGLDISSYVANTDLTPED-CLYDLIAVDNHYGGLGGG 1118



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D+F G   S + C  C + S   + F DL+LP+P
Sbjct: 478 SVIIDLFTGLYQSTLICPDCGKKSITFDPFNDLTLPLP 515


>UniRef50_A7TI48 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 712

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/55 (30%), Positives = 32/55 (58%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           + +Q  + ++   + L+G N + C  C +L+   +L G+  LP  L +HLKRF++
Sbjct: 486 IDIQKMMISYHQKEMLQGSNKFYCGTCFELQEAERLLGLKELPKTLAIHLKRFKY 540



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 16/56 (28%), Positives = 35/56 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHH 234
           + ++D+F G + + ++CL CD V++R E+F D  + +   E + +   Q+ M+++H
Sbjct: 444 NFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEVIGDETIDI---QKMMISYH 496


>UniRef50_A1DGE8 Cluster: Ubiquitin C-terminal hydrolase, putative;
            n=4; Trichocomaceae|Rep: Ubiquitin C-terminal hydrolase,
            putative - Neosartorya fischeri (strain ATCC 1020 / DSM
            3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC
            1020 / DSM 3700 / NRRL 181))
          Length = 2538

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/57 (35%), Positives = 35/57 (61%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            SL++ L A+   + ++GDN YSC+ C +  + VK + +  +P  L  HLKRF  +++
Sbjct: 1765 SLEESLQAYVEGEIMQGDNKYSCTSCGRHVDAVKRACLKEVPDNLIFHLKRFDFDMI 1821


>UniRef50_Q9UPU5 Cluster: Ubiquitin carboxyl-terminal hydrolase 24;
            n=37; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
            hydrolase 24 - Homo sapiens (Human)
          Length = 1870

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/52 (44%), Positives = 30/52 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+  L  F   + L+G N Y C +CK+ R  VK + I  LP VL +HL RF
Sbjct: 1087 SLEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRF 1138


>UniRef50_P51784 Cluster: Ubiquitin carboxyl-terminal hydrolase 11;
           n=19; Theria|Rep: Ubiquitin carboxyl-terminal hydrolase
           11 - Homo sapiens (Human)
          Length = 920

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 736 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 790


>UniRef50_UPI00006D0117 Cluster: Ubiquitin carboxyl-terminal hydrolase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            Ubiquitin carboxyl-terminal hydrolase family protein -
            Tetrahymena thermophila SB210
          Length = 1654

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            L DC+ AF   ++L+  N + CS+CK+     K   I   P +L +HLKRF+
Sbjct: 1014 LYDCIDAFVKKEQLEKGNEWYCSKCKRHVLATKQMEIYNTPKILIIHLKRFK 1065


>UniRef50_Q86UV5-7 Cluster: Isoform 7 of Q86UV5 ; n=10;
           Mammalia|Rep: Isoform 7 of Q86UV5 - Homo sapiens (Human)
          Length = 485

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>UniRef50_Q4SHQ3 Cluster: Chromosome 5 SCAF14581, whole genome shotgun
            sequence; n=3; Percomorpha|Rep: Chromosome 5 SCAF14581,
            whole genome shotgun sequence - Tetraodon nigroviridis
            (Green puffer)
          Length = 1046

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKR 464
            SLQDCL  F   ++L  +N   C  CK  R+  K   I  +P +L VHLKR
Sbjct: 874  SLQDCLRLFSKEEKLTDNNKVFCRHCKAHRDSTKKLEIWKVPPILLVHLKR 924



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/48 (45%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           SII  +F G+  S VQCL C R S   ETF  LSLP+ S    ++  C
Sbjct: 831 SIIVALFQGQFKSTVQCLTCHRKSRTFETFMYLSLPLASTSRCSLQDC 878


>UniRef50_Q54PQ7 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1089

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 7/113 (6%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCK-KLRNGVKLSGIVVLPXVLCVHLKRF------ 467
            ++L DCL  +  +++L  ++ + C +CK  +   +K   +   P +L VHLKRF      
Sbjct: 922  ITLNDCLQLYTKSEKLGTNDTWYCPQCKAHIEGSMKKLELWSAPKILVVHLKRFHYVHGH 981

Query: 468  RHELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            RHE + +           + W       KS P  +  Y L AV +HMG +G G
Sbjct: 982  RHEKINAFVDFPLDNLDISQW----VLNKSNPPPI--YQLYAVSNHMGGMGSG 1028



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +SII ++F G+  S + C  C +VS   + +  ++LPIP
Sbjct: 546 QSIIVNLFQGQYKSTLVCAKCSKVSITFDPYMFVTLPIP 584


>UniRef50_Q381H6 Cluster: Ubiquitin carboxyl-terminal hydrolase,
            putative; n=1; Trypanosoma brucei|Rep: Ubiquitin
            carboxyl-terminal hydrolase, putative - Trypanosoma
            brucei
          Length = 1184

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/106 (26%), Positives = 49/106 (46%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V + +CL + FS+D L G+N  +CS+C    +G     +  LP  L + LKRF+ ++   
Sbjct: 1031 VDVHECLKSTFSSDILTGENSLNCSKCGGFCDGRVERRLFRLPPCLIISLKRFKLDIRGV 1090

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K          +   +    + +P   ++Y L  V+ H G +  G
Sbjct: 1091 TKDTAFVRFSEEL-DMKQFMDEESPEKHTKYKLVGVVFHRGGLSYG 1135


>UniRef50_A5DMF5 Cluster: Putative uncharacterized protein; n=1;
            Pichia guilliermondii|Rep: Putative uncharacterized
            protein - Pichia guilliermondii (Yeast) (Candida
            guilliermondii)
          Length = 1169

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 32/106 (30%), Positives = 48/106 (45%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V L DCL +F + + L   +++ C RCK  +   K   I     +L +HLKRF+    FS
Sbjct: 916  VLLVDCLQSFSTPEVLGEFDLWYCPRCKDHKRATKTIQIWSTGDILTIHLKRFQSARSFS 975

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+         I    ++   +       Y L AV +H G +GGG
Sbjct: 976  DKI--DLTVDFPIEGLDMSNFVAGGDESLIYDLIAVDNHYGGLGGG 1019



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D+F G   S + C  C + S   + F DL+LP+P
Sbjct: 491 SVIVDLFTGLYQSTLVCPDCGKTSITFDPFSDLTLPLP 528


>UniRef50_Q13107 Cluster: Ubiquitin carboxyl-terminal hydrolase 4;
            n=48; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
            hydrolase 4 - Homo sapiens (Human)
          Length = 963

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 6.7
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>UniRef50_Q86UV5 Cluster: Ubiquitin carboxyl-terminal hydrolase 48;
           n=35; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 48 - Homo sapiens (Human)
          Length = 1035

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>UniRef50_P38187 Cluster: Ubiquitin carboxyl-terminal hydrolase 13;
           n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
           carboxyl-terminal hydrolase 13 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 747

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/99 (24%), Positives = 44/99 (44%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           +Q+ L ++   + L G N + C  C  L+   +L G+  LP  L +HLKRF++    +  
Sbjct: 516 IQEILKSYHQREMLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFKYSEKQNCN 575

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           +         +     +   S  +   +Y L  ++ HMG
Sbjct: 576 IKLFNNIHYPLTLNVCSSINS--KVCQKYELAGIVVHMG 612



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           N   A S  + D    K ++ ISD+F G L + ++CL CD +++R E F D  + +   E
Sbjct: 453 NKKIAASDINSDSEPSKSKNFISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEVQGDE 512


>UniRef50_UPI00015A4023 Cluster: Ubiquitin carboxyl-terminal hydrolase
            15 (EC 3.1.2.15) (Ubiquitin thioesterase 15)
            (Ubiquitin-specific-processing protease 15)
            (Deubiquitinating enzyme 15) (Unph-2) (Unph4).; n=1;
            Danio rerio|Rep: Ubiquitin carboxyl-terminal hydrolase 15
            (EC 3.1.2.15) (Ubiquitin thioesterase 15)
            (Ubiquitin-specific-processing protease 15)
            (Deubiquitinating enzyme 15) (Unph-2) (Unph4). - Danio
            rerio
          Length = 912

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDN-MYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            L+DC+  F + ++L  D+  + C  CK+ +   K   +  LP VL VHLKRF +      
Sbjct: 734  LRDCIQLFTTKEKLGADDPWWYCPSCKQHQQATKQLDLWSLPPVLVVHLKRFSYSRYMRD 793

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    ++     P   V  Y L AV +H G +GGG
Sbjct: 794  KL--DTLVEFPLRDLDMSEFLINPHAGVCLYDLIAVSNHYGGMGGG 837


>UniRef50_UPI00015A4021 Cluster: Ubiquitin carboxyl-terminal hydrolase
            15 (EC 3.1.2.15) (Ubiquitin thioesterase 15)
            (Ubiquitin-specific-processing protease 15)
            (Deubiquitinating enzyme 15) (Unph-2) (Unph4).; n=4;
            Danio rerio|Rep: Ubiquitin carboxyl-terminal hydrolase 15
            (EC 3.1.2.15) (Ubiquitin thioesterase 15)
            (Ubiquitin-specific-processing protease 15)
            (Deubiquitinating enzyme 15) (Unph-2) (Unph4). - Danio
            rerio
          Length = 926

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 2/106 (1%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDN-MYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            L+DC+  F + ++L  D+  + C  CK+ +   K   +  LP VL VHLKRF +      
Sbjct: 737  LRDCIQLFTTKEKLGADDPWWYCPSCKQHQQATKQLDLWSLPPVLVVHLKRFSYSRYMRD 796

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    ++     P   V  Y L AV +H G +GGG
Sbjct: 797  KL--DTLVEFPLRDLDMSEFLINPHAGVCLYDLIAVSNHYGGMGGG 840


>UniRef50_Q9FPS5 Cluster: Ubiquitin-specific protease 22; n=3; core
           eudicotyledons|Rep: Ubiquitin-specific protease 22 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 557

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           +L  CL  F  +++L  D   +C  C + R   K   I  LP +LC+H+KRF H L
Sbjct: 362 TLSGCLDFFTRSEKLGPDQKLNCQSCGEKRESSKQMSIRRLPLLLCLHVKRFEHFL 417


>UniRef50_A0CV10 Cluster: Chromosome undetermined scaffold_29, whole
            genome shotgun sequence; n=6; cellular organisms|Rep:
            Chromosome undetermined scaffold_29, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2396

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +L++CL      D L+G+N Y+C +C K  + +K   I  LP  L + LKRF  +    A
Sbjct: 1583 NLEECLQTLVHGDLLEGENAYNCEQCNKKVSALKRMCIKKLPDHLILVLKRFNFDFDLMA 1642

Query: 492  K 494
            K
Sbjct: 1643 K 1643


>UniRef50_Q6CUN8 Cluster: Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y- 1140 of Kluyveromyces
            lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
            lactis strain NRRL Y-1140 chromosome C of strain NRRL Y-
            1140 of Kluyveromyces lactis - Kluyveromyces lactis
            (Yeast) (Candida sphaerica)
          Length = 1252

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 31/108 (28%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            ++L  CL  F   + L   + + C  CK+     K   +   P +L +HLKRF ++  FS
Sbjct: 902  ITLDSCLRLFSQPEILGSADSWYCPNCKQHTQASKQIELWNTPDILLIHLKRFENQRSFS 961

Query: 489  AKV--XXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+             +  L+  K     V  Y L AV +H G +GGG
Sbjct: 962  DKIDATVKFPIEGLDMSPYLSYKKEGENDV--YDLIAVDNHYGGLGGG 1007



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D+F G   S + C  C+ VS   + + DL+LP+P
Sbjct: 492 SVIMDLFVGLYKSTLVCPNCNHVSITFDPYNDLTLPLP 529


>UniRef50_Q4P6R1 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1427

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            +S++DC+  F   ++L  D+ + C  CK+ R   K   +   P +L VHLKRF
Sbjct: 1133 LSIEDCMDEFTREEQLGEDDPWYCPSCKEFRQATKKFDLWKAPDILVVHLKRF 1185



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S+I D+F G+  S + C  C +VS + + F  L+LPIP+R+
Sbjct: 683 SVIVDLFQGQYRSTLVCPDCSKVSIKFDPFMYLTLPIPNRK 723


>UniRef50_A4QTP9 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 2502

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/56 (39%), Positives = 31/56 (55%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            SLQ+ L A+   + + GDN Y CS C +  + VK + +  +P  L  HLKRF   L
Sbjct: 1690 SLQESLEAYVEGEIMGGDNKYKCSTCDRHVDAVKRACLKDIPNNLIFHLKRFDFNL 1745


>UniRef50_P39967 Cluster: Ubiquitin carboxyl-terminal hydrolase 9;
           n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
           carboxyl-terminal hydrolase 9 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 754

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/100 (25%), Positives = 49/100 (49%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           +Q  L ++   + L G N + C++C  L+   ++ G+  LP +L +HLKRF++     + 
Sbjct: 515 IQKMLKSYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSN 574

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
           +         + T  ++ T +      +Y L  V+ HMG+
Sbjct: 575 IKLFNKILYPL-TLDVSSTFNT-SVYKKYELSGVVIHMGS 612



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  NSARAKSG-SSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           N+ R + G    D SN  +   I+D+F G L + ++CL CD +++R E F D  + +   
Sbjct: 454 NNPRMRFGPQKTDNSNDNF---ITDLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGD 510

Query: 187 E 189
           E
Sbjct: 511 E 511


>UniRef50_P39944 Cluster: Ubiquitin carboxyl-terminal hydrolase 5;
           n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
           carboxyl-terminal hydrolase 5 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 805

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S I D+F G+  S +QC +C+  ST  +TF  LS+P+P  +   +L C
Sbjct: 603 SAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKTCNILDC 650



 Score = 39.5 bits (88), Expect = 0.077
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           ++ DC   F   + L  D  +SC +C K +   K   I  LP  L ++LKRF +++
Sbjct: 646 NILDCFREFTKCERLGVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQM 701


>UniRef50_Q70EK9 Cluster: Ubiquitin carboxyl-terminal hydrolase 51;
           n=66; Deuterostomia|Rep: Ubiquitin carboxyl-terminal
           hydrolase 51 - Homo sapiens (Human)
          Length = 711

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 36/119 (30%), Positives = 49/119 (41%), Gaps = 12/119 (10%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           + SL DCL  F   + L       C+ C+  +   K   +  LP V C HLKRF H    
Sbjct: 546 IPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFEHVGKQ 605

Query: 486 SAKVXXXXXXXXTI-WT*RLTRTKSA-------PRXV----SRYSLXAVISHMGTVGGG 626
             K+         +  T  L  TK +       P       ++YSL AVI+H GT+  G
Sbjct: 606 RRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGTLESG 664



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C  C  VST I+   D+SL +P
Sbjct: 483 IIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLP 519


>UniRef50_Q3V0C5 Cluster: Ubiquitin carboxyl-terminal hydrolase 48;
           n=25; Deuterostomia|Rep: Ubiquitin carboxyl-terminal
           hydrolase 48 - Mus musculus (Mouse)
          Length = 1052

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   + L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>UniRef50_UPI00015B620A Cluster: PREDICTED: similar to GA19137-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           GA19137-PA - Nasonia vitripennis
          Length = 963

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S+IS +F G+L S ++CL C++ ST  ETF  L++ +P+     +  C
Sbjct: 762 SVISKLFFGQLRSTIECLYCNQNSTTYETFNSLTMSLPTTNKCTLDEC 809



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 4/109 (3%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +L +C+  F S   + G   + C  CK  R G+K   I  LP ++ +HL RF     +  
Sbjct: 805  TLDECVKKFVSGQRVSG---WKCPNCKVPREGMKKFDIAKLPHIIVIHLNRFGETSGWLE 861

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPRXVS----RYSLXAVISHMGTVGGG 626
            K         T +  R    +      +     Y+L A+ +H GT+ GG
Sbjct: 862  KKNTAVDFPLTNFIMRHYVVQDNDNFNNSQSYNYNLYAMSNHYGTMEGG 910


>UniRef50_UPI0000D55BC4 Cluster: PREDICTED: similar to CG5486-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG5486-PA, isoform A - Tribolium castaneum
          Length = 1307

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L+G+N Y C +C K  +  K    +  P +L +HLKRF
Sbjct: 340 SVEEALRAFVQPETLEGNNQYHCEKCNKKCDAHKGLKFIKFPYLLTLHLKRF 391



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/42 (35%), Positives = 27/42 (64%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + K  ++I+D++ G +L  V+CL C    +R +TF D+ LP+
Sbjct: 288 DTKQANLINDLYEGTMLDYVKCLECGTEKSREDTFLDIPLPV 329


>UniRef50_UPI000049A01C Cluster: ubiquitin carboxyl-terminal
           hydrolase; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           ubiquitin carboxyl-terminal hydrolase - Entamoeba
           histolytica HM-1:IMSS
          Length = 642

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 35/107 (32%), Positives = 49/107 (45%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH-ELLF 485
           +SL+ CL  FF  + L   N + CS+C K  N  +   I   P VL + LKRFR+ E L 
Sbjct: 501 ISLEWCLNDFFKENILGKGNEWKCSQCGKKVNARQKCIIEYPPNVLVIQLKRFRYTEHLS 560

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K          I   +          V +Y L +V++H GT+ GG
Sbjct: 561 VVKDNSLVYFPLEIDLHQF-------GMVGKYRLNSVVNHRGTLNGG 600


>UniRef50_UPI000065E383 Cluster: Ubiquitin carboxyl-terminal
           hydrolase 43 (EC 3.1.2.15) (Ubiquitin thioesterase 43)
           (Ubiquitin-specific-processing protease 43)
           (Deubiquitinating enzyme 43).; n=1; Takifugu
           rubripes|Rep: Ubiquitin carboxyl-terminal hydrolase 43
           (EC 3.1.2.15) (Ubiquitin thioesterase 43)
           (Ubiquitin-specific-processing protease 43)
           (Deubiquitinating enzyme 43). - Takifugu rubripes
          Length = 580

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L +C   +   ++L  D+ + C  CK+L  G+    +  LP +L +HLKRF  +
Sbjct: 453 TLDECFYLYTKEEQLAPDDAWKCPHCKQLEQGMVKMSLWTLPDILILHLKRFMQD 507


>UniRef50_Q4RXP6 Cluster: Chromosome 11 SCAF14979, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 11
           SCAF14979, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 679

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V CL C   S  +E F DLSL  P R H
Sbjct: 447 VLNTIFHGQLLSQVTCLSCKHKSNTVEPFWDLSLEFPERYH 487


>UniRef50_Q9W117 Cluster: CG30421-PA; n=7; Drosophila|Rep:
           CG30421-PA - Drosophila melanogaster (Fruit fly)
          Length = 1272

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L+ CL  +  A+ L  ++ + C  C++    VK  G+  LP +L VH KRFR
Sbjct: 722 LTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFR 775


>UniRef50_Q9VW49 Cluster: CG8334-PA; n=3; Eukaryota|Rep: CG8334-PA -
            Drosophila melanogaster (Fruit fly)
          Length = 1736

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            V L  CL AF S ++L  +  Y CS CK  +   K   I  LP +L VHLKRF
Sbjct: 1445 VDLNHCLRAFTSEEKL--EQWYHCSHCKGKKPATKKLQIWKLPPILIVHLKRF 1495



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           + + +SII D+F G+L S V CL C   S R + F  LSLP+P   ++
Sbjct: 815 HARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYI 862


>UniRef50_Q54G37 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 407

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           SL +CL+ F S + L  ++ + C +C  L+   K   I  LP  L +HLKRF++
Sbjct: 242 SLTNCLSNFSSIEILSKNDKFFCDQCNSLQEAQKRMKIKKLPNTLIIHLKRFKY 295



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 13/44 (29%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           ++++ ++F G L +  +CL C+ ++ + E+F DLS+ I   + L
Sbjct: 200 KTLVHEIFEGTLTNETKCLTCESITNKDESFLDLSIDIEQNKSL 243


>UniRef50_Q386W6 Cluster: Ubiquitin carboxyl-terminal hydrolase,
           putative; n=1; Trypanosoma brucei|Rep: Ubiquitin
           carboxyl-terminal hydrolase, putative - Trypanosoma
           brucei
          Length = 554

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 30/106 (28%), Positives = 46/106 (43%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           + L+DC   +   +EL  D+ Y C  CK+     K   +  LP +L V +KRFR +   S
Sbjct: 411 ICLEDCFRLYCKEEELDLDSAYHCPSCKQKVKVSKQLLLYSLPTLLFVTIKRFRSDGAIS 470

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+         I    L     +    + Y L  V++H G+  GG
Sbjct: 471 MKLNDPVFFQKKI---DLKPFLCSTEKNTIYDLVGVVNHSGSTTGG 513


>UniRef50_Q16RT1 Cluster: Ubiquitin specific protease 2, putative;
            n=3; Culicidae|Rep: Ubiquitin specific protease 2,
            putative - Aedes aegypti (Yellowfever mosquito)
          Length = 934

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 32/105 (30%), Positives = 45/105 (42%), Gaps = 1/105 (0%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L++C+  F   + + G +  +CSRCK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 788  LENCMDMFVKEEVMDGIDQPTCSRCKARRKCTKSLTIERFPKYLVIHLKRF-SETRWSNK 846

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            +              L    S        YSL  + +HMG+  GG
Sbjct: 847  LTNVVEFPTGERELNLQPYASEDHSGPVNYSLYGISNHMGSTAGG 891



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +1

Query: 19  RAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           R K+    D  +    S+I ++F G L S ++C  C+  S   + F DLSLP+PS
Sbjct: 727 RVKATMMWDWYSRVENSMIKNLFVGLLRSTLKCTYCNGASVTFDPFWDLSLPLPS 781


>UniRef50_Q74Z36 Cluster: AGR370Wp; n=1; Eremothecium gossypii|Rep:
           AGR370Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 740

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           +++QD L  F   + L G N + C  C  L+   +  GI  LP +L +HLKRF++
Sbjct: 504 LNVQDILRDFHQREMLNGANKFYCDSCNGLQEAERTVGIKELPELLPLHLKRFKY 558



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAV 201
           + I  +F G + ++++CL CD +++  E F D ++P+   E L V
Sbjct: 462 NFIHTLFQGTMNNSIKCLTCDNITSNEEPFFDFAIPVSEDEELNV 506


>UniRef50_Q4PG60 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 778

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/50 (42%), Positives = 29/50 (58%)
 Frame = +3

Query: 324 CLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           CL  + S ++L G+N YSC+ C    +  K   +  LP VLC+ LKRF H
Sbjct: 601 CLQRYCSEEKL-GNNDYSCTGCGGSASATKQLSLYRLPPVLCIQLKRFEH 649


>UniRef50_Q24574 Cluster: Ubiquitin carboxyl-terminal hydrolase 64E;
           n=4; Fungi/Metazoa group|Rep: Ubiquitin
           carboxyl-terminal hydrolase 64E - Drosophila
           melanogaster (Fruit fly)
          Length = 1556

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 548 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 599



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           N K  ++IS+++ GK+   V+CL C+   TR +TF D+ LP+
Sbjct: 496 NTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPV 537


>UniRef50_Q70CQ1 Cluster: Ubiquitin carboxyl-terminal hydrolase 49;
           n=29; Euteleostomi|Rep: Ubiquitin carboxyl-terminal
           hydrolase 49 - Homo sapiens (Human)
          Length = 688

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>UniRef50_UPI000023D208 Cluster: hypothetical protein FG05462.1; n=1;
            Gibberella zeae PH-1|Rep: hypothetical protein FG05462.1
            - Gibberella zeae PH-1
          Length = 2563

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            +L++ L A+   + ++GDN Y CS C +  + VK + I  +P  L  HLKRF   L
Sbjct: 1747 TLEESLQAYVDGEIMEGDNKYKCSTCDRHVDAVKRACIKDVPENLIFHLKRFDFNL 1802


>UniRef50_A7QTM4 Cluster: Chromosome chr11 scaffold_170, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome chr11 scaffold_170, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 461

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           +L  CL  F   + L  D  + C +C+  +  +K   I  LP V C H+KRF H
Sbjct: 332 TLMGCLDRFTRPERLGSDQKFFCQQCQVRQESLKQMSIRKLPLVSCFHIKRFEH 385


>UniRef50_A4S4T8 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 312

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADE-LKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           G + S+++ L   F  +E L G N Y CS+CK L    K S I V P +L + LKR+
Sbjct: 162 GKIGSVEEALRENFCTEEVLSGSNKYKCSKCKALVRAKKGSKIHVSPNILTIPLKRY 218


>UniRef50_Q7Q0X8 Cluster: ENSANGP00000018655; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000018655 - Anopheles gambiae
           str. PEST
          Length = 445

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+Q  L  F S+++L G+N Y C RC++LR+  +   + V P  L + +K FR++
Sbjct: 183 SVQKLLDYFCSSEKLVGENQYFCDRCRQLRDCERSVTVAVPPQNLILTIKHFRYD 237



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/62 (27%), Positives = 28/62 (45%)
 Frame = +1

Query: 13  SARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           SA   S  SG  +    ++++   F G+L     C +C+  +   ETF+ L L  P    
Sbjct: 114 SALISSNGSGTIATNSTKTLVQKTFEGQLSVGCLCTVCNSTNHTTETFRSLDLSFPEDSD 173

Query: 193 LA 198
           L+
Sbjct: 174 LS 175


>UniRef50_Q7JLZ7 Cluster: Putative uncharacterized protein; n=4;
            Caenorhabditis|Rep: Putative uncharacterized protein -
            Caenorhabditis elegans
          Length = 2923

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            +L++ L  F +A  ++G+N Y C +C + +  +  +  + LP  + + LKRF ++L+
Sbjct: 1921 NLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFTYDLV 1977


>UniRef50_Q4UE45 Cluster: Ubiquitin carboxy-terminal hydrolase,
           putative; n=2; Theileria|Rep: Ubiquitin carboxy-terminal
           hydrolase, putative - Theileria annulata
          Length = 632

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L D L+ F   ++L  DN Y CS CK  +N  K   I   P +L ++LKRF
Sbjct: 261 LIDLLSEFVLPEKLTNDNKYFCSNCKSYQNANKSLSIYKAPRILNINLKRF 311


>UniRef50_Q4X0A7 Cluster: Ubiquitin C-terminal hydrolase, putative;
            n=3; Trichocomaceae|Rep: Ubiquitin C-terminal hydrolase,
            putative - Aspergillus fumigatus (Sartorya fumigata)
          Length = 1694

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L +CL  F   + L  ++ + C RCK+ R   K   +   P +L +HLKRF     F 
Sbjct: 1308 VTLYECLDEFNKEEILSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKRFSASRGFR 1367

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  V           + R+   +     +  Y L AV +H G +GGG
Sbjct: 1368 DKLDVLVDFPVEGLDMSGRVESPEEGKSLI--YDLFAVDNHYGGLGGG 1413



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I+D+F G   S + C +C++VS   + F +L+L +P
Sbjct: 826 SVITDLFAGMYKSTLVCPVCEKVSIIFDPFNNLTLQLP 863


>UniRef50_Q2ULJ3 Cluster: Ubiquitin-specific protease; n=2;
           Pezizomycotina|Rep: Ubiquitin-specific protease -
           Aspergillus oryzae
          Length = 286

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 3/108 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCK-KLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           +L  CL +F S ++L    +Y+CS C    +   K   I  LP +LC+ LKR+ H    S
Sbjct: 131 TLSGCLESFTSPEKLMA-GVYNCSGCGGSAQKATKQLRIKKLPAILCMQLKRYEHTFSVS 189

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR--YSLXAVISHMGTVGGG 626
            K+        +I     T   ++    SR  Y L + + H G +  G
Sbjct: 190 EKLEGRIDFPLSINMLPYTTNPNSHVDKSRYIYDLSSAVVHKGKLDAG 237


>UniRef50_UPI00006CF33A Cluster: Ubiquitin carboxyl-terminal hydrolase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            Ubiquitin carboxyl-terminal hydrolase family protein -
            Tetrahymena thermophila SB210
          Length = 2475

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
            SII DV+ G+ ++ +QC +C  V+ + E F  +SLP+P +  +       P +N
Sbjct: 1745 SIIKDVYMGQTINTIQCSVCGNVNHKYEDFFTISLPLPIKNEVLYEVTYVPRIN 1798


>UniRef50_UPI00006CCFDD Cluster: Ubiquitin carboxyl-terminal
           hydrolase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: Ubiquitin carboxyl-terminal hydrolase family
           protein - Tetrahymena thermophila SB210
          Length = 751

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/53 (41%), Positives = 29/53 (54%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           S+QDCL  FFS + L  D  Y C +C +     K   I   P +L +HLKRF+
Sbjct: 595 SVQDCLNKFFSEEILSDD--YKCEKCNQNNKAKKQVLISKTPYILTLHLKRFK 645



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           SII  +F G+L S V C  C  +S   + F DLSL + S+
Sbjct: 553 SIIDYIFSGQLSSNVNCSKCGYISRTYDPFLDLSLGMDSK 592


>UniRef50_Q0DAG6 Cluster: Os06g0654000 protein; n=5;
           Magnoliophyta|Rep: Os06g0654000 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 944

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G   SL++CL  F + + L GDN Y C  C       K   +   P +L + LKRF+
Sbjct: 237 HGDADSLEECLDKFTAVEWLDGDNKYKCDGCSDYVKAQKRLTVYQAPNILTITLKRFQ 294



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           ++I  +F G+L S VQC  C  VS R E   DL++ I
Sbjct: 200 TLIQHIFGGRLQSQVQCTACGMVSNRYENMMDLTVEI 236


>UniRef50_Q7QD14 Cluster: ENSANGP00000018711; n=2; Culicidae|Rep:
           ENSANGP00000018711 - Anopheles gambiae str. PEST
          Length = 901

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L++CL  +F+ +E++G   + C +CK  ++ +K   I  LP +L VH KRF
Sbjct: 740 LENCLDMYFNGEEVRG---WHCPKCKSNQDAIKKLDISRLPSILVVHFKRF 787



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL 204
           S IS++F G++ S V+C  C + S   E+F +LSL +P   ++  L
Sbjct: 695 SYISELFYGQIKSTVKCTRCHKESATYESFSNLSLELPQDSNICYL 740


>UniRef50_Q23DC1 Cluster: Ubiquitin carboxyl-terminal hydrolase family
            protein; n=1; Tetrahymena thermophila SB210|Rep:
            Ubiquitin carboxyl-terminal hydrolase family protein -
            Tetrahymena thermophila SB210
          Length = 1271

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL-LFS 488
            ++ DCL  F   + L  DN + C  CKK +   K   I   P +L +HLKRF+    LF 
Sbjct: 1042 NIYDCLKLFEQPERLGEDNEWYCPECKKHQKAQKQIVIYRAPDILILHLKRFKGSSGLFK 1101

Query: 489  AKV 497
            +K+
Sbjct: 1102 SKL 1104



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           +SII D+  G+  S V C  C + S   + F   SLPIP++E
Sbjct: 717 QSIIVDLMQGQFKSKVTCPDCSKESITFDPFLTCSLPIPNKE 758


>UniRef50_A0C0G8 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 451

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/52 (32%), Positives = 29/52 (55%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           L +C+  +   ++L   N + C  C KL + +K   +  LP +L +HLKRF+
Sbjct: 285 LIECIKEYVKEEQLTNGNQWFCENCHKLVDAIKKIDLWKLPTILIIHLKRFK 336



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           +SII D+  G+  ++++CL CD  + + E    LS+PIP  E   ++ C
Sbjct: 240 KSIIVDLMQGQFKNSLKCLSCDNYTYKFEPLMYLSVPIPESEECQLIEC 288


>UniRef50_Q6CU80 Cluster: Similar to sp|P50102 Saccharomyces
           cerevisiae YMR223w UBP8; n=1; Kluyveromyces lactis|Rep:
           Similar to sp|P50102 Saccharomyces cerevisiae YMR223w
           UBP8 - Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 446

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 2/106 (1%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL-FSA 491
           L+DCL   F  +E   D  Y C  CK+ +  VK   +   P VL + LKRF H+L   SA
Sbjct: 300 LEDCLD-HFQREETLTDFHYECQSCKQNQGVVKQLTLHKAPNVLVIQLKRFEHQLNGQSA 358

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+         +     L + +        Y L  V+SH GTV  G
Sbjct: 359 KLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGTVDQG 404


>UniRef50_Q4WQI1 Cluster: Ubiquitin C-terminal hydrolase CreB; n=8;
           Eurotiomycetidae|Rep: Ubiquitin C-terminal hydrolase
           CreB - Aspergillus fumigatus (Sartorya fumigata)
          Length = 775

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSI-ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           P +A +   SS  GS     +  + ++F G L S  QCL C++VS R E F DLS+ +  
Sbjct: 251 PETADSVDQSSSTGSKTPNTTRWVHELFEGLLTSETQCLTCEKVSQRDEVFLDLSVDL-- 308

Query: 184 REHLAVLRC 210
            +H +V  C
Sbjct: 309 EQHSSVTSC 317



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 31/103 (30%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L   N + C  C  L+   K   I  LP +L +HLKRF++  +L  
Sbjct: 313 SVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALHLKRFKYTEDLQR 372

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMG 611
             K+         +   RL  T        R Y L AV+ H+G
Sbjct: 373 LQKLFHRVVYPYHL---RLFNTTDDAEDPDRLYELYAVVVHIG 412


>UniRef50_Q0U5U1 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 2452

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCK-KLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
            +LQ+ L A+   D ++GDN Y C  C  K  + VK + +   P  L  HLKRF  +L
Sbjct: 1657 NLQESLQAYVEGDVMEGDNKYKCESCDGKFVDAVKRTCLKDAPDNLIFHLKRFEFDL 1713


>UniRef50_A7EWH8 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1538

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DCL  F   + L   + + C RCK+ R   K   I   P +L +HLKRF    +  
Sbjct: 1117 VTLEDCLDEFGKEEILSEMDTWYCPRCKEHRRASKKFEIWRTPDILIMHLKRFSSSGMRR 1176

Query: 489  AK--VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K  +           + R+   +     +  Y L AV  H G +GGG
Sbjct: 1177 DKLDILVDFPIDGLDLSSRVIERQDGKEEI--YDLIAVDDHWGGMGGG 1222



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           P + R  +    D +  +  S+I+D+F G   S + C  CD+VS   + F +++L +P
Sbjct: 593 PEAIREMATKVWDITKQRDDSVIADLFTGMYKSTLVCPHCDKVSITFDPFNNMTLQLP 650


>UniRef50_O00507 Cluster: Probable ubiquitin carboxyl-terminal
            hydrolase FAF-Y; n=50; Euteleostomi|Rep: Probable
            ubiquitin carboxyl-terminal hydrolase FAF-Y - Homo
            sapiens (Human)
          Length = 2555

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1751 NLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLKRFDYD 1805


>UniRef50_P70398 Cluster: Probable ubiquitin carboxyl-terminal
            hydrolase FAF-X; n=37; Eumetazoa|Rep: Probable ubiquitin
            carboxyl-terminal hydrolase FAF-X - Mus musculus (Mouse)
          Length = 2559

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1749 NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 1803


>UniRef50_Q5UQR3 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase R319; n=1; Acanthamoeba polyphaga
           mimivirus|Rep: Probable ubiquitin carboxyl-terminal
           hydrolase R319 - Mimivirus
          Length = 468

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +++ DCL  +FS + L  DN+++C  C +    +K + +   P VL +  KRF
Sbjct: 314 LNVYDCLREYFSQETLDADNLWNCEGCHEKVQAIKKTKLWTTPYVLVIQFKRF 366


>UniRef50_O24454 Cluster: Ubiquitin carboxyl-terminal hydrolase 3;
           n=10; Magnoliophyta|Rep: Ubiquitin carboxyl-terminal
           hydrolase 3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 371

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F S + L  ++ + C +C  L+   K   I   P +L +HLKRF++  +L  
Sbjct: 211 SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYIEQLGR 270

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
             K+         +   +L+ T   P     YSL AV+ H+G+
Sbjct: 271 YKKLSYRVVFPLEL---KLSNTVE-PYADVEYSLFAVVVHVGS 309



 Score = 36.7 bits (81), Expect = 0.54
 Identities = 20/61 (32%), Positives = 34/61 (55%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLNHHAAHNAQ 252
           + ++F G L +  +CL C+ V+ R ETF DLSL I   ++ ++  C +   +    H A+
Sbjct: 172 VHNIFQGILTNETRCLRCETVTARDETFLDLSLDI--EQNSSITSCLKNFSSTETLH-AE 228

Query: 253 D 255
           D
Sbjct: 229 D 229


>UniRef50_UPI0000E46730 Cluster: PREDICTED: similar to MGC81730
           protein, partial; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to MGC81730 protein,
           partial - Strongylocentrotus purpuratus
          Length = 625

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           L+D L  +FS + L  DN Y C +C+ L++  K   I+  P +L + L RF +++
Sbjct: 290 LEDLLRHYFSPELLVKDNRYHCDKCQSLQDAEKSLEIINAPEILIITLLRFSYDV 344



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP---SREHLAVLRCQQP 219
           SI+   F G+  + ++CL C  VS+R ETF DL L  P    R++L   RC  P
Sbjct: 177 SIVERHFGGQSATHIRCLNCGTVSSRKETFFDLPLGFPGTEGRDNLLGGRCDTP 230


>UniRef50_A5ATZ4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 494

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           +G   SL++CL  F   + L G+NMY C  C       K   +   P +L + LKRF+
Sbjct: 370 HGDAASLEECLDQFTVTEWLHGENMYKCDGCNDYVKASKRLTVRHAPNILTIALKRFQ 427


>UniRef50_Q9VC56 Cluster: CG5794-PD, isoform D; n=7; Eukaryota|Rep:
            CG5794-PD, isoform D - Drosophila melanogaster (Fruit
            fly)
          Length = 3912

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQ+ L      D L+GDNMY+CS+C K     K +    LP +LC +  R+   ++   
Sbjct: 2161 NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML 2220

Query: 492  K 494
            K
Sbjct: 2221 K 2221


>UniRef50_Q55EJ1 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 2125

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +L+DC+  F +  E+    MY C  CK  ++  K   I  LP +LC+ LKRF      S+
Sbjct: 1834 TLEDCIQ-FLTKQEMLEGKMYFCEACKSKQDAKKQFTIQSLPNILCIVLKRFSWAHSSSS 1892

Query: 492  KV 497
            K+
Sbjct: 1893 KI 1894


>UniRef50_A7SHS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1482

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/49 (38%), Positives = 27/49 (55%)
 Frame = +3

Query: 348 DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           D L GDNMY+CS+C K     K +   VLP +LC +  R+   ++   K
Sbjct: 253 DTLDGDNMYTCSQCGKKVRAEKRACFTVLPRILCFNTMRYTFNMVTMMK 301


>UniRef50_A0BDA1 Cluster: Chromosome undetermined scaffold_10, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_10,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 522

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           S+++D F G+LLS V C +C   S   + FQDLSL  P+
Sbjct: 330 SLVTDYFTGQLLSRVTCSVCKNQSLAFDNFQDLSLAFPN 368



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 1/110 (0%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           G  ++L+D L  + S + +   N Y+C +C++ R   +   I  LP +L +HLKRF ++ 
Sbjct: 371 GNQITLEDMLKYYLSEESI---NQYTCGKCRQQRKCTRQLEIWRLPDILVIHLKRFYYKG 427

Query: 480 LFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVS-RYSLXAVISHMGTVGGG 626
               K+         +   +     S    ++  Y+L  ++ H G +  G
Sbjct: 428 PMKKKINIDIKFGAKLDLGQFIINSSDKSTLNCNYNLYGIVKHYGDLNFG 477


>UniRef50_A7TGY3 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 882

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/49 (40%), Positives = 26/49 (53%)
 Frame = +3

Query: 321 DCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           DC   F   ++L  D ++SC  CKK +   K   I  LP  L +HLKRF
Sbjct: 722 DCFNEFTKVEKLGTDELWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRF 770



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S+I D+F G+  S ++C +C   ST  +TF  LS+P+P      +L C
Sbjct: 676 SVIVDLFQGQYASQLKCKVCGCTSTTYQTFSVLSVPVPHVSSCHILDC 723


>UniRef50_P32571 Cluster: Ubiquitin carboxyl-terminal hydrolase 4;
           n=2; Saccharomyces cerevisiae|Rep: Ubiquitin
           carboxyl-terminal hydrolase 4 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 926

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           ++++DC   F   + L+ D  + C  C+K +   K   I  LP  L VHLKRF
Sbjct: 761 ITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRF 813



 Score = 41.1 bits (92), Expect = 0.025
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP---SREHLAVLRC 210
           S+I D+F G+  S ++C +C   ST  + F  LS+PIP   SR ++ +  C
Sbjct: 716 SVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDC 766


>UniRef50_Q4RWF2 Cluster: Chromosome 2 SCAF14990, whole genome shotgun
            sequence; n=2; Euteleostomi|Rep: Chromosome 2 SCAF14990,
            whole genome shotgun sequence - Tetraodon nigroviridis
            (Green puffer)
          Length = 1846

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D +  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1343 NLLDSMEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 1397


>UniRef50_Q9TYY8 Cluster: Putative uncharacterized protein; n=2;
            Caenorhabditis|Rep: Putative uncharacterized protein -
            Caenorhabditis elegans
          Length = 900

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V LQ+ L  F + ++L   + + C +CKK     K   +  LP +L +HLKRF++     
Sbjct: 698  VLLQETLDWFTTKEQLGEQDSWYCPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSR 757

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGTVGGG 626
             K+         +    LT   + P      Y L AV  H G++ GG
Sbjct: 758  EKL--TWEVVIPVRGLDLTDKVANPNHEKAIYDLIAVSRHYGSLSGG 802



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SII D   G+L S + C +C+++S + + F  LSLP+P +E +
Sbjct: 419 SIIVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPLPPKEQI 461


>UniRef50_A1DNZ5 Cluster: Ubiquitin C-terminal hydrolase Ubp8,
           putative; n=7; Eurotiomycetidae|Rep: Ubiquitin
           C-terminal hydrolase Ubp8, putative - Neosartorya
           fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 499

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKL-RNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
           +L  CL +F S + L    +Y+CS C    +   K   I  LP +LC+ LKRF H    S
Sbjct: 344 TLNGCLESFTSPERLMA-GVYNCSECGGTPQKATKRLRIKKLPAILCMQLKRFEHSSAVS 402

Query: 489 AKV 497
            KV
Sbjct: 403 EKV 405


>UniRef50_Q9USM5 Cluster: Probable ubiquitin carboxyl-terminal
           hydrolase 1; n=1; Schizosaccharomyces pombe|Rep:
           Probable ubiquitin carboxyl-terminal hydrolase 1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 849

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F+   ++L+DCL  F   ++L   + + C  CK  R   K   I  LP +L +HL RF
Sbjct: 685 FHMESITLEDCLLEFSKPEQLDLQDSWYCPGCKAFRPATKRLEIWRLPKILVIHLNRF 742



 Score = 35.9 bits (79), Expect = 0.95
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           SII  +F G   S ++C IC + ST  + F  L+LP+P+
Sbjct: 426 SIIVQLFQGMYKSTLECSICYQKSTAFDPFMYLTLPLPT 464


>UniRef50_Q9UMW8 Cluster: Ubl carboxyl-terminal hydrolase 18; n=27;
           Theria|Rep: Ubl carboxyl-terminal hydrolase 18 - Homo
           sapiens (Human)
          Length = 372

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>UniRef50_UPI00015B618B Cluster: PREDICTED: similar to CG5486-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG5486-PA - Nasonia vitripennis
          Length = 648

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L+G+N Y C +C K  N  K       P +L + LKRF
Sbjct: 324 SVEEALEAFVKYETLEGNNQYFCEKCDKKSNAHKGLKFTKFPYILTLQLKRF 375



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +N     +I+ ++ GK+   V+CL C+    R +TF D+ LP+
Sbjct: 271 TNTAQADLINRLYEGKINDYVKCLTCNTEKFREDTFLDIPLPV 313


>UniRef50_UPI0000DB6B1E Cluster: PREDICTED: similar to mule
           CG5505-PA, isoform A; n=1; Apis mellifera|Rep:
           PREDICTED: similar to mule CG5505-PA, isoform A - Apis
           mellifera
          Length = 822

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 1/101 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L + L+++FS ++L  +N Y C  CK+     K   +   P VLCV LKRF    +   
Sbjct: 261 TLDEALSSYFSREQLD-NNDYKCEACKRRVPATKQFSLERPPKVLCVQLKRFS---VLGG 316

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMG 611
           K+        TI     L +          Y L ++++HMG
Sbjct: 317 KISKHIGFKQTIDMGPYLWKEPGESSQSLTYKLMSIVTHMG 357



 Score = 34.3 bits (75), Expect = 2.9
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +1

Query: 22  AKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           A+  +S   S  K  + I+ +F G + + V+CL C  VST  + FQDL + I
Sbjct: 205 ARHKASKLDSYSKETTPINQIFGGYIRTEVKCLQCRHVSTTFQHFQDLLVDI 256


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 615,458,790
Number of Sequences: 1657284
Number of extensions: 10667920
Number of successful extensions: 35035
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 32689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34935
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54958682807
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -