SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...    37   0.59 
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...    37   0.59 
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...    37   0.59 
UniRef50_Q55E25 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_Q2QX80 Cluster: Citrate binding protein, putative; n=3;...    34   4.2  
UniRef50_Q0EWX1 Cluster: Putative uncharacterized protein; n=1; ...    34   5.5  
UniRef50_Q872V2 Cluster: Putative uncharacterized protein B23G1....    34   5.5  
UniRef50_Q73SN9 Cluster: Putative uncharacterized protein; n=2; ...    33   7.3  
UniRef50_A5P592 Cluster: Putative uncharacterized protein precur...    33   9.7  
UniRef50_Q5KCS3 Cluster: Mitochondrial outer membrane protein, p...    33   9.7  

>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 25/42 (59%), Positives = 25/42 (59%)
 Frame = +3

Query: 642 APSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           A SESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 60  ALSESYY-GLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 99


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score = 37.1 bits (82), Expect = 0.59
 Identities = 19/32 (59%), Positives = 19/32 (59%)
 Frame = +3

Query: 672 AVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  AVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 53


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score = 37.1 bits (82), Expect = 0.59
 Identities = 19/32 (59%), Positives = 19/32 (59%)
 Frame = +3

Query: 672 AVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  AVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 57


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score = 37.1 bits (82), Expect = 0.59
 Identities = 19/32 (59%), Positives = 19/32 (59%)
 Frame = +3

Query: 672 AVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           AV LQRRDWENPG    L  L AH PF    N
Sbjct: 9   AVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 39


>UniRef50_Q55E25 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 733

 Score = 34.7 bits (76), Expect = 3.2
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTP-IRPNNSTLTAMAVGDLFDCNRIKL 157
           P T    P TA  PP TT    PP  P I    +T TA A     D N I++
Sbjct: 557 PTTTATPPPTATTPPPTTATTTPPPPPIIATTKTTATATATTIPIDLNEIQI 608


>UniRef50_Q2QX80 Cluster: Citrate binding protein, putative; n=3;
           Oryza sativa|Rep: Citrate binding protein, putative -
           Oryza sativa subsp. japonica (Rice)
          Length = 237

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 633 TQFAPSESYYIPWAVXLQRRDWEN 704
           T   PSESYY  + V +Q RDW N
Sbjct: 198 TNVIPSESYYFKFGVYMQHRDWSN 221


>UniRef50_Q0EWX1 Cluster: Putative uncharacterized protein; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Putative
           uncharacterized protein - Mariprofundus ferrooxydans
           PV-1
          Length = 1023

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +1

Query: 625 GPVPNSPLVSRITFPGPSXYNVVTGKTPGVT 717
           GP P   LVS  T+PGP  +  +TGK  G++
Sbjct: 349 GPEPRKSLVSIYTYPGPGKHRELTGKDVGLS 379


>UniRef50_Q872V2 Cluster: Putative uncharacterized protein
           B23G1.020; n=2; Sordariomycetes|Rep: Putative
           uncharacterized protein B23G1.020 - Neurospora crassa
          Length = 434

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +2

Query: 2   TPVTEQQSPHTAALPPRTTRIHNPPTTPIRPNNSTLTAMAVGDLFDCNRIKLTSL 166
           T  T+Q  P ++   P TT    PPTT  +P+  T T++ +       R K+T +
Sbjct: 86  TSTTQQPPPISSTTAPPTTSTPAPPTTTQQPSTETFTSVQIITTEGETRTKITQI 140


>UniRef50_Q73SN9 Cluster: Putative uncharacterized protein; n=2;
           Mycobacterium avium|Rep: Putative uncharacterized
           protein - Mycobacterium paratuberculosis
          Length = 559

 Score = 33.5 bits (73), Expect = 7.3
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRPNNSTLTAMA 121
           P T  Q P T   PP TT  H PPTT  +P ++  T  A
Sbjct: 494 PTTTYQPPTTTYQPPTTT--HEPPTTTYQPPSTRATTEA 530


>UniRef50_A5P592 Cluster: Putative uncharacterized protein
           precursor; n=3; Alphaproteobacteria|Rep: Putative
           uncharacterized protein precursor - Methylobacterium sp.
           4-46
          Length = 481

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = -3

Query: 747 GXVPARRLKWGNARGFPSHDVVXRRPRECNTTH*GRIGY-RAPP 619
           G  PAR   WG   G+P  D    R R  +  + GR GY R PP
Sbjct: 22  GAGPARAQWWGGDEGYPRQDPYGARSRGYDDGYGGRQGYARRPP 65


>UniRef50_Q5KCS3 Cluster: Mitochondrial outer membrane protein,
           putative; n=1; Filobasidiella neoformans|Rep:
           Mitochondrial outer membrane protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 475

 Score = 33.1 bits (72), Expect = 9.7
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 4/37 (10%)
 Frame = +2

Query: 2   TPVTEQQSPHTAAL--PPRTTRIHNPPTTPI--RPNN 100
           T   + Q PH+ +   PPR + +HNPP TP+  RP++
Sbjct: 400 TYTLDPQIPHSVSYRHPPRGSHVHNPPETPVPQRPSH 436


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 737,633,141
Number of Sequences: 1657284
Number of extensions: 13150605
Number of successful extensions: 28976
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 27312
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28913
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79522270534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -