SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4TEL0 Cluster: Chromosome undetermined SCAF5294, whole...   144   2e-33
UniRef50_O43776 Cluster: Asparaginyl-tRNA synthetase, cytoplasmi...   143   5e-33
UniRef50_Q5C128 Cluster: SJCHGC05996 protein; n=1; Schistosoma j...   103   8e-21
UniRef50_Q4TEK9 Cluster: Chromosome undetermined SCAF5294, whole...   100   6e-20
UniRef50_O94567 Cluster: Probable asparaginyl-tRNA synthetase, c...    95   2e-18
UniRef50_A2FRT6 Cluster: Asparaginyl-tRNA synthetase family prot...    94   5e-18
UniRef50_Q554D9 Cluster: Asparagine-tRNA ligase; n=3; Eukaryota|...    80   6e-14
UniRef50_Q1E9J8 Cluster: Asparaginyl-tRNA synthetase, cytoplasmi...    75   2e-12
UniRef50_A6QUC8 Cluster: Asparaginyl-tRNA synthetase; n=6; Peziz...    68   4e-10
UniRef50_UPI0000499914 Cluster: asparaginyl-tRNA synthetase; n=1...    55   2e-06
UniRef50_Q7QQP3 Cluster: GLP_300_5465_7111; n=1; Giardia lamblia...    54   5e-06
UniRef50_Q7TPL1 Cluster: Ac1-163; n=1; Rattus norvegicus|Rep: Ac...    53   1e-05
UniRef50_A4RP67 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q4SRE1 Cluster: Chromosome undetermined SCAF14527, whol...    51   4e-05
UniRef50_Q4Q2W6 Cluster: Asparaginyl-trna synthetase, putative; ...    47   7e-04
UniRef50_Q9RVH4 Cluster: Aspartyl-tRNA synthetase, non-discrimin...    45   0.002
UniRef50_Q8ZU29 Cluster: Asparaginyl-tRNA synthetase; n=5; Therm...    43   0.012
UniRef50_Q97DB5 Cluster: Aspartyl/asparaginyl-tRNA synthetase; n...    42   0.027
UniRef50_Q2S1I6 Cluster: Asparaginyl-tRNA synthetase; n=1; Salin...    42   0.027
UniRef50_Q979Y4 Cluster: Asparaginyl-tRNA synthetase; n=4; Therm...    41   0.036
UniRef50_Q2QU17 Cluster: Retrotransposon protein, putative, Ty3-...    40   0.083
UniRef50_A1SFW8 Cluster: TRNA synthetase, class II; n=3; Actinom...    39   0.19 
UniRef50_Q3YQY9 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_A1I8L1 Cluster: Iron-sulfur cluster binding protein; n=...    38   0.33 
UniRef50_Q2QY67 Cluster: Retrotransposon protein, putative, Ty3-...    38   0.44 
UniRef50_Q2QV76 Cluster: Retrotransposon protein, putative, Ty3-...    37   0.58 
UniRef50_A4M604 Cluster: Asparaginyl-tRNA synthetase; n=2; Bacte...    37   0.77 
UniRef50_Q6GQG1 Cluster: LOC443582 protein; n=6; Xenopus|Rep: LO...    36   1.0  
UniRef50_Q54GW3 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_A0DA06 Cluster: Chromosome undetermined scaffold_42, wh...    36   1.0  
UniRef50_Q2B9B5 Cluster: Oligopeptide ABC transporter, oligopept...    36   1.4  
UniRef50_Q8IBL1 Cluster: Putative uncharacterized protein MAL7P1...    35   2.4  
UniRef50_A2EN31 Cluster: Viral A-type inclusion protein, putativ...    35   2.4  
UniRef50_Q1LVQ6 Cluster: Novel protein; n=6; Clupeocephala|Rep: ...    35   3.1  
UniRef50_Q53NJ8 Cluster: Retrotransposon protein, putative, Ty3-...    35   3.1  
UniRef50_Q2QNP8 Cluster: Retrotransposon protein, putative, Ty3-...    35   3.1  
UniRef50_Q39S02 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q0KJM0 Cluster: Putative uncharacterized protein ORF94;...    34   4.1  
UniRef50_Q54RX3 Cluster: Putative uncharacterized protein; n=2; ...    34   4.1  
UniRef50_Q9BXX2 Cluster: Ankyrin repeat domain-containing protei...    34   4.1  
UniRef50_Q59YV6 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_A0RV77 Cluster: Aspartyl/asparaginyl-tRNA synthetase; n...    34   4.1  
UniRef50_Q8LMW4 Cluster: Putative uncharacterized protein OSJNBa...    34   5.5  
UniRef50_A6MD06 Cluster: UBX domain-containing protein; n=1; Ory...    34   5.5  
UniRef50_A2F8N3 Cluster: Viral A-type inclusion protein, putativ...    34   5.5  
UniRef50_Q5A2Z9 Cluster: Putative uncharacterized protein MUB1; ...    34   5.5  
UniRef50_UPI00006CC0AF Cluster: hypothetical protein TTHERM_0021...    33   7.2  
UniRef50_UPI000049A0EC Cluster: hypothetical protein 20.t00044; ...    33   7.2  
UniRef50_Q8XNH3 Cluster: DNA polymerase III, subunit alpha; n=5;...    33   7.2  
UniRef50_Q54MI3 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_A7TFQ2 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_UPI0000F2BC3E Cluster: PREDICTED: hypothetical protein;...    33   9.5  
UniRef50_UPI00006CB631 Cluster: hypothetical protein TTHERM_0044...    33   9.5  

>UniRef50_Q4TEL0 Cluster: Chromosome undetermined SCAF5294, whole
           genome shotgun sequence; n=2; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF5294,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 533

 Score =  144 bits (350), Expect = 2e-33
 Identities = 67/109 (61%), Positives = 82/109 (75%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L F+ LRDGTG+LQCVL   LCQ YNALVLSTES+V LYG +  VPEGK
Sbjct: 111 WVHRLRRQGKNLMFIVLRDGTGFLQCVLSDKLCQCYNALVLSTESTVALYGTVTPVPEGK 170

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL  D+W +         D +LNE++  DVQL++R ++IR EN
Sbjct: 171 QAPGGHELHCDFWELIGLAPAGGADNLLNEDSDVDVQLNNRHMLIRGEN 219



 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +2

Query: 251 CYSKDDTKDYDVAAKSQLKK-IQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQ 427
           C  K+     DV ++ + +  + K+ V  N  ++ +A    E+ E+R +NL+EAKK++++
Sbjct: 27  CAGKEPFPTIDVDSQEEGEVGLDKLQVEVNEFSVTQA----EDNERREKNLEEAKKVIIE 82

Query: 428 EDPSLPKATVVKICETTEHRGQRI 499
           +DPSLP    VKI +    RGQR+
Sbjct: 83  DDPSLPSPETVKIRQLETKRGQRV 106



 Score = 37.1 bits (82), Expect = 0.58
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +3

Query: 183 EKPFKTILKAMHHAGKEPFPTIYV 254
           +KPFK  LKA+  AGKEPFPTI V
Sbjct: 15  QKPFKAPLKALPCAGKEPFPTIDV 38


>UniRef50_O43776 Cluster: Asparaginyl-tRNA synthetase, cytoplasmic;
           n=65; Fungi/Metazoa group|Rep: Asparaginyl-tRNA
           synthetase, cytoplasmic - Homo sapiens (Human)
          Length = 548

 Score =  143 bits (347), Expect = 5e-33
 Identities = 66/109 (60%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L FL LRDGTGYLQCVL   LCQ YN ++LSTESSV +YG L   P+GK
Sbjct: 133 WVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGK 192

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL+ D+W +         D ++NEE+  DVQL++R +MIR EN
Sbjct: 193 QAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN 241



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + ++V +KSQLK I+K+W RE  K+  + K E E++ +R +NL+EAKKI ++ DP
Sbjct: 48  SQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDP 107

Query: 437 SLPKATVVKICETTEHRGQRI 499
           SLP+   VKI     +RGQR+
Sbjct: 108 SLPEPKCVKIGALEGYRGQRV 128



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +3

Query: 123 LSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYV 254
           L+E+Y S             EKPFKT LKA+   GKEPFPTIYV
Sbjct: 3   LAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYV 46


>UniRef50_Q5C128 Cluster: SJCHGC05996 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05996 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 224

 Score =  103 bits (246), Expect = 8e-21
 Identities = 46/92 (50%), Positives = 61/92 (66%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHR+RRQ K+L F+ LRDGTG+LQC+    LC T  A+ LS ES+V +YG ++ +P GK
Sbjct: 132 WVHRIRRQSKTLMFIILRDGTGFLQCIFANNLCLTQEAITLSPESTVKVYGVVKQLPAGK 191

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEA 786
            APGG EL ADYW +         D++L  E+
Sbjct: 192 SAPGGIELVADYWMVIGNAPAGGVDSVLTVES 223



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = +2

Query: 263 DDTKD--YDVAAKSQLKKIQK---IWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQ 427
           D T D  +DV +KS+LKK  K   I  ++  KA  +     EN +  + NL EA  + L 
Sbjct: 46  DGTGDEMWDVVSKSKLKKATKQYHIQTKKQEKAPHEKIVSYENGD--NVNLSEAINVQLT 103

Query: 428 EDPSLPKATVVKICETTEHRGQRICI 505
            D  LP+A  +KI +      QR+C+
Sbjct: 104 LDTKLPEAKELKIRDLQTMIDQRVCV 129


>UniRef50_Q4TEK9 Cluster: Chromosome undetermined SCAF5294, whole
           genome shotgun sequence; n=2; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF5294,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 562

 Score =  100 bits (239), Expect = 6e-20
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L F+ LRDGTG+LQCVL   LCQ YNALVLSTES+V LYG +  VPEGK
Sbjct: 114 WVHRLRRQGKNLMFIVLRDGTGFLQCVLSDKLCQCYNALVLSTESTVALYGTVTPVPEGK 173

Query: 691 K 693
           +
Sbjct: 174 Q 174



 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +2

Query: 251 CYSKDDTKDYDVAAKSQLKK-IQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQ 427
           C  K+     DV ++ + +  + K+ V  N  ++ +A    E+ E+R +NL+EAKK++++
Sbjct: 30  CAGKEPFPTIDVDSQEEGEVGLDKLQVEVNESSVTQA----EDNERREKNLEEAKKVIIE 85

Query: 428 EDPSLPKATVVKICETTEHRGQRI 499
           +DPSLP    VKI +    RGQR+
Sbjct: 86  DDPSLPSPETVKIRQLETKRGQRV 109



 Score = 37.1 bits (82), Expect = 0.58
 Identities = 17/24 (70%), Positives = 19/24 (79%)
 Frame = +3

Query: 183 EKPFKTILKAMHHAGKEPFPTIYV 254
           +KPFK  LKA+  AGKEPFPTI V
Sbjct: 18  QKPFKAPLKALPCAGKEPFPTIDV 41


>UniRef50_O94567 Cluster: Probable asparaginyl-tRNA synthetase,
           cytoplasmic; n=4; Dikarya|Rep: Probable asparaginyl-tRNA
           synthetase, cytoplasmic - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 568

 Score = 95.5 bits (227), Expect = 2e-18
 Identities = 53/112 (47%), Positives = 68/112 (60%), Gaps = 4/112 (3%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQ--TYNALVLSTESSVVLYGKLEAVPE 684
           WVHR+R Q K + F+ LRDGTG+LQCVL G +    +Y+ + L  ES+V LYG ++ +PE
Sbjct: 149 WVHRMRTQ-KGIIFIILRDGTGFLQCVLSGKVYDRASYDFINLGPESTVCLYGVIKELPE 207

Query: 685 GKKAPGGHELTADYWGIDWTRTT--RWCDAILNEEALPDVQLDHRXIMIRXE 834
           GK APG HEL  DY+ I     T        LN EA P   LD R ++IR E
Sbjct: 208 GKSAPGNHELVVDYYQILHAAPTGEEAFTNRLNAEAEPSYLLDQRHLVIRGE 259


>UniRef50_A2FRT6 Cluster: Asparaginyl-tRNA synthetase family
           protein; n=1; Trichomonas vaginalis G3|Rep:
           Asparaginyl-tRNA synthetase family protein - Trichomonas
           vaginalis G3
          Length = 624

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 48/108 (44%), Positives = 71/108 (65%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVH+L R G  + FLTLRDGTG+LQ +L G+L QT +AL ++ E++V++ GK   V E K
Sbjct: 211 WVHKLSRHG-GIMFLTLRDGTGFLQVILEGILTQTTSALTINREATVMVVGK---VREDK 266

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXE 834
           +A GG EL ADYW +     + + D +   +  PD+ LD+R +++R E
Sbjct: 267 RAVGGKELAADYWEMIGNAPSDF-DTLTRPDLTPDLLLDNRHLVLRSE 313



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +2

Query: 206 ESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAK-AEEENTE 382
           E+N+   ++A  H L +++   K    A +  L +++K       +A  KAK AE  N E
Sbjct: 111 ENNSRVLEQAYEH-LNFAEAMGKSAKKAMEKNLARVKK---NAEKRAAQKAKEAENANAE 166

Query: 383 --KRSQNLDEAKKILLQEDPSLPKATVVKI 466
             K    L++A  I L+ED SLP A   KI
Sbjct: 167 AEKLKAALEKAASIKLEEDKSLPAAVTRKI 196


>UniRef50_Q554D9 Cluster: Asparagine-tRNA ligase; n=3;
           Eukaryota|Rep: Asparagine-tRNA ligase - Dictyostelium
           discoideum AX4
          Length = 653

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 45/106 (42%), Positives = 59/106 (55%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           W H +R Q K + FL LRDGTG+LQCVL G L        L  E++V + G L   P  K
Sbjct: 237 WAHHVRNQ-KKIVFLELRDGTGFLQCVLSGDLVHPSIIDKLLREATVKIVGTLVIPPADK 295

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIR 828
           K PGG EL ADYW +    +    + ++N+E+  D   D R IM+R
Sbjct: 296 KCPGGVELQADYWEL-LGPSNADLEGVINQESNVDHLFDQRHIMMR 340


>UniRef50_Q1E9J8 Cluster: Asparaginyl-tRNA synthetase, cytoplasmic;
           n=9; Pezizomycotina|Rep: Asparaginyl-tRNA synthetase,
           cytoplasmic - Coccidioides immitis
          Length = 578

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 44/110 (40%), Positives = 67/110 (60%), Gaps = 3/110 (2%)
 Frame = +1

Query: 514 VHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGKK 693
           VHRLR Q K + F+TL DG G+LQCV  G L +TY+A+ L+ E+S+ ++G++ AVP  + 
Sbjct: 162 VHRLRSQ-KDVIFVTLSDGYGFLQCVFTGDLVKTYDAMTLTLETSIAVHGEMCAVPPKQH 220

Query: 694 APGGHELTADYWGIDWTRTTRWCDAILNE---EALPDVQLDHRXIMIRXE 834
           AP   EL AD++ +   R     +AI      +A P    D+R +++R E
Sbjct: 221 APDNRELHADFFTV-IGRAAGDKEAITTRVAPDADPQTLYDNRHLVLRGE 269



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 3/83 (3%)
 Frame = +2

Query: 275 DYDVAAKSQLKKIQKIWVRENYKAMDK---AKAEEENTEKRSQNLDEAKKILLQEDPSLP 445
           ++  A KS LKK   ++     KA  +   A  ++E  EKR   L+ AKK++++ED SLP
Sbjct: 70  EWKPATKSALKKATNLFEARKKKAAKEHELALRQKEEAEKRQLVLEAAKKVVIKEDASLP 129

Query: 446 KATVVKICETTEHRGQRICIRDG 514
           K   +++ E       ++ +RDG
Sbjct: 130 KPVRIRLYEKDP---AKVKLRDG 149


>UniRef50_A6QUC8 Cluster: Asparaginyl-tRNA synthetase; n=6;
           Pezizomycotina|Rep: Asparaginyl-tRNA synthetase -
           Ajellomyces capsulatus NAm1
          Length = 581

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 3/110 (2%)
 Frame = +1

Query: 514 VHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGKK 693
           VHRLR Q K + F+TL DG G LQC+  G L ++Y A+ L+ E+S+ ++G++ AVP    
Sbjct: 165 VHRLRSQ-KDMMFVTLSDGYGLLQCIFTGDLVKSYGAMTLTLETSIAIHGEMRAVPPKNH 223

Query: 694 APGGHELTADYWGIDWTRTTRWCDAILNE---EALPDVQLDHRXIMIRXE 834
           A    EL AD++ I   R     +AI      ++ P    D+R +++R E
Sbjct: 224 AYDDRELHADFFTI-IGRAAGDKEAITTRVAPDSDPHTLYDNRHLVLRGE 272



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWVRENYKAMDK---AKAEEENTEKRSQNLDEAKKILLQEDPSLPKATV 457
           A KS LKK   ++ +   KA  +   A  E++  EKR   L+EAKK++++ED SLPK   
Sbjct: 74  ATKSALKKANNLYEQRKKKAAKEKELAIREKDEIEKRKLVLEEAKKVIIKEDESLPKPLK 133

Query: 458 VKICETTEHRGQRICIRDGYIVSGAKVNL 544
           +++ ET   +  ++   DG  + G +V +
Sbjct: 134 IRLNETDPAK-IKLRPSDGDEIPGTRVRV 161


>UniRef50_UPI0000499914 Cluster: asparaginyl-tRNA synthetase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: asparaginyl-tRNA
           synthetase - Entamoeba histolytica HM-1:IMSS
          Length = 451

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 39/122 (31%), Positives = 66/122 (54%), Gaps = 10/122 (8%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGL-LCQTYNALVLSTESSVVLYGKLEAVPEG 687
           W + +R+  K+L F+ LRDG+GY QCV+ G  LC+     +L+ E S+ + G+L A   G
Sbjct: 33  WAYHIRKARKTLIFVELRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAY-AG 91

Query: 688 KKAPGGHELTADYWGIDWTRTTRW---------CDAILNEEALPDVQLDHRXIMIRXENP 840
           K  P   E+ AD   ++  + T W          + I+N+++    ++ +R I+IR E+ 
Sbjct: 92  KNHP--PEI-ADILNLE-MQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHT 147

Query: 841 VQ 846
            Q
Sbjct: 148 QQ 149


>UniRef50_Q7QQP3 Cluster: GLP_300_5465_7111; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_300_5465_7111 - Giardia lamblia ATCC
           50803
          Length = 548

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 1/110 (0%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNA-LVLSTESSVVLYGKLEAVPEG 687
           W HR+R     LAF+ LRDGTGY Q VL+     T     +L TE++V   G L A    
Sbjct: 125 WCHRVRVSSPKLAFVVLRDGTGYCQLVLNEACMGTRRTQTLLRTEAAVKAVGILVA---D 181

Query: 688 KKAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
            +A GG+E+   Y+ I    +  + +  +  E+ PD +   R ++ R E+
Sbjct: 182 TRAQGGYEIQCLYFDIIGPSSGEF-ETRITPESGPDARARERHLIHRGEH 230


>UniRef50_Q7TPL1 Cluster: Ac1-163; n=1; Rattus norvegicus|Rep:
           Ac1-163 - Rattus norvegicus (Rat)
          Length = 948

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 24/62 (38%), Positives = 42/62 (67%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + +DV +KSQ+K I+K+W RE  K     K + E+  +R +NL+EA+ I+++ DP
Sbjct: 420 SQKENERWDVISKSQMKNIKKMWQRELMKNDTWEKTKAEDNLQREKNLEEAENIIIKYDP 479

Query: 437 SL 442
           +L
Sbjct: 480 NL 481



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +3

Query: 183 EKPFKTILKAMHHAGKEPFPTIYV 254
           EKPFKT LKA+   GKEP+PT++V
Sbjct: 395 EKPFKTGLKALMTVGKEPYPTVFV 418


>UniRef50_A4RP67 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 267

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 44/72 (61%)
 Frame = +1

Query: 514 VHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGKK 693
           V+R+ +Q   L F  LR G   +Q +  G L +TY+AL L+ E+S+ ++G+L  VP G +
Sbjct: 81  VYRVAKQS-GLMFARLRRGLDLIQRLYAGNLAKTYDALTLARETSMEVFGELREVPAGLR 139

Query: 694 APGGHELTADYW 729
           AP   EL  +Y+
Sbjct: 140 APLDRELHGNYF 151


>UniRef50_Q4SRE1 Cluster: Chromosome undetermined SCAF14527, whole
            genome shotgun sequence; n=4; Fungi/Metazoa group|Rep:
            Chromosome undetermined SCAF14527, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 3152

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +1

Query: 691  KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
            KAPGGHEL  D+W +         D +LNE++  DVQL++R ++IR EN
Sbjct: 2502 KAPGGHELHCDFWELIGLAPAGGADNLLNEDSDVDVQLNNRHMLIRGEN 2550


>UniRef50_Q4Q2W6 Cluster: Asparaginyl-trna synthetase, putative;
           n=7; Eukaryota|Rep: Asparaginyl-trna synthetase,
           putative - Leishmania major
          Length = 890

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 1/107 (0%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           W HR+R Q + ++F+ LRDGTG++QCV  G      +      ES V + G L   P+ K
Sbjct: 467 WAHRVRHQSR-MSFVVLRDGTGFIQCVFDG------STEPFHRESCVAIRGTLRHEPKAK 519

Query: 691 -KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIR 828
            +     EL  D + +    +    + ++  E+  D   D R +++R
Sbjct: 520 SELQPPMELHVDEYAVVGD-SDGTIETVITAESSVDKLYDQRHVVVR 565


>UniRef50_Q9RVH4 Cluster: Aspartyl-tRNA synthetase,
           non-discriminating; n=5; Deinococci|Rep: Aspartyl-tRNA
           synthetase, non-discriminating - Deinococcus radiodurans
          Length = 435

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +1

Query: 505 QRWVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPE 684
           Q +VH  R  G  + FL LRD TG  QCV  GL       L L+ ESSV + GK++A P 
Sbjct: 24  QGFVHARRDLG-GVQFLVLRDVTGVTQCVGSGL------TLPLA-ESSVEVVGKVKAHP- 74

Query: 685 GKKAPGGHELTADYWGIDWTRTTRWCDAILNEE--ALPDVQLDHRXIMIR 828
             KAPGG E+  + + +    T      I   E    P+  LD+R + +R
Sbjct: 75  --KAPGGFEVQVEDFRVISAATEATPVEIPKMEWNVNPETMLDYRVVTVR 122


>UniRef50_Q8ZU29 Cluster: Asparaginyl-tRNA synthetase; n=5;
           Thermoproteales|Rep: Asparaginyl-tRNA synthetase -
           Pyrobaculum aerophilum
          Length = 431

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 31/77 (40%), Positives = 43/77 (55%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WV+R +R  K  AF+ LRD TG +Q V      +  +A  L+ ESS+V+ G L   P   
Sbjct: 26  WVYR-KRVLKEKAFILLRDSTGVIQLVFPRE--RLKDAEELNLESSIVVTGALVREP--- 79

Query: 691 KAPGGHELTADYWGIDW 741
           +APGG EL  +   +DW
Sbjct: 80  RAPGGVELHVE--SVDW 94


>UniRef50_Q97DB5 Cluster: Aspartyl/asparaginyl-tRNA synthetase;
           n=15; Firmicutes|Rep: Aspartyl/asparaginyl-tRNA
           synthetase - Clostridium acetobutylicum
          Length = 479

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = +1

Query: 505 QRWVHRLRRQGKSLAFLTLRDGTGYLQCVL 594
           Q WVH+LR+ GK +AF+ LRD TG +QCV+
Sbjct: 74  QGWVHKLRKLGK-IAFVLLRDRTGIIQCVV 102


>UniRef50_Q2S1I6 Cluster: Asparaginyl-tRNA synthetase; n=1;
           Salinibacter ruber DSM 13855|Rep: Asparaginyl-tRNA
           synthetase - Salinibacter ruber (strain DSM 13855)
          Length = 544

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 29/109 (26%), Positives = 49/109 (44%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           W+H  R  G  + FL LRDG+G++QCV+        +  V              +V   +
Sbjct: 66  WLHNQRGSG-GIKFLILRDGSGFVQCVVPQDAVDADSWAVADDVRQEAALEITGSVSADE 124

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGG+EL  D   ++    +        E  + D  ++HR + +R E+
Sbjct: 125 RAPGGYELQVD--AVERIGESGDYPVTPKEHGI-DFLMEHRHLWLRSES 170


>UniRef50_Q979Y4 Cluster: Asparaginyl-tRNA synthetase; n=4;
           Thermoplasmatales|Rep: Asparaginyl-tRNA synthetase -
           Thermoplasma volcanium
          Length = 429

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +1

Query: 490 SEDMHQRWVHRLRRQGKSLAFLTLRDGTGYLQCVL--HGLLCQTYNAL-VLSTESSVVLY 660
           SE   + WV+R+R  G  + F+ +RD TG +QC    + L  + Y+ +  L  ESS+ L 
Sbjct: 15  SEVSVRGWVYRIRSSG-GVTFIVIRDSTGIVQCTAKKNELTPEQYDEISSLGIESSLSLI 73

Query: 661 GKLEAVPEGKKAPGGHELT 717
           G ++  P   ++P G+E++
Sbjct: 74  GTMKKEP---RSPTGYEIS 89


>UniRef50_Q2QU17 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy subclass - Oryza sativa subsp. japonica (Rice)
          Length = 832

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = +2

Query: 296 SQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICET 475
           S++KK++K+WVR+  KA +     EE+ +      D AK I  Q + +   A  V I   
Sbjct: 686 SKVKKVKKVWVRKEAKAPEVVAINEESQDVHVPTGDAAKTI--QAEKTEANAVAVDIGGL 743

Query: 476 TEHRGQRIC 502
           TE  GQ  C
Sbjct: 744 TETAGQSDC 752


>UniRef50_A1SFW8 Cluster: TRNA synthetase, class II; n=3;
           Actinomycetales|Rep: TRNA synthetase, class II -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 424

 Score = 38.7 bits (86), Expect = 0.19
 Identities = 30/79 (37%), Positives = 40/79 (50%)
 Frame = +1

Query: 481 TPWSEDMHQRWVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLY 660
           TP S    Q WVHR RR+  +L FL +RD +G  Q V+         + V   E++V + 
Sbjct: 13  TPGSTVRLQGWVHR-RRELSALTFLVVRDRSGLAQVVVRD------GSAVPPEETTVEVV 65

Query: 661 GKLEAVPEGKKAPGGHELT 717
           G   A     +APGG ELT
Sbjct: 66  GTATA---NAQAPGGMELT 81


>UniRef50_Q3YQY9 Cluster: Putative uncharacterized protein; n=1;
            Ehrlichia canis str. Jake|Rep: Putative uncharacterized
            protein - Ehrlichia canis (strain Jake)
          Length = 1267

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 7/116 (6%)
 Frame = +2

Query: 197  DNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLK--KIQKIWVRE-NYKAMDKAKAE 367
            DN ++   CW       LCY  DDTKD   + K  +K  K +   V +  Y  ++  K+ 
Sbjct: 978  DNKKAEKLCWANEEVSLLCYEDDDTKD---SVKDNIKGGKSESDGVYKCCYGKLEDYKSP 1034

Query: 368  EENTEKR---SQNLDEAKKILLQEDP-SLPKATVVKICETTEHRGQRICIRDGYIV 523
             +N +KR    ++L +   +L+ +D   L K    +I   T++R  ++ + +G +V
Sbjct: 1035 SKNDKKRICWKKSLTDLTNMLVGDDAVELAKLNTKEIKGKTQYRSSQVKMIEGKLV 1090


>UniRef50_A1I8L1 Cluster: Iron-sulfur cluster binding protein; n=1;
           Candidatus Desulfococcus oleovorans Hxd3|Rep:
           Iron-sulfur cluster binding protein - Candidatus
           Desulfococcus oleovorans Hxd3
          Length = 537

 Score = 37.9 bits (84), Expect = 0.33
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -2

Query: 631 GLEHCRSDIVNHVERTVGTQCHHAGSGMPEIYL 533
           GL+H R  I++ + R +G  CH AG G  +IYL
Sbjct: 141 GLDHLRDLIIDGLNRAIGELCHQAGIGTTDIYL 173


>UniRef50_Q2QY67 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=3; Oryza sativa|Rep:
           Retrotransposon protein, putative, Ty3-gypsy subclass -
           Oryza sativa subsp. japonica (Rice)
          Length = 832

 Score = 37.5 bits (83), Expect = 0.44
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = +2

Query: 296 SQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICET 475
           S++KK++K+WVR+  KA +     EE+ +      D AK I  Q + +     VV I   
Sbjct: 667 SKVKKVKKVWVRKEAKAPEVVAINEESQDVHVPTGDAAKTI--QTEKTKANTVVVDISGL 724

Query: 476 TEHRGQ 493
           TE  G+
Sbjct: 725 TEPAGR 730


>UniRef50_Q2QV76 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy subclass - Oryza sativa subsp. japonica (Rice)
          Length = 720

 Score = 37.1 bits (82), Expect = 0.58
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKI 466
           + +S++KK++K+WVR+  KA +    +E++ + +    D AK I  Q + +   A  V I
Sbjct: 498 SGRSKVKKVKKVWVRKEAKAPEVIAIKEKSQDVQVPTEDAAKTI--QAEKTEADAVAVDI 555

Query: 467 CETTEHRGQ 493
              TE  G+
Sbjct: 556 GSLTEPAGR 564


>UniRef50_A4M604 Cluster: Asparaginyl-tRNA synthetase; n=2;
           Bacteria|Rep: Asparaginyl-tRNA synthetase - Petrotoga
           mobilis SJ95
          Length = 434

 Score = 36.7 bits (81), Expect = 0.77
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLH--GLLCQTY-NALVLSTESSVVLYGKLE 672
           WV   R  GK +AFL LRDGTG++Q +        +T+ N   +  ESS++L G ++
Sbjct: 24  WVWNKRSSGK-IAFLQLRDGTGFIQGIAEKKDFDDETFENIRKIKMESSIILQGTIK 79


>UniRef50_Q6GQG1 Cluster: LOC443582 protein; n=6; Xenopus|Rep:
           LOC443582 protein - Xenopus laevis (African clawed frog)
          Length = 623

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 5/80 (6%)
 Frame = +2

Query: 272 KDYDVAAK---SQLKKIQKIWVRENYKAMDK--AKAEEENTEKRSQNLDEAKKILLQEDP 436
           K+  VA+K   SQL K +K  V E  K  +K   K E+E+ E  S+N  E+    LQE+ 
Sbjct: 180 KEKTVASKKKTSQLIKEKKPIVHEKSKIPEKNVVKNEKEDKENISENERESSGDCLQEES 239

Query: 437 SLPKATVVKICETTEHRGQR 496
           S P  T+    E  E R +R
Sbjct: 240 STPSETLRTPLENGERRKKR 259


>UniRef50_Q54GW3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 247

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
 Frame = +2

Query: 293 KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNL---DEAKKILLQEDPSL 442
           K Q  K  K+W   + K +DK K ++E  EK  ++     EAK++L QED  +
Sbjct: 29  KKQRDKEDKMWEETDTKILDKQKKQKEKEEKAREDAKKKQEAKELLQQEDKEI 81


>UniRef50_A0DA06 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 442

 Score = 36.3 bits (80), Expect = 1.0
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +2

Query: 242 HNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKIL 421
           H +    +DTK + VA   +LKK +KI   +  K+ DK+K E + +  +   ++E K+  
Sbjct: 143 HKIKQDLEDTKSF-VAKAQRLKKPEKILKAQQEKSFDKSKQEIKKSTTKQNQMNEDKQQQ 201

Query: 422 LQED 433
            QE+
Sbjct: 202 SQEN 205


>UniRef50_Q2B9B5 Cluster: Oligopeptide ABC transporter,
           oligopeptide-binding protein; n=2; Bacillus sp. NRRL
           B-14911|Rep: Oligopeptide ABC transporter,
           oligopeptide-binding protein - Bacillus sp. NRRL B-14911
          Length = 545

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +2

Query: 323 WVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLP 445
           WV E Y ++      E++  KR Q L +A+KIL++E P +P
Sbjct: 470 WVNEEYDSLIAQAKVEQDEAKRYQLLHDAEKILMEEMPFMP 510


>UniRef50_Q8IBL1 Cluster: Putative uncharacterized protein
           MAL7P1.129; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL7P1.129 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1003

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 194 QDN-IESNASCWQR--AISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKA 364
           +DN I S++S ++   ++   + +S D++  +D     ++KK+  I   +N+K   K K 
Sbjct: 102 EDNYISSDSSSFKSRSSLGRKISFSSDESY-FDSDIDMRIKKLLNIEDHDNFKKKKKKKI 160

Query: 365 EEENTEKRSQNLDEAKK 415
           +EE   K+ +  +E KK
Sbjct: 161 KEEEERKKKEEEEERKK 177


>UniRef50_A2EN31 Cluster: Viral A-type inclusion protein, putative;
            n=1; Trichomonas vaginalis G3|Rep: Viral A-type inclusion
            protein, putative - Trichomonas vaginalis G3
          Length = 5296

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 263  DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQE 430
            D+TK   V  +++  + QK+ + E  +A    + E+  TEKR Q  +EAKK L  E
Sbjct: 3843 DETKQQKVNLENEKAETQKL-LEETEEAKKNLENEKAETEKRLQETEEAKKNLANE 3897



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 22/68 (32%), Positives = 36/68 (52%)
 Frame = +2

Query: 245  NLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
            NL   K++T+     A+ Q  + QK+ + +  +A    + E+  TEK+ Q  +EAKK L 
Sbjct: 3774 NLENEKNETQKKLEEAEQQKAETQKL-LEQTEEAKKNLENEKSETEKKLQETEEAKKNLE 3832

Query: 425  QEDPSLPK 448
            QE   + K
Sbjct: 3833 QEKSDIQK 3840



 Score = 34.7 bits (76), Expect = 3.1
 Identities = 22/68 (32%), Positives = 36/68 (52%)
 Frame = +2

Query: 245  NLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
            NL   K++T+     A+ Q  + QK+ + +  +A    + E+  TEK+ Q  +EAKK L 
Sbjct: 3928 NLENEKNETQKKLEEAEQQKAETQKL-LEQTEEAKKNLENEKSETEKKLQETEEAKKNLE 3986

Query: 425  QEDPSLPK 448
            QE   + K
Sbjct: 3987 QEKSDIQK 3994


>UniRef50_Q1LVQ6 Cluster: Novel protein; n=6; Clupeocephala|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1290

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 227 QRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNL 400
           +R   +N+   KDD +  DV A    K++Q+   ++N +  D+ K EEE   K   N+
Sbjct: 386 KREEKNNITSVKDDCRRQDVDADKTNKEMQRKEAKQNLQVEDQCKIEEERDGKNKINV 443


>UniRef50_Q53NJ8 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy sub-class; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy sub-class - Oryza sativa subsp. japonica
           (Rice)
          Length = 799

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = +2

Query: 239 SHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKI 418
           SH+   S+D       +  S++K+++K+WVR+  KA +    +EE+ + +    D  K I
Sbjct: 471 SHSFNSSQDRFPQKSRSGGSKVKQVKKVWVRKEAKAPEVVTIKEESQDVQVPTRDAVKTI 530


>UniRef50_Q2QNP8 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy subclass - Oryza sativa subsp. japonica (Rice)
          Length = 331

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 20/71 (28%), Positives = 38/71 (53%)
 Frame = +2

Query: 281 DVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVV 460
           D   +S++KK++K+WVR+  KA +    +E++ + +    D AK  ++Q + +      V
Sbjct: 73  DGLGESKVKKVKKVWVRKEAKAPEVVTIKEKSQDVQVPTGDAAK--IIQVEKTEAGTVTV 130

Query: 461 KICETTEHRGQ 493
            I   TE  G+
Sbjct: 131 NIGGLTETAGR 141


>UniRef50_Q39S02 Cluster: Putative uncharacterized protein; n=1;
           Geobacter metallireducens GS-15|Rep: Putative
           uncharacterized protein - Geobacter metallireducens
           (strain GS-15 / ATCC 53774 / DSM 7210)
          Length = 163

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 19/90 (21%), Positives = 45/90 (50%)
 Frame = +2

Query: 197 DNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEEN 376
           + I+S +  WQ+  + +L   K D    DV  + +++++Q  +     +   + + + + 
Sbjct: 16  ETIKSESLEWQKKHNDDLNKLKRDKDLADVKLRHEIEELQTRFEEHKVRVQIEEQHKTKQ 75

Query: 377 TEKRSQNLDEAKKILLQEDPSLPKATVVKI 466
             +  Q++DE K  +L++ PS+ K   + I
Sbjct: 76  FSEFLQSIDETKSKILEQFPSMSKPIALMI 105


>UniRef50_Q0KJM0 Cluster: Putative uncharacterized protein ORF94;
           n=2; Sphingomonas sp. KA1|Rep: Putative uncharacterized
           protein ORF94 - Sphingomonas sp. KA1
          Length = 142

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 3/64 (4%)
 Frame = -1

Query: 692 FFPSGTASNFPYKTTDDSVDRTRAL*V*HS--KPCRTHCRYPVPSRRVRNARDLPWRRRR 519
           F P G AS  P  TT    DRT A  + H   K    HCR PVP   +R+  D  WRRRR
Sbjct: 66  FGPVGVAS--PCCTTLS--DRTAASAIDHPPRKRRHRHCRPPVP---LRSTSDRQWRRRR 118

Query: 518 -CTH 510
            CT+
Sbjct: 119 QCTN 122


>UniRef50_Q54RX3 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 16/64 (25%), Positives = 35/64 (54%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSL 442
           D+  DY  A +  L+K ++  + + YK  +K   +++ ++KR + +++  K LL++    
Sbjct: 3   DNNLDYKKAYEELLEKQKEKEIEKAYKVYEKLLEKQKESQKRQKEIEKENKELLEKQKES 62

Query: 443 PKAT 454
            K T
Sbjct: 63  QKKT 66


>UniRef50_Q9BXX2 Cluster: Ankyrin repeat domain-containing protein
           30B; n=9; Homo/Pan/Gorilla group|Rep: Ankyrin repeat
           domain-containing protein 30B - Homo sapiens (Human)
          Length = 1011

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +2

Query: 329 RENYKA--MDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHRGQRIC 502
           RE +KA  M  +++++++ E+ S + +   + LLQ D  LPKAT  K  +T   + +   
Sbjct: 552 RETFKAAQMFPSESKQKDDEENSWDFESFLETLLQNDVCLPKATHQKEFDTLSGKLEESP 611

Query: 503 IRDGYI--VSGAKVNL 544
            +DG +    G K++L
Sbjct: 612 DKDGLLKPTCGMKISL 627


>UniRef50_Q59YV6 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 1130

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 5/104 (4%)
 Frame = +2

Query: 185 ETIQDNIESNASCWQRAISHNLCYSKDDT-KDYD--VAAKSQLKKIQKIWVRENYKAMDK 355
           + I D+ ES  +  ++ +   L   KD+T K YD       +L+ + K+ + EN + +  
Sbjct: 186 QEITDHNESKVTNERKLLE--LQQLKDETEKKYDDQTVLYDKLQLVNKLQLEENEQYIKD 243

Query: 356 AKAEEENTEKRSQNLDEAKKILLQEDPSLP--KATVVKICETTE 481
             A+EE  E   + L E    L Q    L   KAT+V+I  TT+
Sbjct: 244 ITAKEEEIESLQKKLKEMNADLTQVTKDLKDSKATIVEIENTTK 287


>UniRef50_A0RV77 Cluster: Aspartyl/asparaginyl-tRNA synthetase; n=1;
           Cenarchaeum symbiosum|Rep: Aspartyl/asparaginyl-tRNA
           synthetase - Cenarchaeum symbiosum
          Length = 425

 Score = 34.3 bits (75), Expect = 4.1
 Identities = 22/48 (45%), Positives = 28/48 (58%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVV 654
           WV  LR  GK ++F+TLRD TG  Q V+ G L  + + L   T  SVV
Sbjct: 26  WVEDLRELGK-VSFVTLRDATGLAQIVVKGGLQASMDGL---TRQSVV 69


>UniRef50_Q8LMW4 Cluster: Putative uncharacterized protein
           OSJNBa0040E17.17; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0040E17.17 - Oryza sativa subsp. japonica (Rice)
          Length = 171

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = +2

Query: 296 SQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICET 475
           S++KK++K+WVR+  KA +     EE+ +      D AK I  Q + +   A  V I   
Sbjct: 92  SKVKKVKKVWVRKEVKAPEVVAINEESQDVHVPTGDAAKTI--QAEKTKADAIAVDIGCL 149

Query: 476 TE 481
           TE
Sbjct: 150 TE 151


>UniRef50_A6MD06 Cluster: UBX domain-containing protein; n=1; Oryza
           brachyantha|Rep: UBX domain-containing protein - Oryza
           brachyantha
          Length = 600

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = +2

Query: 263 DDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSL 442
           D  K+     +++L+++++   RE   A++K K EEE   K+    +E +  L  +  SL
Sbjct: 452 DQEKELKAQQEAELRRLEETAARE--AALEKLKQEEEERRKKQLEEEELESSLASKQASL 509

Query: 443 PKATVV 460
           P    V
Sbjct: 510 PSEPAV 515


>UniRef50_A2F8N3 Cluster: Viral A-type inclusion protein, putative;
            n=1; Trichomonas vaginalis G3|Rep: Viral A-type inclusion
            protein, putative - Trichomonas vaginalis G3
          Length = 1513

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 21/74 (28%), Positives = 38/74 (51%)
 Frame = +2

Query: 260  KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
            K D++  +   KS++ KI + +  +  K   + +    + EK+   L+EAKK LL+ D  
Sbjct: 923  KVDSEKAETDRKSEIAKINEDFEIKFDKLKKQLEEANNSLEKKENELEEAKKALLRNDTE 982

Query: 440  LPKATVVKICETTE 481
              KA   K+ + +E
Sbjct: 983  -QKAEFAKLSKMSE 995


>UniRef50_Q5A2Z9 Cluster: Putative uncharacterized protein MUB1;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein MUB1 - Candida albicans (Yeast)
          Length = 733

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 3/90 (3%)
 Frame = +2

Query: 164 YR*WYERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKK---IQKIWVRE 334
           Y    E E+I D+ E   + +Q     N C   +  K  D    ++LK    ++K W  E
Sbjct: 567 YESMVECESISDDSEREVALFQIYNKMNKCIEVESRKLKDTIIGARLKTKRYLEKKWNYE 626

Query: 335 NYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
            YK  D     +E+ E +  +L E KK+ L
Sbjct: 627 EYKYFD----IDEHNEDKDDSLTEYKKVSL 652


>UniRef50_UPI00006CC0AF Cluster: hypothetical protein
           TTHERM_00217190; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00217190 - Tetrahymena
           thermophila SB210
          Length = 315

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
           KD  K+Y +  K  +K IQK W  + Y+   K         K+ QN+ EA K +L
Sbjct: 258 KDTKKEY-IILKKDVKAIQKKWDCQAYRFTLKTTRRLYRASKKKQNVTEALKAVL 311


>UniRef50_UPI000049A0EC Cluster: hypothetical protein 20.t00044;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 20.t00044 - Entamoeba histolytica HM-1:IMSS
          Length = 486

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 25/92 (27%), Positives = 46/92 (50%)
 Frame = +2

Query: 182 RETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAK 361
           R T +DNI  +    +R+++ N   +K   K    A +  LKK +K+ V+E  K + K+ 
Sbjct: 230 RATKKDNIAVDIDKKERSVAVNKAVNKQLKKVLTPAQQESLKKTKKV-VQEAQKEIKKSD 288

Query: 362 AEEENTEKRSQNLDEAKKILLQEDPSLPKATV 457
            E++   K    + EAKK + ++   L +  +
Sbjct: 289 EEQKQLNK----VKEAKKKIQKQKDELVRQNI 316


>UniRef50_Q8XNH3 Cluster: DNA polymerase III, subunit alpha; n=5;
            Clostridium|Rep: DNA polymerase III, subunit alpha -
            Clostridium perfringens
          Length = 1192

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +1

Query: 520  RLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKL 669
            ++ R    +AF  + D TGYL+CV+     +  NALV + +S V++ G++
Sbjct: 1045 KVTRNNTLMAFAKVEDLTGYLECVIFPKTLEKCNALV-NEDSFVLIRGRV 1093


>UniRef50_Q54MI3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1278

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 17/91 (18%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = +2

Query: 179 ERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLK-KIQKIWVRENYKAMDK 355
           E++  Q NIE      Q  +   +     +     +  + +++ +I+K   +EN + +++
Sbjct: 214 EKDENQPNIEEKGKEKQNLLEKGIENENQNENQIQIEKEKEIEIEIEKEKEKENKELIEE 273

Query: 356 AKAEEENTEKRSQNLDEAKKILLQEDPSLPK 448
           +K E++N +K ++       + + E+P  P+
Sbjct: 274 SKTEKDNQQKENKENTNEINVTVVEEPEQPQ 304


>UniRef50_A7TFQ2 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 477

 Score = 33.5 bits (73), Expect = 7.2
 Identities = 23/89 (25%), Positives = 44/89 (49%)
 Frame = +2

Query: 200 NIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENT 379
           NI +    W   I +   Y K+ TK  +    ++  + +KI +       D+ + E++N 
Sbjct: 281 NIGARGKLWLETIGYIKLYQKE-TKTSESTEPTEKIENEKIGID------DEKEREDKNE 333

Query: 380 EKRSQNLDEAKKILLQEDPSLPKATVVKI 466
           ++   + +E KK+  +ED SL K T +K+
Sbjct: 334 DEAKADNNEEKKLETKEDDSLYKDTPIKL 362


>UniRef50_UPI0000F2BC3E Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 549

 Score = 33.1 bits (72), Expect = 9.5
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 305 KKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           K  ++IW RE Y+A +K K +EE  +K     +E KK  ++E+
Sbjct: 465 KDPERIW-REAYEAEEKRKQQEETKKKMEAEDEEEKKYAVEEE 506


>UniRef50_UPI00006CB631 Cluster: hypothetical protein
           TTHERM_00444580; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00444580 - Tetrahymena
           thermophila SB210
          Length = 1127

 Score = 33.1 bits (72), Expect = 9.5
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = +2

Query: 296 SQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           SQLK+IQ  + +  Y   D A+   +N  K+  N+D  K IL Q+D
Sbjct: 326 SQLKQIQNRFKKHRYSNQDLAQQMNKNLSKKQLNID-IKYILKQQD 370


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 876,631,776
Number of Sequences: 1657284
Number of extensions: 18305955
Number of successful extensions: 52486
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 49632
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52412
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 78292544701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -