SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   182   1e-44
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   181   2e-44
UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   177   4e-43
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   175   9e-43
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   160   5e-38
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   153   7e-36
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   139   7e-32
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   134   4e-30
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   130   3e-29
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   126   7e-28
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   126   7e-28
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   126   7e-28
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   124   4e-27
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   123   7e-27
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   122   2e-26
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   122   2e-26
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   120   5e-26
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   120   5e-26
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   118   2e-25
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   118   2e-25
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...   112   9e-24
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   112   9e-24
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   111   2e-23
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...   111   3e-23
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...   110   5e-23
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   108   2e-22
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   106   6e-22
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   103   4e-21
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   103   4e-21
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...   101   2e-20
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   100   9e-20
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    99   1e-19
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...    99   1e-19
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...    99   1e-19
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...    98   2e-19
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...    98   3e-19
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    97   5e-19
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...    96   9e-19
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    96   9e-19
UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC 50318...    96   1e-18
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...    96   1e-18
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...    96   1e-18
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    95   2e-18
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    95   2e-18
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    94   4e-18
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    94   4e-18
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...    94   4e-18
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...    94   5e-18
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    94   5e-18
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    94   5e-18
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    94   5e-18
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    92   1e-17
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    92   1e-17
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    92   2e-17
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    92   2e-17
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    91   2e-17
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    90   6e-17
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    90   8e-17
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    89   1e-16
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    89   1e-16
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    89   2e-16
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    87   7e-16
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    86   9e-16
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    86   1e-15
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    85   2e-15
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    85   3e-15
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    84   5e-15
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    84   5e-15
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    83   1e-14
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    82   2e-14
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    80   6e-14
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    79   1e-13
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    78   2e-13
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    78   2e-13
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    77   6e-13
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    76   1e-12
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    75   2e-12
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    75   2e-12
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    73   7e-12
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    73   7e-12
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    73   9e-12
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    73   9e-12
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    73   1e-11
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    73   1e-11
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    73   1e-11
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    70   7e-11
UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmi...    69   2e-10
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    69   2e-10
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    68   3e-10
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    67   6e-10
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    66   1e-09
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    64   3e-09
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    64   3e-09
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    64   6e-09
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    63   7e-09
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    62   2e-08
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    62   2e-08
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    61   3e-08
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    60   9e-08
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    58   2e-07
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    58   3e-07
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    58   4e-07
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...    57   5e-07
UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta...    57   7e-07
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    57   7e-07
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    57   7e-07
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    56   1e-06
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    56   1e-06
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    56   1e-06
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    56   2e-06
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    56   2e-06
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    56   2e-06
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    55   2e-06
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    55   3e-06
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    55   3e-06
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    54   3e-06
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3 actin...    54   5e-06
UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza sativa...    54   5e-06
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    54   6e-06
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...    53   1e-05
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    52   1e-05
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    52   2e-05
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    52   2e-05
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    52   2e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   2e-05
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    52   2e-05
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    52   2e-05
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    51   3e-05
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    51   3e-05
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    50   6e-05
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    50   1e-04
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    50   1e-04
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...    50   1e-04
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    49   1e-04
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    49   2e-04
UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella ve...    49   2e-04
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    41   4e-04
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    47   5e-04
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    47   7e-04
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    47   7e-04
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    46   0.001
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   0.001
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    46   0.002
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    45   0.002
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    45   0.002
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    45   0.003
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    45   0.003
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    44   0.004
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    44   0.004
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    44   0.004
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    44   0.005
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    44   0.005
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.006
UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit (A...    44   0.006
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    44   0.006
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    43   0.009
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...    43   0.011
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    43   0.011
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    43   0.011
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    42   0.020
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    42   0.020
UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.020
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    42   0.020
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.026
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    42   0.026
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    41   0.035
UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23; Magnolio...    41   0.035
UniRef50_O94241 Cluster: Actin-like protein arp6; n=1; Schizosac...    41   0.035
UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1; ...    40   0.060
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    40   0.060
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    40   0.060
UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4; Tryp...    40   0.080
UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Ac...    40   0.11 
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    40   0.11 
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.11 
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2; ...    40   0.11 
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    40   0.11 
UniRef50_A4T104 Cluster: Conserved hypothetical proline rich pro...    39   0.14 
UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2; ...    39   0.18 
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    39   0.18 
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    39   0.18 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.18 
UniRef50_UPI0000E48649 Cluster: PREDICTED: similar to hyalin; n=...    38   0.24 
UniRef50_UPI0000660530 Cluster: Serine/threonine-protein kinase ...    38   0.24 
UniRef50_Q4JK70 Cluster: Group 15 allergen protein; n=3; Dermato...    38   0.24 
UniRef50_Q0V4N1 Cluster: Predicted protein; n=1; Phaeosphaeria n...    38   0.24 
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    38   0.24 
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    38   0.24 
UniRef50_UPI0000E817D4 Cluster: PREDICTED: similar to glycoprote...    38   0.32 
UniRef50_UPI000065CAA6 Cluster: Homolog of Gallus gallus "Ovomuc...    38   0.32 
UniRef50_Q196W0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.32 
UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;...    38   0.32 
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    38   0.32 
UniRef50_A7F4E6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.32 
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.42 
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    38   0.43 
UniRef50_UPI0000F30951 Cluster: UPI0000F30951 related cluster; n...    38   0.43 
UniRef50_Q7U3X4 Cluster: Putative uncharacterized protein; n=1; ...    38   0.43 
UniRef50_A7RGS9 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.43 
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    38   0.43 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.43 
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    37   0.56 
UniRef50_A6W8W6 Cluster: DNA polymerase III, beta subunit; n=1; ...    37   0.56 
UniRef50_Q54D31 Cluster: Putative uncharacterized protein; n=1; ...    37   0.56 
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...    37   0.56 
UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n...    37   0.56 
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    37   0.56 
UniRef50_Q2JP36 Cluster: Protein kinase; n=2; Synechococcus|Rep:...    37   0.74 
UniRef50_Q3DVE9 Cluster: Putative Ig; n=2; cellular organisms|Re...    37   0.74 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.74 
UniRef50_Q0UPJ7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.74 
UniRef50_O10341 Cluster: Uncharacterized 29.3 kDa protein; n=7; ...    37   0.74 
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    37   0.74 
UniRef50_A4X4V1 Cluster: Putative uncharacterized protein; n=1; ...    36   0.98 
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    36   0.98 
UniRef50_UPI0000EBC3B8 Cluster: PREDICTED: hypothetical protein,...    36   1.3  
UniRef50_A7H9N7 Cluster: Heavy metal translocating P-type ATPase...    36   1.3  
UniRef50_A4XIG4 Cluster: Type 3a, cellulose-binding domain prote...    36   1.3  
UniRef50_A4XC59 Cluster: NLP/P60 protein precursor; n=2; Salinis...    36   1.3  
UniRef50_Q54CA1 Cluster: Putative uncharacterized protein; n=2; ...    36   1.3  
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    36   1.3  
UniRef50_Q4WZL9 Cluster: Ubiquitin conjugating enzyme (UbcF), pu...    36   1.3  
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_UPI0001553895 Cluster: PREDICTED: similar to C6orf205 p...    36   1.7  
UniRef50_UPI0000E45E2F Cluster: PREDICTED: hypothetical protein;...    36   1.7  
UniRef50_Q605T0 Cluster: Putative uncharacterized protein; n=2; ...    36   1.7  
UniRef50_Q2J4M7 Cluster: Putative uncharacterized protein; n=3; ...    36   1.7  
UniRef50_A6W8I7 Cluster: ABC transporter CydDC cysteine exporter...    36   1.7  
UniRef50_A0G3S3 Cluster: Putative uncharacterized protein precur...    36   1.7  
UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    36   1.7  
UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas ...    36   1.7  
UniRef50_Q8WWQ4 Cluster: Mucin 5; n=5; Catarrhini|Rep: Mucin 5 -...    36   1.7  
UniRef50_Q4P3I7 Cluster: Putative uncharacterized protein; n=1; ...    36   1.7  
UniRef50_UPI0000EBC89F Cluster: PREDICTED: similar to Complement...    35   2.3  
UniRef50_UPI0000E49F3E Cluster: PREDICTED: similar to HLA-B-asso...    35   2.3  
UniRef50_Q4SLF6 Cluster: Chromosome 7 SCAF14557, whole genome sh...    35   2.3  
UniRef50_Q9FC63 Cluster: Putative acyltransferase; n=1; Streptom...    35   2.3  
UniRef50_Q9RFX5 Cluster: Multidomain beta-1,4-mannanase precurso...    35   2.3  
UniRef50_A5CQA6 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_Q6YVF6 Cluster: Putative uncharacterized protein P0758B...    35   2.3  
UniRef50_Q2HGF8 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_A4WK20 Cluster: Metallophosphoesterase precursor; n=4; ...    35   2.3  
UniRef50_A5V249 Cluster: Integrin alpha beta-propellor repeat pr...    35   3.0  
UniRef50_A5USV4 Cluster: Putative uncharacterized protein; n=2; ...    35   3.0  
UniRef50_A4AYB3 Cluster: Guanine deaminase; n=2; Alteromonadales...    35   3.0  
UniRef50_Q39492 Cluster: WP6 protein precursor; n=1; Chlamydomon...    35   3.0  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   3.0  
UniRef50_Q55DV2 Cluster: Putative transmembrane protein; n=1; Di...    35   3.0  
UniRef50_Q4Q2G7 Cluster: Actin-like protein, putative; n=3; Leis...    35   3.0  
UniRef50_A6RMM1 Cluster: Predicted protein; n=1; Botryotinia fuc...    35   3.0  
UniRef50_P08640 Cluster: Mucin-like protein 1 precursor; n=6; Sa...    35   3.0  
UniRef50_Q4SE61 Cluster: Chromosome undetermined SCAF14625, whol...    34   4.0  
UniRef50_Q2JXI7 Cluster: Putative lipoprotein; n=1; Synechococcu...    34   4.0  
UniRef50_A3DIC9 Cluster: S-layer-like domain containing protein;...    34   4.0  
UniRef50_A0QRP2 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_A0LSH8 Cluster: Glycoside hydrolase, family 6 precursor...    34   4.0  
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...    34   4.0  
UniRef50_Q9VZ49 Cluster: CG2145-PA; n=4; Diptera|Rep: CG2145-PA ...    34   4.0  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   4.0  
UniRef50_Q54SZ6 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_A7SXP8 Cluster: Predicted protein; n=1; Nematostella ve...    34   4.0  
UniRef50_A2GVH9 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_Q0U3J5 Cluster: Predicted protein; n=1; Phaeosphaeria n...    34   4.0  
UniRef50_A6RMP4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_Q5NW24 Cluster: Alkaline serine protease; n=2; Archaea|...    34   4.0  
UniRef50_O35930 Cluster: Platelet glycoprotein Ib alpha chain pr...    34   4.0  
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    34   5.3  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    34   5.3  
UniRef50_UPI00005A5159 Cluster: PREDICTED: hypothetical protein ...    34   5.3  
UniRef50_Q9PCD0 Cluster: Serine protease; n=22; cellular organis...    34   5.3  
UniRef50_Q988W7 Cluster: Mlr6562 protein; n=2; cellular organism...    34   5.3  
UniRef50_Q2JQ30 Cluster: Putative uncharacterized protein; n=2; ...    34   5.3  
UniRef50_Q0RHG8 Cluster: Putative serine/threonine protein kinas...    34   5.3  
UniRef50_A1UP46 Cluster: Gluconate transporter; n=9; Bacteria|Re...    34   5.3  
UniRef50_A0LWJ5 Cluster: Chitinase precursor; n=2; Actinomycetal...    34   5.3  
UniRef50_Q9ZRH9 Cluster: Early embryogenesis protein; n=6; Oryza...    34   5.3  
UniRef50_O22017 Cluster: HepC protein; n=1; Cylindrotheca fusifo...    34   5.3  
UniRef50_A7QSW1 Cluster: Chromosome undetermined scaffold_163, w...    34   5.3  
UniRef50_Q75JG6 Cluster: Similar to Leishmania major. Ppg3; n=2;...    34   5.3  
UniRef50_Q54WQ8 Cluster: Putative uncharacterized protein; n=2; ...    34   5.3  
UniRef50_Q4SZ13 Cluster: Chromosome 2 SCAF11863, whole genome sh...    33   6.9  
UniRef50_Q3E0G9 Cluster: Ig-like, group 1; n=1; Chloroflexus aur...    33   6.9  
UniRef50_Q06WK5 Cluster: Dermatan-binding protein PA5541; n=4; P...    33   6.9  
UniRef50_A7HC17 Cluster: WD40 domain protein beta Propeller; n=1...    33   6.9  
UniRef50_A5UV57 Cluster: Putative uncharacterized protein precur...    33   6.9  
UniRef50_A3DJL9 Cluster: Pectate lyase/Amb allergen precursor; n...    33   6.9  
UniRef50_A0LSI1 Cluster: Cellulose-binding, family II precursor;...    33   6.9  
UniRef50_O65153 Cluster: Zygote-specific lectin-like protein; n=...    33   6.9  
UniRef50_A7R0E9 Cluster: Chromosome undetermined scaffold_306, w...    33   6.9  
UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lambli...    33   6.9  
UniRef50_Q61Q33 Cluster: Putative uncharacterized protein CBG072...    33   6.9  
UniRef50_Q55CH1 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   6.9  
UniRef50_A2EKB2 Cluster: Serine/threonine-protein kinase C, puta...    33   6.9  
UniRef50_Q9HBK7 Cluster: NPD007; n=3; Eutheria|Rep: NPD007 - Hom...    33   6.9  
UniRef50_A2QIG5 Cluster: Remark: the blastp hits are due to the ...    33   6.9  
UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_P59797 Cluster: Selenoprotein V; n=6; Eutheria|Rep: Sel...    33   6.9  
UniRef50_Q02817 Cluster: Mucin-2 precursor; n=56; cellular organ...    33   6.9  
UniRef50_P16237 Cluster: 3-hydroxy-3-methylglutaryl-coenzyme A r...    33   6.9  
UniRef50_P22534 Cluster: Endoglucanase A precursor; n=38; cellul...    33   6.9  
UniRef50_Q5K767 Cluster: Enhancer of polycomb-like protein 1; n=...    33   6.9  
UniRef50_Q01108 Cluster: Bialaphos biosynthetic pathway regulato...    33   6.9  
UniRef50_O15254 Cluster: Acyl-coenzyme A oxidase 3, peroxisomal;...    33   6.9  
UniRef50_UPI00015B8D7F Cluster: UPI00015B8D7F related cluster; n...    33   9.2  
UniRef50_UPI000155C72E Cluster: PREDICTED: similar to hCG1811042...    33   9.2  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   9.2  
UniRef50_Q8YUE0 Cluster: Serine/threonine kinase; n=4; Nostocace...    33   9.2  
UniRef50_Q67PP1 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_Q0S0X8 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_Q098R9 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_A1GAK7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_A0LTI3 Cluster: Glycoside hydrolase, family 9; n=1; Aci...    33   9.2  
UniRef50_Q6L4H6 Cluster: Putative uncharacterized protein OSJNBa...    33   9.2  
UniRef50_Q336N6 Cluster: Poly polymerase catalytic domain contai...    33   9.2  
UniRef50_A7E2Y9 Cluster: TRIF protein; n=3; Bos taurus|Rep: TRIF...    33   9.2  
UniRef50_Q8SY38 Cluster: LD32741p; n=1; Drosophila melanogaster|...    33   9.2  
UniRef50_Q61GF0 Cluster: Putative uncharacterized protein CBG112...    33   9.2  
UniRef50_Q55AJ1 Cluster: Putative uncharacterized protein; n=2; ...    33   9.2  
UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    33   9.2  
UniRef50_Q1JTK6 Cluster: Putative uncharacterized protein precur...    33   9.2  
UniRef50_A7BG18 Cluster: Merozoite surface protein-1; n=16; Plas...    33   9.2  
UniRef50_Q9H5G9 Cluster: CDNA: FLJ23447 fis, clone HSI03346; n=2...    33   9.2  
UniRef50_Q8WWQ5 Cluster: Mucin 5; n=17; root|Rep: Mucin 5 - Homo...    33   9.2  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   9.2  
UniRef50_Q6CAQ5 Cluster: Similar to tr|Q9P7X2 Schizosaccharomyce...    33   9.2  
UniRef50_Q5KMC9 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_Q4WD71 Cluster: MFS allantoate transporter, putative; n...    33   9.2  
UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_Q2GW41 Cluster: Predicted protein; n=1; Chaetomium glob...    33   9.2  
UniRef50_Q0CIK7 Cluster: Predicted protein; n=1; Aspergillus ter...    33   9.2  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_A4RND4 Cluster: Putative uncharacterized protein; n=2; ...    33   9.2  
UniRef50_P10474 Cluster: Endoglucanase/exoglucanase B precursor ...    33   9.2  

>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  182 bits (442), Expect = 1e-44
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 40  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 99

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 100 KMTQIMFETFNVPAMYVAIQAVLSL 124



 Score =  121 bits (292), Expect = 2e-26
 Identities = 62/78 (79%), Positives = 63/78 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD LMKILTERGY F T
Sbjct: 125 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYMFTT 184

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 185 TAEREIVR-DMKEKLAYV 201



 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 37/43 (86%), Positives = 40/43 (93%)
 Frame = +1

Query: 139 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GDE ++K
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSK 43


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  181 bits (441), Expect = 2e-44
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 61  AQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 120

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 121 KMTQIMFETFNVPAMYVAIQAVLSL 145



 Score =  120 bits (289), Expect = 5e-26
 Identities = 60/78 (76%), Positives = 63/78 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI+RLD +   LTD LM IL ERGY+F T
Sbjct: 146 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTDNLMTILMERGYNFTT 205

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 206 TAEREIVR-DIKEKLCYV 222



 Score =  113 bits (271), Expect = 7e-24
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDE ++K
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64


>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  177 bits (430), Expect = 4e-43
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETF  PA+YVAIQAVLSL
Sbjct: 119 KMTQIMFETFAAPAVYVAIQAVLSL 143



 Score =  129 bits (312), Expect = 8e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGVSHTVPIYEGYALPHAILR+D +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVSHTVPIYEGYALPHAILRMDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  121 bits (291), Expect = 3e-26
 Identities = 53/62 (85%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDE +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  175 bits (427), Expect = 9e-43
 Identities = 78/85 (91%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ+KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK NRE
Sbjct: 58  AQNKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETF+ PAMYV+IQA+LSL
Sbjct: 118 KMTQIMFETFDVPAMYVSIQAILSL 142



 Score =  111 bits (266), Expect = 3e-23
 Identities = 54/78 (69%), Positives = 61/78 (78%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGY LPHAI R+D +   LT ++MK  TERG++F T
Sbjct: 143 YASGRTTGIVLDSGDGVSHTVPIYEGYVLPHAINRIDMAGRDLTYHMMKWFTERGHTFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCY+
Sbjct: 203 TAEREIVR-DIKEKLCYI 219



 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 40/59 (67%), Positives = 47/59 (79%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGDE + K
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNK 61


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  160 bits (388), Expect = 5e-38
 Identities = 72/85 (84%), Positives = 78/85 (91%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK NRE
Sbjct: 60  AQVQRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM ++MFETF  PA+ VA+ AVLSL
Sbjct: 120 KMXRVMFETFGAPAVCVAVLAVLSL 144



 Score =  121 bits (292), Expect = 2e-26
 Identities = 60/78 (76%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTD+LMKILT+RGYSF T
Sbjct: 145 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTQRGYSFTT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A R I     KEKL Y+
Sbjct: 205 SAQRGIVR-DMKEKLAYI 221



 Score = 96.7 bits (230), Expect = 7e-19
 Identities = 43/55 (78%), Positives = 48/55 (87%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGDE
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDE 59


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  153 bits (370), Expect = 7e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+L++PI HGI T+WDD+E+IW HTFY ELR+ PEEHP+L+TE PLNPKANR+
Sbjct: 36  AQSKRGILSLRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQ 95

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPA Y AIQ+VLSL
Sbjct: 96  KMTQIMFETFNTPAFYTAIQSVLSL 120



 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 43/77 (55%), Positives = 57/77 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSG  V++TVP+YEG+ LP+++ +L    + +T+YLMKIL  + YSF T
Sbjct: 121 YASGRTTGIVVDSGYDVTYTVPVYEGHCLPYSVSKLALGGNHVTEYLMKILNNKSYSFTT 180

Query: 689 NAXREIRS*TFKEKLCY 739
           +A RE R    KE LCY
Sbjct: 181 SAERE-RVNYIKETLCY 196



 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 28/39 (71%), Positives = 32/39 (82%)
 Frame = +1

Query: 151 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGDE ++K
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSK 39


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  139 bits (337), Expect = 7e-32
 Identities = 63/83 (75%), Positives = 70/83 (84%)
 Frame = +3

Query: 261 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 440
           +KRG+L  KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE PLNPKANREK 
Sbjct: 132 AKRGVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKT 191

Query: 441 TQIMFETFNTPAMYVAIQAVLSL 509
            ++MFETF TPA Y+AIQA LSL
Sbjct: 192 IKVMFETFKTPATYIAIQAALSL 214



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 249
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M   G++D Y+G
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMT--GKQDVYIG 128



 Score = 38.3 bits (85), Expect = 0.24
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSH 565
           YASGRTTGIVLDSG GVS+
Sbjct: 215 YASGRTTGIVLDSGKGVSY 233


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  134 bits (323), Expect = 4e-30
 Identities = 55/85 (64%), Positives = 69/85 (81%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ  RG+L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLNP++NRE
Sbjct: 71  AQKNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNRE 130

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM Q+MFE FN P MY++IQAVL+L
Sbjct: 131 KMCQVMFEQFNVPCMYISIQAVLAL 155



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 37/79 (46%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL-MKILTERGYSFI 685
           YASGRTTG+V+DSGDGVSH VP+YEG+ALP +I R+D +   +T +L   I    G +  
Sbjct: 156 YASGRTTGVVVDSGDGVSHIVPVYEGFALPPSIQRMDVAGRDVTSHLSYNIRRMTGVALQ 215

Query: 686 TNAXREIRS*TFKEKLCYV 742
           ++A  E+     KE  C++
Sbjct: 216 SSAELEVVR-LMKESCCFI 233



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 22/39 (56%), Positives = 29/39 (74%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 222
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAG 48


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  130 bits (315), Expect = 3e-29
 Identities = 55/85 (64%), Positives = 69/85 (81%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL L +P++ G+V NWDDMEKIWHHT Y+ELRV PEEHP+L+T+ P   K +RE
Sbjct: 36  AQSKRGILKLMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHPILMTDTPFASKMDRE 95

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM QIMFETF+TP  YV + ++L+L
Sbjct: 96  KMAQIMFETFDTPKFYVTLGSLLAL 120



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 37/65 (56%), Positives = 48/65 (73%)
 Frame = +2

Query: 512 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITN 691
           ASGR +GIVL SG  V++TVPIYE   L HA+ +++     LTD+L+KI++ERGYSF T 
Sbjct: 122 ASGRRSGIVLQSGGSVTYTVPIYEEKPLLHALQKVEIGGMDLTDHLLKIMSERGYSFTTT 181

Query: 692 AXREI 706
           A REI
Sbjct: 182 AEREI 186



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 25/39 (64%), Positives = 31/39 (79%)
 Frame = +1

Query: 151 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGDE ++K
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSK 39


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  126 bits (304), Expect = 7e-28
 Identities = 52/78 (66%), Positives = 65/78 (83%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PKAN+EK+ ++MF
Sbjct: 109 LLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E+F  PA+YVAIQ +LSL
Sbjct: 169 ESFRVPALYVAIQDILSL 186



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 31/78 (39%), Positives = 49/78 (62%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           ++SGRT+G++++SGD +++ VPI  G  LP +I+ ++ +   L+  LMK L  +GYS  T
Sbjct: 187 FSSGRTSGLIVNSGDQMTYGVPIEGGDILPDSIMTMEVAGHDLSMALMKSLVNKGYSLCT 246

Query: 689 NAXREIRS*TFKEKLCYV 742
                +     KEKLCYV
Sbjct: 247 MVELNLVR-AIKEKLCYV 263



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+E
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNE 101


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  126 bits (304), Expect = 7e-28
 Identities = 56/85 (65%), Positives = 69/85 (81%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ  RG+L LK+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP  NR 
Sbjct: 52  AQHMRGVLALKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRR 110

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           +M +IMFE FN P  YVA+QAVLSL
Sbjct: 111 RMVEIMFECFNVPFTYVAMQAVLSL 135



 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 39/78 (50%), Positives = 53/78 (67%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGR+TG+V DSGDGVSH+VP+++G+ LPHA+ R   +   +T +L+K+L E+G    T
Sbjct: 136 YASGRSTGVVFDSGDGVSHSVPVFDGHYLPHAVQRFPLAGVDVTLHLIKLLQEQGVCMRT 195

Query: 689 NAXREIRS*TFKEKLCYV 742
            A  EI     KEK C V
Sbjct: 196 TAEVEIVR-EMKEKCCRV 212



 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 23/50 (46%), Positives = 37/50 (74%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G E
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHE 51


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  126 bits (304), Expect = 7e-28
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A  K  +L L+ PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+ NRE
Sbjct: 56  AVQKSDLLVLRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNRE 115

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           K  Q+MFETFN    Y+ +QAVL+L
Sbjct: 116 KKIQMMFETFNVSGFYLGMQAVLAL 140



 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 35/78 (44%), Positives = 50/78 (64%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           ++ G TTG+V D+G+GVS TVPIYE Y LPHAI+R   S + +T +L K L +RG +  +
Sbjct: 141 FSIGCTTGVVWDAGEGVSFTVPIYEAYGLPHAIMRSTISGADITKHLQKTLLDRGVNPES 200

Query: 689 NAXREIRS*TFKEKLCYV 742
               + +    KEK+C V
Sbjct: 201 IKLEDCK--VLKEKICSV 216



 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 27/50 (54%), Positives = 38/50 (76%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG E
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFE 55


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  124 bits (298), Expect = 4e-27
 Identities = 67/101 (66%), Positives = 72/101 (71%)
 Frame = +3

Query: 225 GTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 404
           G +    R  AQ K GILT KY IEHGIV NWDDME I HH FYN+L +APEE  +LLTE
Sbjct: 102 GQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILLTE 160

Query: 405 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
            PLN KA  E MTQIMFETFNTPAMY+AIQ VL L   V P
Sbjct: 161 IPLNLKAKGE-MTQIMFETFNTPAMYLAIQTVLFLYAVVTP 200


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  123 bits (296), Expect = 7e-27
 Identities = 53/85 (62%), Positives = 69/85 (81%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A   RG+L ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE PLNP++NR+
Sbjct: 61  AAELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPLNPRSNRD 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
              QI+FETFN PA++ +IQAVLSL
Sbjct: 120 TAAQILFETFNVPALHTSIQAVLSL 144



 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLD GDGVSH VP+Y+G+ +P++I R+D +   +T+++  +L + GY F T
Sbjct: 145 YASGRTTGVVLDVGDGVSHAVPVYQGFTVPNSIRRMDVAGRDVTEHMQTLLRKSGYVFHT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A +EI     KE   YV
Sbjct: 205 SAEKEIVR-MIKETTSYV 221



 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 24/55 (43%), Positives = 38/55 (69%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +  A+
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAE 63


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  122 bits (293), Expect = 2e-26
 Identities = 51/85 (60%), Positives = 66/85 (77%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ  R ILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP  NR 
Sbjct: 62  AQDNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRA 121

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM +I FETF  PA+YVA+Q +++L
Sbjct: 122 KMVEIFFETFQVPALYVALQGLMAL 146



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/78 (41%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+G++TG+VL+ GDGV+  +PIY+G  L  +I R DF+   +T+YL  +  E+G S + 
Sbjct: 147 YATGKSTGVVLECGDGVTAVIPIYQGRCLFQSISRSDFAGGDVTNYLAGLFLEKGISLMN 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              ++I +   KE+LCY+
Sbjct: 207 TGSKDIIT-DIKERLCYI 223



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG E
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQE 61


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  122 bits (293), Expect = 2e-26
 Identities = 52/85 (61%), Positives = 70/85 (82%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+L YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP ++RE
Sbjct: 62  AQSKRGILSLTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHRE 121

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM ++MFE+F  PA+YVA+Q + +L
Sbjct: 122 KMAELMFESFQVPALYVALQGLAAL 146



 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 41/81 (50%), Positives = 54/81 (66%)
 Frame = +2

Query: 500 ALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYS 679
           A  +A  RTTG+VLDSGDGV+ TVPI+ G  L   + RLDF+   +T YL ++L E G+S
Sbjct: 144 AALHACARTTGMVLDSGDGVTVTVPIHGGSCLLQGVTRLDFAGRGITKYLARLLMEIGHS 203

Query: 680 FITNAXREIRS*TFKEKLCYV 742
           F++   +EI     KEKLCYV
Sbjct: 204 FVSATEKEIVR-DMKEKLCYV 223



 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 30/54 (55%), Positives = 41/54 (75%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+E ++K
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSK 65


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  120 bits (289), Expect = 5e-26
 Identities = 50/84 (59%), Positives = 67/84 (79%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +
Sbjct: 57  QTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSR 116

Query: 438 MTQIMFETFNTPAMYVAIQAVLSL 509
           MTQI+FETFN PA+Y A QAVLSL
Sbjct: 117 MTQILFETFNFPALYTANQAVLSL 140



 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 26/54 (48%), Positives = 38/54 (70%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAE 55


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  120 bits (289), Expect = 5e-26
 Identities = 50/84 (59%), Positives = 67/84 (79%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +
Sbjct: 57  QTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSR 116

Query: 438 MTQIMFETFNTPAMYVAIQAVLSL 509
           MTQI+FETFN PA+Y A QAVLSL
Sbjct: 117 MTQILFETFNFPALYTANQAVLSL 140



 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 26/54 (48%), Positives = 38/54 (70%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAE 55



 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +2

Query: 512 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITN 691
           ASGRT+G  ++SGDG+++ VP+  GY L  +  +LD +   LT YLMK+L++ G    T 
Sbjct: 142 ASGRTSGTAIESGDGMTYFVPVMNGYPLHLSTTKLDIAGQDLTLYLMKLLSDNGNVLETI 201

Query: 692 AXRE-IRS*TFKEKLCYV 742
           A  E IR    K+K  YV
Sbjct: 202 ADLEYIRD--LKDKYSYV 217


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  118 bits (284), Expect = 2e-25
 Identities = 51/85 (60%), Positives = 66/85 (77%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ  RG+LTL+YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LNP  NR+
Sbjct: 75  AQHMRGVLTLRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQ 133

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           +M ++MFE F+ P  +VA+QAVL+L
Sbjct: 134 RMVELMFEAFSVPLTFVAVQAVLAL 158



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/78 (56%), Positives = 56/78 (71%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGVSH+VP++EGY LPHA+ RLD + + +T  L K+L E G    T
Sbjct: 159 YASGRTTGVVLDSGDGVSHSVPVFEGYCLPHAVQRLDLAGADVTLQLQKLLLESGVCLRT 218

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  EI     KE+ C+V
Sbjct: 219 SAELEIVR-EMKERCCFV 235



 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 24/50 (48%), Positives = 37/50 (74%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG +
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHD 74


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  118 bits (283), Expect = 2e-25
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score =  112 bits (270), Expect = 9e-24
 Identities = 50/82 (60%), Positives = 60/82 (73%)
 Frame = +2

Query: 248 EMSTEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPSPAH*GSPQPQGQ 427
           E   E+KR+PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P   G  QP+ Q
Sbjct: 20  ERGPEKKRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRGPSQPKSQ 79

Query: 428 QREDDPDHVRNIQHARHVRRHP 493
           QREDDPDHVR++Q  R+VRRHP
Sbjct: 80  QREDDPDHVRDVQCTRNVRRHP 101


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  112 bits (270), Expect = 9e-24
 Identities = 46/85 (54%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A  KRG+L   YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+PL P+  RE
Sbjct: 57  AYLKRGVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIRE 116

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           +  Q+MFETFN P++Y+AI A L L
Sbjct: 117 QTVQMMFETFNVPSLYMAISAALQL 141



 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 50/78 (64%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           ++ G+TTGIV D GD  +H VP+ +G+ +P    R+  +   LT ++ K+L ERGY+F +
Sbjct: 142 HSIGKTTGIVCDIGDSATHAVPVKDGFVIPDTSSRIQLAGKDLTSFMAKVLRERGYNFTS 201

Query: 689 NAXREIRS*TFKEKLCYV 742
           +   +I S   KEK+C+V
Sbjct: 202 SDELQIVS-DMKEKICFV 218



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 24/55 (43%), Positives = 38/55 (69%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G++
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGED 56


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  111 bits (267), Expect = 2e-23
 Identities = 51/81 (62%), Positives = 60/81 (74%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           R +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE P NP  NR+KM Q
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKMAQ 122

Query: 447 IMFETFNTPAMYVAIQAVLSL 509
           IMFETF  PA YVA  A+LSL
Sbjct: 123 IMFETFQIPAFYVANPALLSL 143



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 37/103 (35%), Positives = 61/103 (59%)
 Frame = +2

Query: 488 HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           +P+    Y+SGR +G V+++G GV+ T+ +YEGY L  A  R   +   +T YLM++L +
Sbjct: 137 NPALLSLYSSGRVSGFVIETGAGVTQTLAVYEGYCLEAATHRTGLAGREMTHYLMRLLNK 196

Query: 668 RGYSFITNAXREIRS*TFKEKLCYVGS*LSKQXIGXRLHSKXF 796
           +GYSF T A REI     KE+ CYV     ++    ++ ++ +
Sbjct: 197 KGYSFSTTAEREIVR-EIKERCCYVAEDFEREMARTQIRTERY 238



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV---DGKREAFIGE 57


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score =  111 bits (266), Expect = 3e-23
 Identities = 53/94 (56%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 PSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 380
           PSG  G    + ++  R     R I   K P+E  I+TNWD  EKIWHHT  NEL VAPE
Sbjct: 10  PSGVRGGRDRKTVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPE 69

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 482
           EHP L T+A  NPKANREKM Q MFE F+ PAMY
Sbjct: 70  EHPTLFTKAAWNPKANREKMAQXMFEPFSVPAMY 103


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score =  110 bits (264), Expect = 5e-23
 Identities = 56/84 (66%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 431
           AQSK+ +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE  LN K N 
Sbjct: 30  AQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTEVLLNLKVNH 89

Query: 432 EKMTQIMFETFNTPAMYVAIQAVL 503
           +KMTQ MFETF+TPA+ V+ Q++L
Sbjct: 90  DKMTQSMFETFSTPAI-VSSQSML 112


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  108 bits (260), Expect = 2e-22
 Identities = 56/74 (75%), Positives = 56/74 (75%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE                  MTQIMFETFN
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE------------------MTQIMFETFN 62

Query: 468 TPAMYVAIQAVLSL 509
           TPAMYVAIQAVLSL
Sbjct: 63  TPAMYVAIQAVLSL 76



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 139 AGFAGDDAPRAVFPSIVGRP 198
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  106 bits (255), Expect = 6e-22
 Identities = 46/74 (62%), Positives = 59/74 (79%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEAPLNP +NREKM + +FE+F 
Sbjct: 72  YPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNPISNREKMAETLFESFG 130

Query: 468 TPAMYVAIQAVLSL 509
            PA++V IQAVL+L
Sbjct: 131 VPALHVQIQAVLTL 144



 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 37/79 (46%), Positives = 56/79 (70%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILT-ERGYSFI 685
           Y+SGRT G+VLDSGDGV+H VP++EG  +P ++ RL+ +   LT+++M++L+ E    F 
Sbjct: 145 YSSGRTDGLVLDSGDGVTHLVPVFEGQTMPQSVRRLELAGRDLTEWMMELLSDELDRPFT 204

Query: 686 TNAXREIRS*TFKEKLCYV 742
           T+A RE+     KE LCY+
Sbjct: 205 TSADREVAR-RVKESLCYI 222



 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGDE
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDE 61


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  103 bits (248), Expect = 4e-21
 Identities = 44/85 (51%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ++RG+LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK N+E
Sbjct: 68  AQNRRGVLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNKE 126

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM +I FE F +P + +A QA L+L
Sbjct: 127 KMAEIFFEKFQSPGICLANQAALAL 151



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 4/54 (7%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDE 255
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+E
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEE 67



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 2/83 (2%)
 Frame = +2

Query: 500 ALA-YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK-ILTERG 673
           ALA ++ G+T G+++DSG GV+H VPI+    LP   L++D +   L + L   ++ E  
Sbjct: 148 ALALFSLGKTCGLIVDSGHGVTHVVPIHPENPLPPTTLQMDLAGGDLDEALFSHLVDEHK 207

Query: 674 YSFITNAXREIRS*TFKEKLCYV 742
           Y+       ++R    KEKLCYV
Sbjct: 208 YN---GRLTDLR--VVKEKLCYV 225


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  103 bits (248), Expect = 4e-21
 Identities = 40/83 (48%), Positives = 59/83 (71%)
 Frame = +3

Query: 261 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 440
           +K  ++ +  PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +  REK 
Sbjct: 58  TKSDLVDISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHAREKT 117

Query: 441 TQIMFETFNTPAMYVAIQAVLSL 509
            Q+ FETFN P  Y  +Q+V +L
Sbjct: 118 IQMFFETFNVPGYYSGVQSVFAL 140



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/52 (46%), Positives = 29/52 (55%)
 Frame = +2

Query: 518 GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           G TTGIV D G+G S  VP+YEGY  PHA+L+       LT +    L   G
Sbjct: 144 GLTTGIVWDGGEGYSSVVPVYEGYQQPHAVLQSPICGEVLTKFFTDKLNAAG 195



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+E
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNE 55


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score =  101 bits (242), Expect = 2e-20
 Identities = 44/64 (68%), Positives = 52/64 (81%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ KRG+L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  V  T+ P + KA+RE
Sbjct: 17  AQRKRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELLVFFTDVPKSTKASRE 76

Query: 435 KMTQ 446
           K TQ
Sbjct: 77  KTTQ 80


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score = 99.5 bits (237), Expect = 9e-20
 Identities = 42/85 (49%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           +  +RG+L L+YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP  ++ 
Sbjct: 63  SDEQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPINHKF 121

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           ++ Q  FE FN PA+++A+Q VLSL
Sbjct: 122 RVAQQFFENFNAPALFIAVQGVLSL 146



 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +ASG+TTG+V++ GDGVS  VP+++GY+L +A  R+D     +T++L  +L   GY F T
Sbjct: 147 FASGKTTGVVVEIGDGVSQIVPVFDGYSLQYAQQRIDLGGRDITEHLNLLLRRSGYFFHT 206

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  EI     KEK C+V
Sbjct: 207 SAEMEIIK-KIKEKKCFV 223



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGN 61


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 42/78 (53%), Positives = 56/78 (71%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E +N   +++ +QAVLSL
Sbjct: 126 EKYNFAGVFIQVQAVLSL 143



 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H VP+ +G++ PH   R++ +   +T YL+ +L+ RGY+   
Sbjct: 144 YAQGLLTGLVIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHITSYLVDLLSRRGYAMNK 203

Query: 689 NAXRE-IRS*TFKEKLCYV 742
           +A  E +R    KEKLCY+
Sbjct: 204 SADFETVRE--IKEKLCYL 220



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 42/78 (53%), Positives = 56/78 (71%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E +N   +++ +QAVLSL
Sbjct: 126 EKYNFAGVFIQVQAVLSL 143



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTV 571
           YA G  TG+V+DSGDGV+H +
Sbjct: 144 YAQGLLTGLVIDSGDGVTHVI 164


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 41/85 (48%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A   R  L + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE P+NPKANR+
Sbjct: 59  AAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQ 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM ++MFE +    +YVAIQAVL+L
Sbjct: 119 KMCEVMFEEYGFGGVYVAIQAVLTL 143



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 40/78 (51%), Positives = 53/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H VP+Y+G+ALPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 144 YAQGLQTGVVVDSGDGVTHIVPVYDGFALPHLTRRLDVAGRDVTRYLIKLLLMRGYAFER 203

Query: 689 NAXRE-IRS*TFKEKLCY 739
            A  E +R    KE LC+
Sbjct: 204 TADFETVRG--IKEALCF 219



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQ-KDSYVGDE 255
           LVVDNG+G  K G+AG + P  VFPSIVGRP       +G  Q KD  +GDE
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDE 58


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 40/73 (54%), Positives = 54/73 (73%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK +RE   Q+ FE+F  
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRELCCQLFFESFGV 134

Query: 471 PAMYVAIQAVLSL 509
           PA+Y+A  ++LS+
Sbjct: 135 PALYLATTSLLSM 147



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/49 (48%), Positives = 35/49 (71%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK 655
           Y S +T+G+VLD G+GV+H+V I+EG  +P+AI RLD     LT  ++K
Sbjct: 148 YGSSKTSGLVLDIGEGVAHSVLIHEGCIMPYAITRLDMGGFDLTSQIVK 196



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG 228
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNG 51


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score = 97.9 bits (233), Expect = 3e-19
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 124

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 125 EVMFENFGVPAFYLSDQAVLAL 146



 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 147 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 207 QLDKGLVD-DIKKKLCYV 223



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEE 61


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 97.1 bits (231), Expect = 5e-19
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FNTPAM++A Q+ LS+
Sbjct: 189 EAFNTPAMHIAYQSRLSM 206



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 38/91 (41%), Positives = 54/91 (59%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+  + SR   Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD++ S LT YL
Sbjct: 195 AMHIA-YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYL 253

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +L   G  F  +    +     K+K C+V
Sbjct: 254 LGLLNSAGNEFTQDQMGIVED--IKKKCCFV 282



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score = 96.3 bits (229), Expect = 9e-19
 Identities = 40/85 (47%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQ  R  L++ YP+E G++T+WDDME +W H +   L++ P + PVL+TE  LNP ANR+
Sbjct: 120 AQDWRSSLSISYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQ 179

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           ++ ++ FE    PA Y++IQAVL+L
Sbjct: 180 QIVEVFFEHLGVPAFYMSIQAVLAL 204



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD+
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQ 119


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 96.3 bits (229), Expect = 9e-19
 Identities = 40/76 (52%), Positives = 52/76 (68%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP  NRE   ++MFET
Sbjct: 67  LYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENREHTAEVMFET 126

Query: 462 FNTPAMYVAIQAVLSL 509
           F    +++A+Q  L+L
Sbjct: 127 FGVKQLHIAVQGALAL 142



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/82 (32%), Positives = 49/82 (59%)
 Frame = +2

Query: 518 GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAX 697
           G  TG+V+DSGDGV+H VPI +G+ + +AI  +  +   +T+++++ L ERG     +  
Sbjct: 158 GENTGVVVDSGDGVTHIVPIVDGFVMHNAIQHIPLAGRDITNFVLEWLRERGEPVPADDA 217

Query: 698 REIRS*TFKEKLCYVGS*LSKQ 763
             +     KEK CY+   ++++
Sbjct: 218 LYLAQ-HIKEKYCYIARNIARE 238



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGDE
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDE 57


>UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC
           50318|Rep: Actin-3 - Cercomonas sp. ATCC 50318
          Length = 266

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+      AL Y+SGRTTG+VLDSGDG+++TVPIY+GYA+P A LR+D S   +TD+L
Sbjct: 6   AVHISNSAMLAL-YSSGRTTGVVLDSGDGITYTVPIYDGYAIPQATLRMDLSGCDITDHL 64

Query: 650 MKILTERG-YSFITNAXREIRS*TFKEKL 733
           M+++T RG +SF T++ REI     KEKL
Sbjct: 65  MELITARGHHSFTTSSEREIVR-DIKEKL 92


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 39/74 (52%), Positives = 56/74 (75%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N K N+EKMTQIMFE F 
Sbjct: 63  YPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEKMTQIMFENFE 122

Query: 468 TPAMYVAIQAVLSL 509
            P ++++ Q VLSL
Sbjct: 123 VPFLHISNQTVLSL 136



 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 32/78 (41%), Positives = 47/78 (60%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+TTG++LDSG+G ++ VPIYEG+ L   + +LD + S  T+Y+ + L E      T
Sbjct: 137 YSLGKTTGVILDSGEGATYCVPIYEGFQLRQQLSKLDIAGSNCTNYMSQTLKEEFLKIYT 196

Query: 689 NAXREIRS*TFKEKLCYV 742
              R   +   KE LCYV
Sbjct: 197 PFQRNQIAKAIKESLCYV 214


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +3

Query: 189 GKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 368
           G+A    R  + G E L     AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 369 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLAL 141



 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LD +   LT+YLM ++   G   ++
Sbjct: 142 FAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLS 201

Query: 689 NAXREIRS*TFKEKLCYV 742
            + R+I     KE  CYV
Sbjct: 202 ASDRKIVE-DIKESFCYV 218



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQ 56


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 95.5 bits (227), Expect = 2e-18
 Identities = 40/75 (53%), Positives = 52/75 (69%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN   NRE + +IMFETF
Sbjct: 76  KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETF 135

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 136 NVPGLYIAVQAVLAL 150



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TGIV+DSGDGV+H +P+ EG+ +   I  +  +   +T ++ ++L ER          E 
Sbjct: 165 TGIVIDSGDGVTHAIPVAEGHVIGSCIKHIPIAGRDITYFIQQLLREREIGIPPEQSLET 224

Query: 707 RS*TFKEKLCYV 742
                KE+ CY+
Sbjct: 225 AK-AVKERYCYI 235


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 95.5 bits (227), Expect = 2e-18
 Identities = 40/81 (49%), Positives = 57/81 (70%)
 Frame = +3

Query: 270 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 449
           G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +I
Sbjct: 383 GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEI 442

Query: 450 MFETFNTPAMYVAIQAVLSLT 512
           MFETFN P +Y+++Q+VLSL+
Sbjct: 443 MFETFNVPGLYISVQSVLSLS 463



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           TG+V+D GDG  H VP+  GY +  +I    FS S +T +++++L ERG
Sbjct: 489 TGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERG 537


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 38/72 (52%), Positives = 53/72 (73%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E   N +A REK+T+IMFE ++ 
Sbjct: 86  PLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEPTYNTRAIREKVTEIMFEKYHA 145

Query: 471 PAMYVAIQAVLS 506
           PA+++A  AVLS
Sbjct: 146 PALFIAKNAVLS 157



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 17/55 (30%), Positives = 38/55 (69%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           ++AS + + +VLDSG G++   P++EG+ + + I++ + + +RLT+   +IL+ +
Sbjct: 158 SFASSKASSLVLDSGGGMTSVTPVFEGFVVKNGIVKSNLAGNRLTEEYYRILSSK 212



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/56 (39%), Positives = 40/56 (71%), Gaps = 1/56 (1%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDE 255
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  DS +G++
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTG--DSEMGEK 58


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 40/77 (51%), Positives = 53/77 (68%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 459 TFNTPAMYVAIQAVLSL 509
           TFN P +Y+A+QAVL+L
Sbjct: 133 TFNVPGLYIAVQAVLAL 149



 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 512 ASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           A  RT TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++  +L ER      
Sbjct: 158 AEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPP 217

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
               E      KEK CY+   ++K+
Sbjct: 218 EQSLETAK-AIKEKHCYICPDIAKE 241



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDE
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NR
Sbjct: 61  ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK+ ++MFET+    +YVAIQAVL+L
Sbjct: 121 EKIVEVMFETYQFSGVYVAIQAVLTL 146



 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 147 YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCYVG
Sbjct: 207 SADFETVR--MIKEKLCYVG 224



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDE
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE 60


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A+R+K+ QIMF
Sbjct: 67  LALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDKLLQIMF 125

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETFN P+ ++ +Q +L+L
Sbjct: 126 ETFNVPSTFLGVQGLLAL 143



 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 34/78 (43%), Positives = 48/78 (61%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+VL+SG G +H VP+++G+ +PHA L  +     L+ +LMK L    YSF +
Sbjct: 144 YACGLVTGVVLESGAGATHVVPVHQGFGIPHATLSQELGGHDLSHFLMKRLLGPMYSFCS 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A R++     KE LCYV
Sbjct: 204 LAQRQVIQ-DIKEDLCYV 220



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +1

Query: 97  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVG 32


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 41/76 (53%), Positives = 51/76 (67%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           L YPI HG V NWD ME+ W    +N LR  PE+H  LLTE+PL    +RE   +IMFET
Sbjct: 143 LSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYFLLTESPLTAPESREYTGEIMFET 202

Query: 462 FNTPAMYVAIQAVLSL 509
           FN P +Y+A+Q VL+L
Sbjct: 203 FNVPGLYIAVQPVLAL 218



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/77 (28%), Positives = 40/77 (51%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           +V+D GDG +H VP+ +GY +  +I  +  +   +T ++ +++ ERG         E+  
Sbjct: 279 VVVDVGDGATHVVPVADGYVIGSSIKSIPIAGKDVTLFVQQLMRERGEHVPPEDSFEVAR 338

Query: 713 *TFKEKLCYVGS*LSKQ 763
              KE  CY  S + K+
Sbjct: 339 -KVKEMYCYTSSDIVKE 354


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 46/78 (58%), Positives = 60/78 (76%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSG GVSHTVPIYEG A+ ++IL LD + + LTDY+MK+L+ERG SF T
Sbjct: 295 YASGRTTGIVIDSGGGVSHTVPIYEGKAMTNSILHLDLAGNDLTDYMMKMLSERGNSFST 354

Query: 689 NAXREIRS*TFKEKLCYV 742
            A R+     ++ ++ YV
Sbjct: 355 TA-RKRNCQRYQREIAYV 371



 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 35/60 (58%), Positives = 45/60 (75%)
 Frame = +3

Query: 330 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           +K W+H F ++L V+ ++HPV LTE P NPK N EKM Q MFE +  PAMYV+IQA+LSL
Sbjct: 235 KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMFECYGIPAMYVSIQAILSL 294


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 38/74 (51%), Positives = 53/74 (71%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP  NRE + +I FETFN
Sbjct: 80  YPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPPENRENIAEIFFETFN 139

Query: 468 TPAMYVAIQAVLSL 509
              +++++QAVLSL
Sbjct: 140 AKGLHISVQAVLSL 153



 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 30/110 (27%), Positives = 53/110 (48%)
 Frame = +2

Query: 410 PQPQGQQREDDPDHVRNIQHARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGY 589
           P    + RE+  +      +A+ +       L+  S   TG+VLDSGDGV+H +P+ +GY
Sbjct: 120 PMNPPENRENIAEIFFETFNAKGLHISVQAVLSLFSTGLTGMVLDSGDGVTHCIPVADGY 179

Query: 590 ALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCY 739
            +   I  +  +   +T ++  +L ERG +      +++     KEK  Y
Sbjct: 180 VIGSCIKHIPLAGRDITQFIQNLLKERGENIPAEDIKKVAR-EVKEKYGY 228


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 45/100 (45%), Positives = 62/100 (62%)
 Frame = +3

Query: 207 GRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 386
           G   + G   L   + A ++     L YPI++GIV NW+DMEK   +TFY +LRV P+ H
Sbjct: 34  GHPNKQGDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYH 93

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
            VLLTE  +N K NR KM +IMFET++ P++ +  Q  LS
Sbjct: 94  SVLLTETTMNTKENRNKMAEIMFETYDIPSIKIENQQKLS 133



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/77 (35%), Positives = 41/77 (53%)
 Frame = +2

Query: 512 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITN 691
           ++G   G ++D GD   + VP  +G  +  A++ LDF    LT YL  +L + GYSF T 
Sbjct: 138 STGTKNGTIVDMGDDSINIVPFVDGQPVTDAVVTLDFGGRNLTGYLAALLFQNGYSFSTV 197

Query: 692 AXREIRS*TFKEKLCYV 742
           A  +I     KEK  ++
Sbjct: 198 ADHQIVR-QIKEKHSFI 213



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 210
           +++D GSG  K GF G+  P     +IVG P  QG
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG 40


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 43/55 (78%), Positives = 46/55 (83%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG E  +K
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSK 55


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF  PAM+V  Q++LS+
Sbjct: 169 ETFGIPAMHVTSQSLLSI 186



 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+T+G+V++SG GVSH VPI EG  LP    R D++   LT+YLM++L E G++F  
Sbjct: 187 YSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTD 246

Query: 689 NAXREIRS*TFKEKLCY 739
           +    I     K+K CY
Sbjct: 247 DHLHIIEH--IKKKCCY 261



 Score = 37.5 bits (83), Expect = 0.43
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 39/82 (47%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+GIL + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P A RE+  
Sbjct: 63  KQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPAAQRERTL 122

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           +IM ETF+  ++Y+    VLSL
Sbjct: 123 EIMMETFHAHSLYLGTSQVLSL 144



 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
 Frame = +2

Query: 428 QREDDPDHVRNIQHARHVRRHPSRALA-YASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 604
           QRE   + +    HA  +    S+ L+ Y+ G TTG+V+DSG  V+H VPI+EGYAL   
Sbjct: 117 QRERTLEIMMETFHAHSLYLGTSQVLSLYSYGLTTGLVVDSGKDVTHAVPIHEGYALVRH 176

Query: 605 ILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +   + + LT YL  +L E+GY+  T   +E+ +   KE LCYV
Sbjct: 177 VTQSPVAGAALTRYLGGLLREQGYALGTATEQELLN-GAKEDLCYV 221



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+E
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEE 59


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 164 TGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 224 AK-AVKERYSYVCPDLVKE 241



 Score = 37.9 bits (84), Expect = 0.32
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDE
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDE 65


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 41/81 (50%), Positives = 55/81 (67%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           R  L L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLNPK NR+KM +
Sbjct: 62  RQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPKDNRKKMCE 121

Query: 447 IMFETFNTPAMYVAIQAVLSL 509
           I FE FN P + V  QA+L L
Sbjct: 122 IFFEQFNFPRLQVCPQALLVL 142



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 35/80 (43%), Positives = 52/80 (65%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H +PI E Y L H   R+D S   +T+ L+K+LT RGY+F  
Sbjct: 143 YAQGLMTGVVVDSGDGVTHIMPIAENYILSHLTGRMDISGRDVTEQLVKLLTLRGYTFHK 202

Query: 689 NAXREIRS*TFKEKLCYVGS 748
            +  ++     KE+LC++ +
Sbjct: 203 TSDFDVVR-EIKEQLCFISA 221


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 35/84 (41%), Positives = 64/84 (76%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           ++++  +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N K NRE+
Sbjct: 68  ETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRER 127

Query: 438 MTQIMFETFNTPAMYVAIQAVLSL 509
           +TQ++FET+N+    V  +A LSL
Sbjct: 128 LTQLLFETYNSKLASVTNRASLSL 151



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 29/76 (38%), Positives = 42/76 (55%)
 Frame = +2

Query: 515 SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNA 694
           SG+ + I+   G G S+TVPIY+G  +  A+  L    + L+++LM+ L  R Y F T  
Sbjct: 154 SGKESAIIAHCGFGESYTVPIYQGKIITKAMSHLPLGGNDLSNFLMEFLKNRDYKFNTYN 213

Query: 695 XREIRS*TFKEKLCYV 742
              I +   KEKL YV
Sbjct: 214 ENLIVN-DIKEKLGYV 228



 Score = 41.1 bits (92), Expect = 0.035
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = +1

Query: 88  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGMGQK 234
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   K
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNK 58


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 89.8 bits (213), Expect = 8e-17
 Identities = 38/78 (48%), Positives = 54/78 (69%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREKLVEVAF 167

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E+  +PAMYVA Q+VLS+
Sbjct: 168 ESLRSPAMYVASQSVLSV 185



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 32/85 (37%), Positives = 50/85 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA GR +G+V+D+G GV++TVP+++GY L HA  RLD + + LT +L ++L + G     
Sbjct: 186 YAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNHLTAFLAEMLLQAGLPLGQ 245

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
                + +   K   CYV S   K+
Sbjct: 246 QDLDLVEN--IKHHYCYVASDFQKE 268



 Score = 38.7 bits (86), Expect = 0.18
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  R
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 39/79 (49%), Positives = 56/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIM 452
           + + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++M
Sbjct: 52  IKVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIEVM 111

Query: 453 FETFNTPAMYVAIQAVLSL 509
           FET+    +Y+AIQAVL+L
Sbjct: 112 FETYQFAGVYIAIQAVLTL 130



 Score = 66.5 bits (155), Expect = 8e-10
 Identities = 27/50 (54%), Positives = 37/50 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKI 658
           YA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD +   +T YL+K+
Sbjct: 131 YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKV 180



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 44/84 (52%), Positives = 53/84 (63%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           QSK   L LK PI   +++N D++E  W H F  EL +   EHPVL+TE+P N K  REK
Sbjct: 60  QSKN--LNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREK 117

Query: 438 MTQIMFETFNTPAMYVAIQAVLSL 509
           +TQIM ETF  PA Y A   VLSL
Sbjct: 118 VTQIMMETFKVPAYYTAYPGVLSL 141



 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 25/87 (28%), Positives = 46/87 (52%)
 Frame = +2

Query: 488 HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           +P     YA+G  +G V+D+G+ ++  +P+Y+ + + H   +++     L  YL K+L +
Sbjct: 135 YPGVLSLYANGMASGCVIDAGETITQILPVYQCFGMTHITGKVEVGGRSLNAYLKKLLND 194

Query: 668 RGYSFITNAXREIRS*TFKEKLCYVGS 748
              +      REI     KE+LCYV +
Sbjct: 195 HDITLPQQNEREIVR-DIKEQLCYVAT 220



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDE 255
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG E
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSE 56


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 88.6 bits (210), Expect = 2e-16
 Identities = 37/71 (52%), Positives = 52/71 (73%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P  NREKM +++FE F  P
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREKMAELLFEGFGVP 107

Query: 474 AMYVAIQAVLS 506
           A+ V  + VL+
Sbjct: 108 AVLVMPRPVLA 118



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/61 (49%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
 Frame = +2

Query: 491 PSRALA-YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           P   LA Y+ G TTG+VL SG G S+ V + +GY LPHA  RLD + + LT YL ++L  
Sbjct: 113 PRPVLATYSYGCTTGVVLGSGAGTSYVVAVQDGYVLPHASFRLDLAGNDLTAYLSQMLAA 172

Query: 668 R 670
           R
Sbjct: 173 R 173



 Score = 37.1 bits (82), Expect = 0.56
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 183
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 86.6 bits (205), Expect = 7e-16
 Identities = 37/78 (47%), Positives = 55/78 (70%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y  G TTG++LDSGDGV+H +P+YE + LPH + R++ +   +T+YL+K+L  RGY+F +
Sbjct: 143 YCEGLTTGMLLDSGDGVTHCIPVYENFILPHLVKRMNIAGRHMTEYLIKLLFRRGYAFNS 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A  E+     KE+LCYV
Sbjct: 203 TADFELVR-DIKERLCYV 219



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 35/81 (43%), Positives = 51/81 (62%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           + +L L  P+E G V NW DME +W ++F  +L    + + VL+TE  LNP  NR+K  +
Sbjct: 63  QAMLELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLNPAQNRKKTAE 121

Query: 447 IMFETFNTPAMYVAIQAVLSL 509
           ++FE FN   M + IQA+LSL
Sbjct: 122 VLFEQFNFGRMQIGIQALLSL 142



 Score = 38.7 bits (86), Expect = 0.18
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           +V D+G+G  K G+AGD+ P+   P+++GRP
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRP 37


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 86.2 bits (204), Expect = 9e-16
 Identities = 41/82 (50%), Positives = 51/82 (62%)
 Frame = -3

Query: 503 EHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMPNLLHV 324
           +HGLDG VHG  VE  +HD                +QD V LG  TQL+VEG++P+LLHV
Sbjct: 34  QHGLDGHVHGWGVEGLKHDLGHLLVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHV 93

Query: 323 IPVSDDSVFDGVFEGQDTSFAL 258
           +PV DD+V  GV +GQD S AL
Sbjct: 94  VPVGDDAVLHGVLQGQDASLAL 115



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/62 (41%), Positives = 35/62 (56%)
 Frame = -2

Query: 255 LISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFVAHLE 76
           LI++I + L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    G   + H E
Sbjct: 117 LIAHIGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGHGGIII-HGE 175

Query: 75  LV 70
           L+
Sbjct: 176 LI 177



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 601 VGECVSLVDGHGVGDTVAGVQHDTGGT 521
           +GE + L+DGH VGD V  V H+   T
Sbjct: 1   MGEGIPLIDGHSVGDPVTRVHHNASST 27


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 41/86 (47%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKANR 431
           A +K   L+LKYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP ANR
Sbjct: 59  AMAKANALSLKYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANR 118

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  QI+FETF  P + +  +AVL L
Sbjct: 119 EKTMQILFETFQAPLISLVNKAVLPL 144



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 36/85 (42%), Positives = 52/85 (61%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G+ TG+V+DSG   ++ VP+YEGY L HA+LR D++ +  T   ++IL + GY F  
Sbjct: 145 YAVGKLTGVVVDSGQDDTNIVPVYEGYYLQHAVLRRDYAGNACTQEFLQILNKSGYYFYK 204

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
           +  R +     KEKLCYV     K+
Sbjct: 205 HYYRSLII-EMKEKLCYVAQDYDKE 228



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+E  AK
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAK 62


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 85.4 bits (202), Expect = 2e-15
 Identities = 36/85 (42%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A +KRG+LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P + +E
Sbjct: 61  ALAKRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPASQKE 120

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           K  ++M ETF+  ++++    VLSL
Sbjct: 121 KTLELMMETFHVHSLFLGASQVLSL 145



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +2

Query: 428 QREDDPDHVRNIQHARHVRRHPSRALA-YASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 604
           Q+E   + +    H   +    S+ L+ Y+ G TTG+V+DSG   +  VP++EGYAL   
Sbjct: 118 QKEKTLELMMETFHVHSLFLGASQVLSLYSYGLTTGLVIDSGKDRTMAVPVHEGYALGRH 177

Query: 605 ILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           +   D +  +LT+Y   +L   G SF T    ++ +   KE +CYV
Sbjct: 178 VAESDVAGEKLTEYFASLLRLEGNSFGTPMEMQVLN-NAKEDICYV 222



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD  
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 259 RAK 267
            AK
Sbjct: 62  LAK 64


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 33/72 (45%), Positives = 53/72 (73%)
 Frame = +3

Query: 294  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
            +  G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+ NREK+ +I+FE F+ P
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVP 973

Query: 474  AMYVAIQAVLSL 509
            AM    QA+L+L
Sbjct: 974  AMQTVHQALLTL 985



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 35/85 (41%), Positives = 44/85 (51%)
 Frame = +2

Query: 488  HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
            H +    YA GRTTG+V+ SG G S+  PI  G   P    RLD + + LTDYL ++L  
Sbjct: 979  HQALLTLYAYGRTTGLVVGSGHGTSYVAPIITGDLAPIDTYRLDVAGADLTDYLTQLLLS 1038

Query: 668  RGYSFITNAXREIRS*TFKEKLCYV 742
             G+S        IR    KE  CYV
Sbjct: 1039 GGHSLPKGGI--IRQ--IKEACCYV 1059


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 33/69 (47%), Positives = 52/69 (75%)
 Frame = +3

Query: 303 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 482
           G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+ NREK+ +++FE F  PAM 
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVELLFENFGVPAMQ 226

Query: 483 VAIQAVLSL 509
              QA+LSL
Sbjct: 227 TVHQALLSL 235



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = +2

Query: 488 HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           H +    YA GRTTG+V+ SG G S+  PI  G   P  + RLD +   L++YL ++L  
Sbjct: 229 HQALLSLYAYGRTTGLVMGSGHGTSYVAPIITGELAPLNLYRLDVAGKDLSEYLSQLLLA 288

Query: 668 RG 673
            G
Sbjct: 289 GG 290



 Score = 41.5 bits (93), Expect = 0.026
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR 140


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 35/75 (46%), Positives = 53/75 (70%), Gaps = 1/75 (1%)
 Frame = +3

Query: 288  YPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
            YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+ NREK+ +I+FE F
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREKVAEILFERF 1011

Query: 465  NTPAMYVAIQAVLSL 509
            + PAM    QA+L+L
Sbjct: 1012 HVPAMQTVHQALLAL 1026



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/64 (45%), Positives = 36/64 (56%)
 Frame = +2

Query: 488  HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
            H +    YA GRTTG+VL SG G S+  PI  G   P    RLD +   LT+YL ++L  
Sbjct: 1020 HQALLALYAYGRTTGLVLGSGYGTSYVAPILTGDLAPLDTYRLDVAGVDLTEYLAQLLLA 1079

Query: 668  RGYS 679
             GYS
Sbjct: 1080 GGYS 1083



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 91   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 204
            +++AA+V+D G+G  K G A +D   +V PS V   +H
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQH 934


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 38/77 (49%), Positives = 54/77 (70%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K +  K+ +IMF
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNKLIEIMF 123

Query: 456 ETFNTPAMYVAIQAVLS 506
           ETF T ++ +  Q++LS
Sbjct: 124 ETFCTQSVSLLDQSMLS 140



 Score = 39.9 bits (89), Expect = 0.080
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +2

Query: 524 TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           ++G+V+D GD V++ VP Y G  L   I+R +F  S +  YL
Sbjct: 168 SSGLVVDIGDSVTNIVPFYNGVLLKEGIVRQEFGGSDIVTYL 209


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 36/85 (42%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A +K G++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N   NRE
Sbjct: 55  AVAKSGVMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPKNRE 114

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           K+T+I+FE F+ PAMY+A Q  LSL
Sbjct: 115 KLTEILFEQFSAPAMYLADQLSLSL 139



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL-TERGYSFI 685
           YASG TTG+ L SG   +    IYEG+ L H +  L+     LT+ L + L  +RG++F 
Sbjct: 140 YASGMTTGVCLSSGFSCTQAAVIYEGHTLNHTLQTLEIGGHHLTENLKQYLRDQRGHNFT 199

Query: 686 TNAXREIRS*TFKEKLCYV 742
           +++  +I +   KEK+CY+
Sbjct: 200 SSSGWQIVN-DIKEKICYL 217



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 19/40 (47%), Positives = 29/40 (72%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 222
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 40


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 80.2 bits (189), Expect = 6e-14
 Identities = 34/81 (41%), Positives = 53/81 (65%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           +R  + +  PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  
Sbjct: 86  RRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAA 145

Query: 444 QIMFETFNTPAMYVAIQAVLS 506
           ++MFE +  PA+++A   VL+
Sbjct: 146 ELMFEKYKVPALFMAKNPVLT 166



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           ++A+GR T +V+D G G +   P+++GY L  A++        LTD L+K L  +G
Sbjct: 167 SFATGRATSLVVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKG 222


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 616
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct: 36  YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 71



 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 34/35 (97%), Positives = 34/35 (97%)
 Frame = +3

Query: 405 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           APLNPKANREKMTQIMFETFNTPAMYV IQAVLSL
Sbjct: 1   APLNPKANREKMTQIMFETFNTPAMYVGIQAVLSL 35


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 34/76 (44%), Positives = 49/76 (64%)
 Frame = +3

Query: 282  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
            L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE    PK  RE++ +++FET
Sbjct: 1303 LRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRERILEVLFET 1362

Query: 462  FNTPAMYVAIQAVLSL 509
            + TPA +V  Q  L+L
Sbjct: 1363 YKTPACFVVNQGALAL 1378



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +2

Query: 500  ALA-YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL-TERG 673
            ALA +A+G T+G+VL SG GV+  VP+Y+G  + +A+  L  +   +T  L +IL  ER 
Sbjct: 1375 ALALHANGETSGLVLSSGSGVTEVVPVYQGCTITNAVTTLPTAGRGVTRRLQRILMDERA 1434

Query: 674  YSFITNAXREIRS*TFKEKLCYV 742
            +S  T     I     KE + YV
Sbjct: 1435 FSVSTPFDHRILQ-DLKENMAYV 1456



 Score = 42.3 bits (95), Expect = 0.015
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +1

Query: 106  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+E
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNE 1284


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 34/41 (82%), Positives = 37/41 (90%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 377
           AQSK GILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 12  AQSKYGILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 31/72 (43%), Positives = 47/72 (65%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 122 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 181

Query: 471 PAMYVAIQAVLS 506
           PA+++A  AVL+
Sbjct: 182 PALFLAKNAVLT 193



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 186
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           ++ASGR T +V+DSG G +    +++GY L  ++         LTD +MK L  +G
Sbjct: 194 SFASGRATSLVVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKG 249


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 34/74 (45%), Positives = 46/74 (62%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P+EHG+V NWD ME+ W H F   L V P++  VLLTEA + P   RE   +IMFE+F  
Sbjct: 68  PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQREMTAEIMFESFGV 127

Query: 471 PAMYVAIQAVLSLT 512
           P + +  QA+  L+
Sbjct: 128 PRLCIGSQALFVLS 141



 Score = 40.3 bits (90), Expect = 0.060
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +2

Query: 518 GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           G  T +V++SG GV+  VPI  GYA+  A  R   +   +T Y++K L E
Sbjct: 146 GCDTAVVVESGAGVTQVVPIVAGYAVSGAARRFPVAGWDITQYVLKSLRE 195


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/75 (45%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P N +  R+K  +IM ETF
Sbjct: 141 QFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRNDENYRQKTLEIMMETF 199

Query: 465 NTPAMYVAIQAVLSL 509
           N P++++  QA LSL
Sbjct: 200 NVPSLHIGNQAELSL 214



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L  ++ I  G +TNW+ ME IW + F  EL     +HP+L+T  P+N +   + +T++  
Sbjct: 489 LRTEFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMNDEYCLQLVTELF- 546

Query: 456 ETFNTPAMY 482
             FN+  ++
Sbjct: 547 -AFNSSFLF 554



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/88 (42%), Positives = 58/88 (65%), Gaps = 3/88 (3%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +++G  TG+ ++SG+G+SH  PI+EGYALP A  R+D     +T++L++++  RGYSF  
Sbjct: 158 FSNGLQTGVAVESGEGISHCTPIFEGYALPKANRRVDLGGRNITEFLIRLMQRRGYSFNQ 217

Query: 689 NAXRE-IRS*TFKEKLCY--VGS*LSKQ 763
           ++  E +R    KE+ CY  V S L KQ
Sbjct: 218 SSDYETVR--RMKERFCYAAVDSKLEKQ 243



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 33/81 (40%), Positives = 51/81 (62%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           R +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E PL    +R  + +
Sbjct: 77  RHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEVPLFSSKHRCHLYE 136

Query: 447 IMFETFNTPAMYVAIQAVLSL 509
           +MFE +N  A+  A+Q  LSL
Sbjct: 137 VMFEKYNFMAIQSAVQGTLSL 157



 Score = 41.5 bits (93), Expect = 0.026
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 34/78 (43%), Positives = 50/78 (64%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+SGRTTG+VLDSGDGV+   P+Y+ Y + +A  R +     +T++L  +L ERG +F T
Sbjct: 144 YSSGRTTGVVLDSGDGVTQVTPVYDSYIIRNAASRFNLGGHEVTEHLRTLLFERGLNF-T 202

Query: 689 NAXREIRS*TFKEKLCYV 742
           +    +   + KE LCYV
Sbjct: 203 SPQDRLTVQSIKESLCYV 220



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 28/67 (41%), Positives = 42/67 (62%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK N E++ +++FE
Sbjct: 68  TLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPKRNSEQLAEVLFE 126

Query: 459 TFNTPAM 479
            F  P++
Sbjct: 127 AFGVPSI 133



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 30/72 (41%), Positives = 49/72 (68%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P+++G+V +WD  + I  HT+   ++     HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 87  PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNI 146

Query: 471 PAMYVAIQAVLS 506
           PA ++   AVL+
Sbjct: 147 PAFFLCKTAVLT 158



 Score = 41.9 bits (94), Expect = 0.020
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI 685
           A+A+GR+TG++LDSG   +  +P+++GY L   I++   +   +T    ++  E     +
Sbjct: 159 AFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELV 218



 Score = 40.7 bits (91), Expect = 0.046
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV ALV D GS   +AG+AG+D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 38/87 (43%), Positives = 50/87 (57%)
 Frame = -3

Query: 518 RTRKREHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMP 339
           R  +R+  L+  VH  RVE  EHD                E++ +FL GD QL+VEG+MP
Sbjct: 355 RCIERQDSLNSYVHSRRVERLEHDLRHLLSVGLRVERSLGEENGMFLWGDAQLVVEGVMP 414

Query: 338 NLLHVIPVSDDSVFDGVFEGQDTSFAL 258
           +LLHVIPV D SV D +F  +DT+  L
Sbjct: 415 DLLHVIPVGDYSVLDRIFNREDTALGL 441



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 10/68 (14%)
 Frame = -2

Query: 255 LISYIRVLLSHTDHHAL----------MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQ 106
           L++Y+ VLL+H DH AL          +AGP+ D  + G+R +++ ET LAH+ +IV ++
Sbjct: 443 LVAYVGVLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVNHE 502

Query: 105 RGNFFVAH 82
            G   VAH
Sbjct: 503 SGYVVVAH 510


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 72.9 bits (171), Expect = 9e-12
 Identities = 32/71 (45%), Positives = 47/71 (66%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 474 AMYVAIQAVLS 506
           A Y++   VLS
Sbjct: 154 AYYLSKNVVLS 164



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 18/54 (33%), Positives = 36/54 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           +A GRT G+++DSG   +  VP+++GYA+ HA+++       +T+ L ++L ++
Sbjct: 166 FAQGRTHGLMVDSGATQTSVVPVFDGYAVTHAVVKCPIGGDLITEQLAQMLDQQ 219



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/78 (43%), Positives = 50/78 (64%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L+ PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P  ++EKM QIMF
Sbjct: 55  LNLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEKMAQIMF 113

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E F    + V +Q++L L
Sbjct: 114 EGFGMKGLDVMMQSLLEL 131



 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 37/78 (47%), Positives = 48/78 (61%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y SGRTTG+V+D G G+   VPIY GY + HA LRL  +   + +YL K+L ERG  F T
Sbjct: 132 YFSGRTTGVVVDCGYGMCQVVPIYNGYMMEHATLRLMCAGEEINEYLRKLLIERGIIFST 191

Query: 689 NAXREIRS*TFKEKLCYV 742
            +  +I     KE+L YV
Sbjct: 192 ES-EKIEVERIKERLGYV 208



 Score = 42.3 bits (95), Expect = 0.015
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 228
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIG 46


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 46/76 (60%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK TQIMFET
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEKTTQIMFET 80

Query: 462 FNTPAMYVAIQAVLSL 509
           FN     + IQ++LSL
Sbjct: 81  FNISKFIIQIQSILSL 96



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/78 (35%), Positives = 43/78 (55%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           ++SG+TTG V+DSG+  ++ VPIYEGY L       + +    + YL  ++T+     + 
Sbjct: 97  FSSGKTTGFVVDSGNDTTYFVPIYEGYKLDIKDNFCNIAGKSCSTYLNHLITQSNQKRVG 156

Query: 689 NAXREIRS*TFKEKLCYV 742
           N   EI     KEK CY+
Sbjct: 157 NL--EILD-YIKEKYCYI 171


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 29/77 (37%), Positives = 50/77 (64%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           T + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN   NR++  QI  E
Sbjct: 56  TFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNSLENRQQTLQIFME 115

Query: 459 TFNTPAMYVAIQAVLSL 509
            +N P+   A  + L+L
Sbjct: 116 EYNVPSFCPAFASSLAL 132



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/78 (34%), Positives = 46/78 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y +G T+GIV+DSG+  +  +P++E + L H + RLD     +++YL K+L ++G     
Sbjct: 133 YNAGYTSGIVVDSGESNTDIIPVFECFTLTHLVSRLDVGGKHVSEYLKKLLNQQGIVLPG 192

Query: 689 NAXREIRS*TFKEKLCYV 742
              REI     KE++ +V
Sbjct: 193 PTEREILR-EVKEQIGFV 209



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPS 183
           +V+D G  + KAGF GD  P  VFPS
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS 31


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 29/85 (34%), Positives = 56/85 (65%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A ++R  L+L +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL    + E
Sbjct: 72  AIAQRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEE 131

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           K+T++MFE F T ++ +A+Q +++L
Sbjct: 132 KITELMFEMFQTQSLNIALQGLMAL 156



 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y++GRTTG+  D G+GV+  VP+Y+GY    ++ R D     +T YL K+L+++GY   T
Sbjct: 157 YSAGRTTGVACDIGEGVTQVVPVYDGYCDSSSLRRADIGGQEITMYLQKLLSDKGYIATT 216

Query: 689 NAXRE-IRS*TFKEKLCYV 742
               E +R    KE LCY+
Sbjct: 217 RDDLEHVR--IIKETLCYI 233



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+E
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEE 71


>UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 221

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 37/61 (60%), Positives = 42/61 (68%)
 Frame = +2

Query: 560 SHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCY 739
           S T+PI EGYA PHA+LRLD +   L  +LM ILTERGYSF T A +EI     KEKLC 
Sbjct: 3   SPTLPIDEGYASPHAVLRLDLAGRGLAHHLMTILTERGYSFTTAAEQEIVR-DIKEKLCC 61

Query: 740 V 742
           V
Sbjct: 62  V 62


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 29/71 (40%), Positives = 46/71 (64%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P ++RE M ++ FE   TP
Sbjct: 73  MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSPTSSRENMAEMAFEVLGTP 132

Query: 474 AMYVAIQAVLS 506
            ++VA Q VLS
Sbjct: 133 GLFVAPQPVLS 143



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI 685
           AY  G+ + +VLD G   +  VP+ EG ++  +  + D +   LT YL  +L + G+   
Sbjct: 144 AYTHGKISALVLDMGHAATRVVPVLEGRSMACSSKQTDVAGRCLTWYLSTLLEDTGHVLS 203

Query: 686 TNAXREIRS*TFKEKLCYV 742
                 +     K   CY+
Sbjct: 204 KGMSHMVED--IKRACCYI 220


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 31/77 (40%), Positives = 48/77 (62%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASG TTG+VLD G+GV+  +P+++GY   ++I+R DF    L+ +L K++ + GYS  T
Sbjct: 134 YASGLTTGLVLDIGEGVTQCLPVFDGYIEKNSIIRSDFGGEELSMFLQKLICDIGYSMTT 193

Query: 689 NAXREIRS*TFKEKLCY 739
               E      KE +C+
Sbjct: 194 TKSLEYVK-NIKETICF 209



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 27/78 (34%), Positives = 49/78 (62%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE PL   ++R+KM +I F
Sbjct: 57  LNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPLCSISHRKKMGEIFF 115

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E F+T  + +++  ++SL
Sbjct: 116 EYFDTLNLNLSVSGLMSL 133



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/54 (40%), Positives = 28/54 (51%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GDE
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDE 49


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 29/86 (33%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANR 431
           A  +R  L L+ P     + +WD +E +W +   N+L +   +EHPV+LT +    K   
Sbjct: 63  AYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEE 122

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EKM +++FE F+ PA+Y +   ++SL
Sbjct: 123 EKMCEVLFEKFSIPAIYCSRDPIMSL 148



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGN 61


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/77 (38%), Positives = 46/77 (59%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE
Sbjct: 62  TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFE 120

Query: 459 TFNTPAMYVAIQAVLSL 509
             + P++ +A Q  +SL
Sbjct: 121 LLHVPSVLLADQLQMSL 137



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           YASG  TG+V+DSG G++   P ++G  LP +   L+F+   L+ YL+K L
Sbjct: 138 YASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSL 188



 Score = 36.7 bits (81), Expect = 0.74
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIV 189
           +++D+GSG  KAG AG + P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/70 (41%), Positives = 43/70 (61%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 476
           E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A R KM ++MFE    PA
Sbjct: 80  ENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVRAKMVELMFEKHAPPA 139

Query: 477 MYVAIQAVLS 506
           +++A   VLS
Sbjct: 140 LFLAKSPVLS 149



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG 38



 Score = 35.5 bits (78), Expect = 1.7
 Identities = 15/55 (27%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           ++A G+ + +V+D G   +    I++G+AL  +++R       LTD ++K L ++
Sbjct: 150 SFAVGKASSLVIDMGGKHTTVSAIHDGFALQKSVVRSPLGGEALTDVVLKYLEKK 204


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 30/78 (38%), Positives = 48/78 (61%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           ++ GR TG+V D+G+G+   VP+YEGY +PHAI+  +   S LT+ + +++T +  S   
Sbjct: 142 FSIGRRTGLVFDNGEGLGSIVPVYEGYTIPHAIIHTELCGSFLTENMKRLITTKDPSTAE 201

Query: 689 NAXREIRS*TFKEKLCYV 742
               E R+   K+KL YV
Sbjct: 202 WKLEEFRA--MKDKLSYV 217



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 32/85 (37%), Positives = 46/85 (54%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A +K  +L L  PIE+G+V NW+   ++W   F N+     E+  +L  E P   + N+ 
Sbjct: 57  ALAKENLLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQQNKA 116

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KM QI+FE FN        Q+VLSL
Sbjct: 117 KMAQILFEKFNCGGFSSIQQSVLSL 141



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/58 (39%), Positives = 35/58 (60%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+E  AK
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAK 60


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 468 TPAMYVAIQAVLSL 509
               Y + QAVLSL
Sbjct: 117 VSGFYASEQAVLSL 130


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 29/73 (39%), Positives = 41/73 (56%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MF
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMF 122

Query: 456 ETFNTPAMYVAIQ 494
           E+   PA Y+A Q
Sbjct: 123 ESLRCPATYLAKQ 135



 Score = 40.3 bits (90), Expect = 0.060
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGY 676
           A+ASG+ T  ++D G   S    IY+G+ L        FS + + D L + L ++ +
Sbjct: 140 AFASGKGTACLVDIGAERSSVSAIYDGFVLQKGYQVQHFSGNAINDILAQTLRDKNF 196


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 31/77 (40%), Positives = 44/77 (57%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y  G+ TG V++ GDGV+  +P+ EGY+   +I R+DF    LT YL K+L  RGY   +
Sbjct: 139 YGLGKLTGTVVEVGDGVTQVLPVIEGYSERSSIKRVDFGGIELTMYLQKMLCTRGYCLTS 198

Query: 689 NAXREIRS*TFKEKLCY 739
               E+     KEK C+
Sbjct: 199 RPDFELVR-ELKEKYCF 214



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEAP     +R K ++I F
Sbjct: 62  MSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPKHRIKSSEIFF 120

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FN   + +++  +LS+
Sbjct: 121 ERFNVDDLNISVAGLLSM 138



 Score = 35.5 bits (78), Expect = 1.7
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA RE++ Q+MFE F
Sbjct: 99  PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQLVQLMFEIF 157

Query: 465 NTPAMYVAIQAVLSL 509
           N    Y + Q VLSL
Sbjct: 158 NISDFYASEQVVLSL 172


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 28/82 (34%), Positives = 45/82 (54%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 471 PAMYVAIQAVLSLTRPVVPPVS 536
           P++   I  + S      P  S
Sbjct: 145 PSVAYGIDGLFSFYHNTKPSSS 166



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +2

Query: 524 TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSF 682
           ++GIVL+ G+  SH +P+  G  +     R+ +  S+ + YL+K+   +  SF
Sbjct: 165 SSGIVLNLGNAASHVIPVLNGERILSEAKRISWGGSQSSSYLLKLFQIKYPSF 217


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 33/99 (33%), Positives = 54/99 (54%)
 Frame = +2

Query: 494 SRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           S    +++GRTTG+V+DSG+G ++   ++EGY L +A    D +   LTD L+  L  +G
Sbjct: 140 SATTVFSTGRTTGLVVDSGEGCTNFNAVWEGYNLQYATHTSDVAGRVLTDRLLAFLRAKG 199

Query: 674 YSFITNAXREIRS*TFKEKLCYVGS*LSKQXIGXRLHSK 790
           Y   T   R +     K  LCYV + + ++    ++H K
Sbjct: 200 YPLSTPNDRRVVE-DVKHTLCYVAADVQEEV--KKMHKK 235



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 21/75 (28%), Positives = 42/75 (56%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A ++ G+L L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + +RE
Sbjct: 60  ACAQEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSREDRE 119

Query: 435 KMTQIMFETFNTPAM 479
           ++ ++MFE+F  P +
Sbjct: 120 RLCEMMFESFGLPQL 134



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGD 252
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGD 58


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/73 (36%), Positives = 42/73 (57%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +AN+ K  +I FE+  
Sbjct: 87  HPLTDGIVADWDAVQNIWEYSLAR-LNADTKTHPLMLTEPCWNTQANKLKALEIAFESLE 145

Query: 468 TPAMYVAIQAVLS 506
            PA Y+   AV S
Sbjct: 146 VPASYLVKDAVAS 158



 Score = 37.1 bits (82), Expect = 0.56
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47



 Score = 36.7 bits (81), Expect = 0.74
 Identities = 18/58 (31%), Positives = 29/58 (50%)
 Frame = +2

Query: 500 ALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           A A+A+G+   +VLD G  V+   P+ +G  L     R  ++   L   + K+L  RG
Sbjct: 157 ASAFAAGKGNALVLDVGSEVASVTPVIDGLVLYKPARRSQYAGDYLDRQIKKVLVSRG 214


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 31/77 (40%), Positives = 45/77 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y  G+++G+V+D GDG+   VP+ EG+    AI R+DF    LT YL K+L E GY  +T
Sbjct: 139 YGVGKSSGMVVDIGDGMIQVVPMEEGHLEKKAIRRIDFGGLELTMYLQKLLCELGYP-MT 197

Query: 689 NAXREIRS*TFKEKLCY 739
           +          KE+LC+
Sbjct: 198 SRDDFDTCRKIKEELCF 214



 Score = 35.5 bits (78), Expect = 1.7
 Identities = 19/84 (22%), Positives = 40/84 (47%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 437
           Q +   ++    ++HG + ++D    +W + F + + V P+   VL+ E  L    +  K
Sbjct: 56  QQRMSYMSTTNVVDHGHIFDYDIAAGLWKYAF-DTMDVEPKGASVLMIEPVLCSAEHHRK 114

Query: 438 MTQIMFETFNTPAMYVAIQAVLSL 509
             +I+ E      ++ ++  VLSL
Sbjct: 115 TGEILLEGMGVEEIHTSMSGVLSL 138


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 36/121 (29%), Positives = 62/121 (51%), Gaps = 3/121 (2%)
 Frame = +2

Query: 488 HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           +P+    YA G+ TG+V++ G+ +   VP  +GY +  AI ++  + S LT+Y+ ++L  
Sbjct: 643 NPALMALYAEGKETGVVVEIGNRMQ-IVPAVDGYVIDSAITKIKGNVSGLTEYMSRLLRA 701

Query: 668 RGYSFITNAXREIRS*TFKEKLCYVGS*LS---KQXIGXRLHSKXFPFEESSYXXFPERF 838
            GY + T+A  E+     KE +CYV        K+     +     P  E++   F ERF
Sbjct: 702 CGYIYTTSAQMELVR-AIKESVCYVALDYDAEMKKKAKDVMKEFQVPGNENTSKFFQERF 760

Query: 839 K 841
           +
Sbjct: 761 Q 761



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 458
           L +P++    T+WD +  I  + + NEL    P  HPV++TE P   +   +K+  +MF 
Sbjct: 573 LVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELPNMNEVATDKIKSMMFN 632

Query: 459 TFNTPAMYVAIQAVLSL 509
             N P + +   A+++L
Sbjct: 633 DLNVPFLKIVNPALMAL 649


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 2/54 (3%)
 Frame = +3

Query: 354 YNELRVAPEEHPVLLTEAPLNP--KANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           Y +L+VAPE HPVLLT+ P  P  KA  EK+ QIMFE F  PA+++   +VLSL
Sbjct: 14  YKQLKVAPENHPVLLTK-PYFPISKATTEKIAQIMFEDFKIPALHLIYPSVLSL 66



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +2

Query: 488 HPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR-LDFSRSRLTDYLMKILT 664
           +PS    Y+ G  TG+V+ SG+  S   PIYEG+ L   + R L  +   LT++L   L 
Sbjct: 60  YPSVLSLYSYGSLTGLVVQSGNFESQFYPIYEGHILERTLTRGLPVAGQYLTEFLQDALA 119

Query: 665 ERG 673
           ++G
Sbjct: 120 KKG 122


>UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta
           actin - Oncorhynchus nerka (Sockeye salmon)
          Length = 70

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 26/49 (53%), Positives = 31/49 (63%)
 Frame = +1

Query: 565 HRAHLRGIRTPPRHPASGL*PVATHRLPHEDSHRARLLVHYQRRXGNSF 711
           H  HLRG+R+ PRHPASG      HRLP ED   ARL +H+  R G S+
Sbjct: 4   HCTHLRGLRSAPRHPASGSGRPRPHRLPDEDPDGARLQLHHHGRVGKSY 52


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 25/53 (47%), Positives = 35/53 (66%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 413
           A + R  L L  PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 54  ANAIRNELILNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           +VVDNG+G  KAG+AGD  PR + P ++GRP+
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPK 40


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 455
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 456 ETFNTPAMYVAIQAVLS 506
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 27/78 (34%), Positives = 45/78 (57%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T    +  ++R K+ ++M 
Sbjct: 63  LPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVTGFLSHRASHRMKLLEVMM 121

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETFN P++Y+   A L L
Sbjct: 122 ETFNVPSLYIGELAELCL 139


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 30/85 (35%), Positives = 44/85 (51%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A  +RG+L L YPI+HGI+ NWD  + +       +L  +  E  V   E P + +  R 
Sbjct: 55  AAERRGLLHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWVEHPFSSRPQRA 113

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           ++ QI+FE      M V I  +LSL
Sbjct: 114 RVAQILFEEKGIFGMCVGIAPLLSL 138



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/55 (47%), Positives = 34/55 (61%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERG 673
           YA+G TTGIVLD G+GVS      +GYA+   + R DF    +T YL ++L E G
Sbjct: 139 YATGETTGIVLDVGEGVSSVAAAVQGYAVTGMMQREDFGGGAVTQYLQRLLREYG 193


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 452
           LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA  NP   R+ M++++
Sbjct: 82  LKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEALANPNFCRQNMSELL 140

Query: 453 FETFNTPAMYVAIQAVLS 506
           FE +  PA+   I A+ S
Sbjct: 141 FECYGIPAVSYGIDALYS 158


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 309 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 488
           VT+WD  E+I  H  + + ++   +HP++L E P   ++ R+KM ++ FE  + P  Y+A
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQKMVELAFEGLDVPEFYLA 120

Query: 489 IQAVLSL 509
            + V++L
Sbjct: 121 SEPVVAL 127



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           Y+ G ++GIVL S    S+   I++G+  P+ ++ L F    +T Y M ++ +
Sbjct: 128 YSVGLSSGIVLSSSYMSSNVSTIHDGHRPPYGLVHLGFGGRDVTQYAMDLIKD 180


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A +  G+L+L YP+  G V ++D +EK+  +    E RV P+  P L        + +RE
Sbjct: 63  AYNDGGLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQTRLDRE 122

Query: 435 KMTQIMFETFNTP 473
           ++ +++FE+FN P
Sbjct: 123 RLCELLFESFNIP 135



 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 32/83 (38%), Positives = 41/83 (49%)
 Frame = +2

Query: 500 ALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYS 679
           A  Y+SGRT G+ LDSG G +    + EGY L H++     +   LTD L   L   GY 
Sbjct: 145 ATLYSSGRTRGLALDSGAGRTCVAAVEEGYTLAHSVRSSSLAGEALTDELFAALRAGGYP 204

Query: 680 FITNAXREIRS*TFKEKLCYVGS 748
             T A R +     KE LC V +
Sbjct: 205 LSTAADRGVVE-AAKEALCRVSA 226



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 97  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 198
           + ++VVD G+   + GF+G++APR +  S VG P
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLP 41


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 42/69 (60%)
 Frame = +3

Query: 300 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
           +G V +WD  EK+    + N++RV P E+ +L++E+ L+ +  REK+ Q+ FE+   P  
Sbjct: 101 NGEVKDWDAFEKLLLDVYENQIRVQPSEYCLLISESSLHNQRQREKICQLAFESLKVPNF 160

Query: 480 YVAIQAVLS 506
           ++    VLS
Sbjct: 161 FIVKSGVLS 169



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37



 Score = 42.7 bits (96), Expect = 0.011
 Identities = 17/51 (33%), Positives = 33/51 (64%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           ++SGR+T +VLD+G   ++ VP+++GY L  ++ + D     LT+ ++  L
Sbjct: 171 FSSGRSTALVLDTGAYSTYAVPVHDGYVLQKSVRKFDIGGEFLTEKILNNL 221


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 25/68 (36%), Positives = 37/68 (54%)
 Frame = +3

Query: 303 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 482
           G+V + +    + HH  +  L V PEEHP+++TE   N    R+ MT++ FE    PA+Y
Sbjct: 113 GVVNDPEPASALLHHILHERLGVNPEEHPIMITEPAWNTPKARQVMTEMAFEGEKMPALY 172

Query: 483 VAIQAVLS 506
                VLS
Sbjct: 173 FGSSGVLS 180



 Score = 42.7 bits (96), Expect = 0.011
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39



 Score = 36.7 bits (81), Expect = 0.74
 Identities = 16/30 (53%), Positives = 21/30 (70%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYAL 595
           A+A+G+ T +VLD G   S  VPI +GYAL
Sbjct: 181 AFAAGKPTALVLDVGYATSSAVPIVDGYAL 210


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 462 FNTPAMYVA 488
           F   ++Y+A
Sbjct: 121 FGFSSLYIA 129



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = +2

Query: 449 HVRNIQHARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSR 628
           H +++ H     R P   L   S     +V+D G   +H VP+   + L HAI R+D   
Sbjct: 130 HPQSLVHLYEASRQPDSIL---SKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 186

Query: 629 SRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
              T+YL ++++ R  + +        +   KEKLC+V
Sbjct: 187 KAFTNYLKELVSYRSINVMDETFLVDDA---KEKLCFV 221


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 461
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 62  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 121

Query: 462 FNTPAMYVA 488
           F   ++Y+A
Sbjct: 122 FGFSSLYIA 130



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = +2

Query: 449 HVRNIQHARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSR 628
           H +++ H     R P   L   S     +V+D G   +H VP+   + L HAI R+D   
Sbjct: 131 HPQSLVHLYEASRQPDSIL---SKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 187

Query: 629 SRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
              T+YL ++++ R  + +        +   KEKLC+V
Sbjct: 188 KAFTNYLKELVSYRSINVMDETFLVDDA---KEKLCFV 222


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 22/74 (29%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP +    R+ M ++++E + 
Sbjct: 87  PMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAPNSLDDLRKTMYEVVYEQYK 146

Query: 468 TPAMYVAIQAVLSL 509
             ++Y+   + L L
Sbjct: 147 FKSLYLTTSSTLGL 160


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 23/78 (29%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PKANREKMTQIMF 455
           +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN P++ R  + +I+F
Sbjct: 73  SLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGPQSQRNIIAEILF 131

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E +   +++++    L +
Sbjct: 132 EKYKIGSLHISTPNTLGM 149


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +3

Query: 270 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNPKANRE 434
           G L  + P+E G + NW+  + IW H F         R  P+E  +LLTE P  PK  ++
Sbjct: 73  GELAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPKELQK 132

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
              +I+FE F   + Y  +   L+   P  P
Sbjct: 133 NCDEIVFEQFEFASYYRCVGPRLNAYHPASP 163


>UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3
           actin-related protein 3 homolog B; n=1; Homo
           sapiens|Rep: PREDICTED: similar to ARP3 actin-related
           protein 3 homolog B - Homo sapiens
          Length = 406

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 23/39 (58%), Positives = 30/39 (76%)
 Frame = +3

Query: 393 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           L TE PLN   NRE + +IMFE+FN P +Y+A+QAVL+L
Sbjct: 257 LQTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLAL 295



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 20/48 (41%), Positives = 32/48 (66%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L ER
Sbjct: 310 TGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRER 357


>UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza
           sativa|Rep: Os08g0128300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 257

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 27/78 (34%), Positives = 41/78 (52%)
 Frame = +2

Query: 530 GIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIR 709
           G+V+D GDG  H VP+  GY +  +I    FS S +T +++++L ERG         +I 
Sbjct: 6   GVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPEDSLDIA 65

Query: 710 S*TFKEKLCYVGS*LSKQ 763
               KE  CY  S + K+
Sbjct: 66  R-RVKEMYCYTSSDIVKE 82


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           +++ P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP  +R  M ++MF
Sbjct: 488 SIRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNPAYSRGIMNELMF 547

Query: 456 ETFNTPAMYVAIQAVLS 506
           E +  P++   I  + S
Sbjct: 548 EAYQVPSVNYGIDCLFS 564


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 46/78 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +++G TTG+V++SG  ++  +P++EG+A+PHA      +  ++T+ L + L         
Sbjct: 191 FSTGETTGLVVESGHSLTTCIPVFEGFAIPHAFQHSYLAGQKMTEILKEELKIPAGQLDD 250

Query: 689 NAXREIRS*TFKEKLCYV 742
           N  ++I     KE++CYV
Sbjct: 251 NVFKDI-----KERMCYV 263



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKM 440
           K+  L  K+PI++G + ++D +  ++ +     L+V       +L+ ++PLNPK  + K+
Sbjct: 108 KKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISSCNLLIIDSPLNPKNYKHKL 167

Query: 441 TQIMFETFNTPAMYVAIQAVLSL 509
            +I+F+     ++     + LSL
Sbjct: 168 AEILFDDMKVNSVLFQNSSSLSL 190


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A R K+ ++ F+ F 
Sbjct: 81  PVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAKIAEMCFDKFR 140

Query: 468 TPAM 479
           +PA+
Sbjct: 141 SPAI 144



 Score = 38.3 bits (85), Expect = 0.24
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 452
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP   R+ M++++
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 453 FETFNTPAMYVAIQAVLS 506
           FE +  P +   I ++ S
Sbjct: 206 FECYQIPNLAYGIDSLFS 223



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           +VL SG   SH +P+  G   P    RL+   + LT YL+++L
Sbjct: 237 LVLSSGFQTSHILPVINGQLDPAHCRRLNIGGTHLTGYLLRLL 279



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           +++DNGS   + G+A +  PR  F +I+ R R
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR 124


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/65 (32%), Positives = 36/65 (55%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YPI  G++++ DD+E I    F   + V     P+++TE  L P   +++  ++ FE F 
Sbjct: 57  YPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRKQEYGELFFEKFE 116

Query: 468 TPAMY 482
           TP +Y
Sbjct: 117 TPGLY 121


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + +  REK  +IMFE
Sbjct: 70  LKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREKEVEIMFE 128

Query: 459 TFNTPAMYVAIQAVLS 506
            F+ PA+Y A +A+LS
Sbjct: 129 KFDVPAVYTAKKAILS 144



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           ++V A++VD GS M K G+ G+D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK-ILTERGYSF 682
           A++ GR++G+V+D G   +  VPI +GY L   +         L D + + +L E+  S 
Sbjct: 145 AFSVGRSSGLVVDIGATATSIVPILDGYTLQKPLCEYPIGGDFLDDQIARHLLKEKNLSI 204

Query: 683 ITN 691
             N
Sbjct: 205 SPN 207


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -3

Query: 185 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 87
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/67 (31%), Positives = 39/67 (58%)
 Frame = +3

Query: 300 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
           +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE  + PA 
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFEQLHVPAF 133

Query: 480 YVAIQAV 500
           Y+  QAV
Sbjct: 134 YLTKQAV 140



 Score = 37.1 bits (82), Expect = 0.56
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDE 56


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/42 (52%), Positives = 32/42 (76%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           EHP+LLTE   N + +REK+T++ FET  +PA Y+A ++VLS
Sbjct: 181 EHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLANRSVLS 222



 Score = 41.1 bits (92), Expect = 0.035
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/41 (53%), Positives = 29/41 (70%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           P+L TE  LNPK  REK  Q++FE F  P++Y +IQ +LSL
Sbjct: 92  PILFTEPALNPKQIREKTIQLLFERFKVPSVYFSIQPILSL 132



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTE-RGYSFI 685
           +AS +T G+V+DSG  ++  +PIYEGY +   + +   + + L +YL+  ++E R  +  
Sbjct: 133 FASEKTDGLVIDSGADITQIIPIYEGYVISSCVHKQYVAGNDLLEYLVSTISEKRDVNLS 192

Query: 686 TNAXREI 706
           T A +E+
Sbjct: 193 TAAAKEV 199



 Score = 39.9 bits (89), Expect = 0.080
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 249
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVG 48


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMF 455
           +LK P    +V N D  E++  H F ++L V  P  +PV++ EA  NP   R ++T+++F
Sbjct: 90  SLKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVINEALCNPGVCRSQLTELLF 148

Query: 456 ETFNTPAMYVAIQAVLS 506
           E+FNTP +   +    S
Sbjct: 149 ESFNTPKLMYYVDCFAS 165



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKD 237
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD 83


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIMFET 461
           P +   VTNW+  E+I  +TF++ L V P+    +P+LLTE     ++ R    QI+FET
Sbjct: 99  PFDGPFVTNWNLTEEILDYTFHH-LGVVPDNGIPNPILLTERLATVQSQRTNWYQILFET 157

Query: 462 FNTPAMYVAIQAVLS 506
           +N P +   I ++ S
Sbjct: 158 YNVPGVTFGIDSLFS 172



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 17/76 (22%), Positives = 36/76 (47%)
 Frame = +2

Query: 515 SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNA 694
           SG  TG+V+  G   ++ +P+ +G  +     R+++   +  DYL  ++  + Y +    
Sbjct: 179 SGNKTGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALK-YPYFPTK 237

Query: 695 XREIRS*TFKEKLCYV 742
              ++  T  +  CYV
Sbjct: 238 MSYLQYETMYKDYCYV 253


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 27/64 (42%), Positives = 31/64 (48%)
 Frame = +2

Query: 92  KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRTLM*EMSTEQKR 271
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT M EM    + 
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRARG 61

Query: 272 YPDP 283
              P
Sbjct: 62  ESSP 65


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 22/43 (51%), Positives = 32/43 (74%)
 Frame = +3

Query: 378 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           EEHP+LLTE  ++    RE+MT+I+FE +N PA+Y A +A L+
Sbjct: 146 EEHPILLTEFNMHNHKIREQMTEILFEKYNIPALYFAKKAKLT 188


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +3

Query: 363 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           L +  EEHP+LL+E  ++    R +MT+I+FETFN PA+Y A +A L+
Sbjct: 134 LNLKIEEHPILLSEENIHNHRVRAEMTEILFETFNIPAVYFAKKAKLT 181



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 494 SRALAYASGRTTGIVLDSGDGVSHTVPIYEGYAL 595
           ++  A++ GR+  +V+D G    +  P+YEGY L
Sbjct: 178 AKLTAFSLGRSNALVIDIGGSSLNVTPVYEGYVL 211


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 204
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH 40



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 2/108 (1%)
 Frame = +2

Query: 425 QQREDDPDHVRNIQHARHVRRHPSRALAYAS-GRTTGIVLDSGDGVSHTVPIYEGYALPH 601
           QQ E   ++     H   +    S AL+  S GR TG+V + G  +++ VPI+E + L H
Sbjct: 111 QQLELITEYFIETFHVPSIAFISSAALSLLSTGRATGVVAECGYSITNVVPIFEFFGLEH 170

Query: 602 AILRLDFSRSRLTDYLMKILTERGYSFI-TNAXREIRS*TFKEKLCYV 742
           A +  +     +  YL  +L + G      NA  E+     KE+LCYV
Sbjct: 171 ARITANLGGQDVDLYLKSLLKKIGMGEADNNAVNEV-----KEQLCYV 213


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 468 TPAMYVAIQAVLS 506
            PA+   + A  S
Sbjct: 145 VPAVAFGVDAAFS 157



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66


>UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 210

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/78 (32%), Positives = 41/78 (52%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+    +GIV+D GD +   +P+ EG  +     RL +   ++TD L + LTE+G+ F +
Sbjct: 74  YSYSAVSGIVVDVGDHID-VIPVVEGCIIESGATRLPYGGRQVTDTLARHLTEKGHRFFS 132

Query: 689 NAXREIRS*TFKEKLCYV 742
                +     KE+ CYV
Sbjct: 133 EVETYVAR-LIKEQACYV 149


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 41.1 bits (92), Expect = 0.035
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49



 Score = 36.3 bits (80), Expect(2) = 4e-04
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 488
           + P+L+TE   NP   REK  +I  E + TPA Y+A
Sbjct: 139 DSPLLMTECGWNPVKAREKTIEIAMEKWGTPAFYLA 174



 Score = 30.7 bits (66), Expect(2) = 4e-04
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +3

Query: 276 LTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 392
           L++  P+   GIV +WD  EK+W ++F + L      +P+
Sbjct: 72  LSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKSGNPL 111


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/48 (52%), Positives = 30/48 (62%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 249
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMG 50



 Score = 35.5 bits (78), Expect = 1.7
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 365
           Q +  + T +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 54  QGRLSVQTPEYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +3

Query: 303 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK---ANREKMTQIMFETFNTP 473
           G+  NWD +E  W + +  +L+V+PEE P+++T    N K   A  E+  ++ F+  N P
Sbjct: 75  GLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVP 134

Query: 474 AMYVAIQ 494
              + I+
Sbjct: 135 VFQIVIE 141


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 458
           LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLE 130

Query: 459 TFNTPAMYVA 488
                A Y+A
Sbjct: 131 GMQFEACYLA 140



 Score = 38.3 bits (85), Expect = 0.24
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/65 (36%), Positives = 42/65 (64%), Gaps = 1/65 (1%)
 Frame = +3

Query: 315 NWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 491
           N++ MEK++     ++ L V  ++HP+LLTE        REK T++MFE++N   M+++ 
Sbjct: 82  NFEAMEKLFEDISGSKALDVNFQDHPILLTEPNKIDSRYREKFTELMFESYNVYQMFLSK 141

Query: 492 QAVLS 506
           ++VLS
Sbjct: 142 RSVLS 146


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 3/83 (3%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREK 437
           RG +   +    GIV++WD +E +  H F        E   + P+++TEA  N   +R+ 
Sbjct: 109 RGHIRNAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYSRKT 168

Query: 438 MTQIMFETFNTPAMYVAIQAVLS 506
           M++++FE +N P++   I ++ S
Sbjct: 169 MSEMLFECYNAPSVVYGIDSLFS 191



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG+V+ S    +H +P+Y+  AL    +RL++      +YL K++  + Y+         
Sbjct: 199 TGLVVSSSYSATHLIPVYDSKALLSQAIRLNWGGWHAAEYLQKLIRLKYYTGFPGKLNSS 258

Query: 707 RS*TFKEKLCYV 742
           ++       CYV
Sbjct: 259 QAENMVRDFCYV 270



 Score = 36.3 bits (80), Expect = 0.98
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSY 243
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCY 103


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 3/78 (3%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 452
           L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP  +R  M+++M
Sbjct: 93  LRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANPNYSRMLMSELM 151

Query: 453 FETFNTPAMYVAIQAVLS 506
           FE +  P +  A+  +LS
Sbjct: 152 FECYGIPGIVYAVDGLLS 169


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL--DFSRSRLTDYLMKILTERG 673
           YA+G+TTG+V+D GDG   T    +GY LP  + R     + + +T YL ++L + G
Sbjct: 203 YATGQTTGVVVDVGDGAVSTAAAADGYVLPQCLQREADGATGAAVTSYLTRLLYQSG 259


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  + +    Q
Sbjct: 75  LAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQTHCDQ 134

Query: 447 IMFETFNTPAMYVAIQAVLSLTRPV 521
           I+FE +   + Y  +  V +  R +
Sbjct: 135 IVFEEYGFASYYRGLGPVFNAYRDI 159



 Score = 36.3 bits (80), Expect = 0.98
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 222
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63



 Score = 36.3 bits (80), Expect = 0.98
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           +++DSG   +   PI +G  L  AI RLD     +T+YL ++L+ R +  + N    +  
Sbjct: 178 LLIDSGYSHTTVTPILQGRPLHPAIRRLDVGGKLMTNYLTRLLSVRHFD-MRNEPYIVNE 236

Query: 713 *TFKEKLCY 739
              KE +CY
Sbjct: 237 --MKEAVCY 243


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 267 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMT 443
           R  + +K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A+R+K  
Sbjct: 66  RAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSL 125

Query: 444 QIMFETFNTPAMYVA 488
           +I+ E+    A Y+A
Sbjct: 126 EILLESMEFEACYLA 140



 Score = 36.3 bits (80), Expect = 0.98
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 210
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 3/80 (3%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 449
           TLK   +   V N+D  E ++ + F + L +  +   EHP+++TE   NP   R+ M+++
Sbjct: 92  TLKSAFDRDTVVNFDIQELVFDYIFMH-LGINTQGRVEHPLVVTEPACNPLQCRQMMSEL 150

Query: 450 MFETFNTPAMYVAIQAVLSL 509
           +FE +  P +   + ++ SL
Sbjct: 151 LFECYGVPRVAYGVDSLFSL 170


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 4/89 (4%)
 Frame = +2

Query: 494 SRALAYASGRTTGIVLDSGDGVSHTV--PIYEGYALPHAILRLDFSRSRLTDYLMKILTE 667
           S+  A AS     +V+DSG   SHTV  P+Y G  L   I RLD     LT+YL ++++ 
Sbjct: 196 SQPRAVASPAECLLVVDSG--YSHTVITPVYRGRPLQRGIRRLDLGGKHLTNYLKELVSM 253

Query: 668 RGYSFI--TNAXREIRS*TFKEKLCYVGS 748
           R Y+ +  T    E+     KE +C+V +
Sbjct: 254 RQYNMVDETYIMNEV-----KESVCFVSN 277



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 8/69 (11%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEAPLNPKANR 431
           +  + P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEAP    A +
Sbjct: 86  MLFRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPNALPALQ 145

Query: 432 EKMTQIMFE 458
           +   +I+ E
Sbjct: 146 KNADEIIME 154


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/77 (28%), Positives = 42/77 (54%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           LT+K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++F
Sbjct: 83  LTIKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLF 142

Query: 456 ETFNTPAMYVAIQAVLS 506
           E +N  ++   I ++ S
Sbjct: 143 ECYNIKSVVYGIDSLFS 159



 Score = 42.3 bits (95), Expect = 0.015
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           +++DNGS  C+AGFA D +P+ +F S+VG+
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGK 62


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           +E+G++ +W+  E++        +L       P+L+TE  L P   R+K+ +++FET   
Sbjct: 82  LENGVIVDWEGYEELLSRVARILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFETHRV 141

Query: 471 PAMYVAIQAVLSL 509
            A   A+  VLSL
Sbjct: 142 VATSFALSPVLSL 154



 Score = 40.7 bits (91), Expect = 0.046
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILT 664
           YASG  TG+ ++ G   SH  P+++G +L HA   LD   + LT +   +++
Sbjct: 155 YASGLGTGVAVELGHDQSHVAPVFQGLSLFHATHCLDVGGADLTRHFTSLMS 206


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GDE
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDE 56


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           +E+G++ N+D +   W + + N      +  +E P++LTE P N   N+   TQI FET 
Sbjct: 62  MENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPWNTSKNKLATTQIAFETL 121

Query: 465 NTP 473
             P
Sbjct: 122 EVP 124



 Score = 37.9 bits (84), Expect = 0.32
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 237
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L  K P E G + NWD  + +W + FYN       +  +LLT+ PL        + Q++F
Sbjct: 47  LVFKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPLTLPQVSANIDQVVF 106

Query: 456 ETF 464
           E +
Sbjct: 107 EEY 109


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 22/78 (28%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 452
           L+ P +  +  N +  E +  ++F + L V+ +   +HP++LTEA  NP  +R+ M++++
Sbjct: 94  LRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELL 152

Query: 453 FETFNTPAMYVAIQAVLS 506
           FE +  P +   I ++ S
Sbjct: 153 FECYGIPKVAYGIDSLFS 170


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDD 159
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit
           (Arp9), putative; n=20; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp9), putative -
           Aspergillus clavatus
          Length = 693

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 23/63 (36%), Positives = 34/63 (53%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           YPIE+G + +W     +  H  +N L   P   P++L   P+    +RE +TQ +FE F 
Sbjct: 146 YPIENGRIVDWPCFFALLTHV-HNTLS-PPFHTPIMLISEPVWSARDREAITQFVFEKFK 203

Query: 468 TPA 476
           TPA
Sbjct: 204 TPA 206


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 2/74 (2%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI--TNAXREI 706
           +V+DSG   +   P+Y G  L  AI RLD     LT+YL ++++ R Y+ +  T    E+
Sbjct: 198 LVVDSGYSHTTVTPLYRGQPLQRAIRRLDIGGKHLTNYLKEMVSMRQYNMVDETYIMNEV 257

Query: 707 RS*TFKEKLCYVGS 748
                KE +C+V +
Sbjct: 258 -----KEAVCFVSN 266



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 8/53 (15%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAP 410
           +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP
Sbjct: 86  MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAP 138


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 22/80 (27%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQ 446
           L L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP   R  M++
Sbjct: 58  LQLRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNPNYCRSLMSE 116

Query: 447 IMFETFNTPAMYVAIQAVLS 506
           ++FE ++ P +   + ++LS
Sbjct: 117 LLFECYDIPGLSYGVDSLLS 136



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           +  G+V NW+             +++ P E P+ L E  L+ K  R+K  + +FE+ N  
Sbjct: 79  LSQGMVNNWEQASNFIEQINKKLMQINPSETPLFLIEQALSTKDVRQKCVEAVFESMNFA 138

Query: 474 AMYVAIQAVLS 506
           A+++    VLS
Sbjct: 139 ALFIHKAPVLS 149



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           +Y   + T +++DSG   ++ VPI EGY     ++R D +   LT  L
Sbjct: 150 SYVLAKETILLVDSGAYSTYVVPIVEGYVNQKGVIRSDIAGEYLTKSL 197


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 20/69 (28%), Positives = 37/69 (53%)
 Frame = +3

Query: 300 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
           +G+V NW+  E +  H +   ++ A E+  V+  E        RE++ +++FET   PA+
Sbjct: 81  NGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAEPTHACIRQRERIGELLFETHGAPAL 140

Query: 480 YVAIQAVLS 506
            V+   VL+
Sbjct: 141 AVSPAVVLA 149



 Score = 38.3 bits (85), Expect = 0.24
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           D  V ++V D GS  CK GFAG+D P +++ S +G
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIG 39



 Score = 37.9 bits (84), Expect = 0.32
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 613
           AYA+GR TG+VLD GD  +   P+ +G      +LR
Sbjct: 150 AYANGRHTGVVLDVGDATTTAAPVLDGTVARSLVLR 185


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 42.7 bits (96), Expect = 0.011
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           +G+VLD G   +H     +G  +P  I RL+     LT+YL ++++ R ++ +  +   I
Sbjct: 187 SGVVLDCGFSFAHATAFVDGTEVPRGIKRLNLGGKALTNYLKELVSFRQWNMMDES-AVI 245

Query: 707 RS*TFKEKLCYV 742
                KEK+CYV
Sbjct: 246 ED--VKEKMCYV 255



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 21/77 (27%), Positives = 34/77 (44%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L+ P + G V +W+   +I        L V P    +++TE P      RE + +++F
Sbjct: 88  LALRRPCDRGYVVHWEQQREILDDALRRTLGVDPTRCDLIITEPPFALPRTREALDEMVF 147

Query: 456 ETFNTPAMYVAIQAVLS 506
           E F      V   A L+
Sbjct: 148 EYFGFRRALVTTPAKLT 164


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 41.9 bits (94), Expect = 0.020
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query: 240 LCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEE--HPVLLTEAP 410
           LC + A + R    +   IE G V +W+ ME++   ++ +EL +++ +E   P+LLTE  
Sbjct: 66  LCLKKAYNCRATTEVSRVIEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKM 122

Query: 411 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           L P+  R+K+ +I+ E     A++ A   VL+L
Sbjct: 123 LVPRTQRQKLAEILMEKHGVTAVHFAQSPVLAL 155



 Score = 38.7 bits (86), Expect = 0.18
 Identities = 28/89 (31%), Positives = 40/89 (44%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H  + P  AL YA+G  +G  ++ G    H VP+++GY L HA   L+      T  +
Sbjct: 144 AVHFAQSPVLAL-YAAGICSGTSVEMGYNACHVVPVFQGYPLFHATHMLNVGGDLCTRQM 202

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLC 736
           M    E       N   ++ S   KEK C
Sbjct: 203 MSTGPELPAMVHPNHRIDVWS-HLKEKYC 230


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 41.9 bits (94), Expect = 0.020
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM-------F 455
           +HGI  NW  +E+++ + +  EL+V P E P+++T   L    NRE  T+I+       F
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKVDPSELPLVIT---LPSMTNRELETKIVENYMELAF 143

Query: 456 ETFNTPAMYVAIQ 494
           E    P + + ++
Sbjct: 144 EKLKVPVLQIVVE 156


>UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 544

 Score = 41.9 bits (94), Expect = 0.020
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV-LLTEAPLN-PKAN 428
           A+ +   + + +P+  G V +W  M  +W++  ++ L +    +   +L   PL   +A 
Sbjct: 69  AERRGDDVAIFWPMRKGYVRDWQQMIALWNYVLFHLLPIRRSHNDSNILISLPLPVSRAT 128

Query: 429 REKMTQIMFETFNTPAMYVAIQAVLS 506
              +TQI FE FN+ A+ +A + +LS
Sbjct: 129 HAYLTQIFFEHFNSAAITIAEKPLLS 154


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 41.9 bits (94), Expect = 0.020
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 449
           ++K P +  +VTNWD ME +  ++  +   V       +P++LTE    P + R+ M +I
Sbjct: 98  SIKTPFDGPLVTNWDYMEVLLDYSLAHLGVVGDNGRLNNPLILTEPVGVPFSQRKNMYEI 157

Query: 450 MFETFNTPAMYVAIQAVLS 506
           +FE +  P +   I ++ S
Sbjct: 158 LFEAYQAPKVTFGIDSLFS 176



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 19/76 (25%), Positives = 36/76 (47%)
 Frame = +2

Query: 515 SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNA 694
           S   +G+V+ +G   +H +P+  G  +     R+DF   +   +L K+L+ +   F +  
Sbjct: 183 SSTASGLVIGTGHESTHVIPVLHGKGILSQTKRIDFGGHQAEQFLGKLLSLKYPYFPSKL 242

Query: 695 XREIRS*TFKEKLCYV 742
                S  F++  CYV
Sbjct: 243 NAHHTSNLFRD-FCYV 257


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.026
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +1

Query: 97  VAALVVDNGSGMCKAGFAGD 156
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 41.1 bits (92), Expect = 0.035
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +3

Query: 351 FYNELRVAPEEHPVLLTEAPL 413
           F  +LRVAPEEHPVLLTEAPL
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 41.5 bits (93), Expect = 0.026
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQ 446
           L+ + P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A R  + Q
Sbjct: 83  LSARSPYDGALVSNWTVAEEVLDYTF-AKLRVGSDGCVDNHIIMNELMSSPAAQRRNLQQ 141

Query: 447 IMFETFNTPAMYVAIQAVLS 506
           ++FE +   ++ + + A+ S
Sbjct: 142 VLFEGYGVRSVALGVDALFS 161


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 41.1 bits (92), Expect = 0.035
 Identities = 25/70 (35%), Positives = 34/70 (48%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           +VLD G G +H+VP  EG  +  A LR +   S L  YL  +   R  +   N   E+  
Sbjct: 200 LVLDCGFGATHSVPFVEGKPIQRAALRSNIGGSHLNAYLKNVSAIRTINLEFN---ELMV 256

Query: 713 *TFKEKLCYV 742
              KE+ CYV
Sbjct: 257 QHMKEESCYV 266



 Score = 39.1 bits (87), Expect = 0.14
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +1

Query: 109 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRA 264
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  GD+H A
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDDHGA 64


>UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23;
           Magnoliophyta|Rep: Actin-related protein 8 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 471

 Score = 41.1 bits (92), Expect = 0.035
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDFSRSRLTDYLMKILTERGYSFI 685
           YA+ RT+GIV++ G  V   +PI  G  +    +  + F   +LT +L + + E   SF 
Sbjct: 245 YAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENNISF- 303

Query: 686 TNAXREIRS*TFKEKLCYV 742
             +   +R  T KEKLCYV
Sbjct: 304 -QSLYTVR--TLKEKLCYV 319


>UniRef50_O94241 Cluster: Actin-like protein arp6; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein arp6 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 401

 Score = 41.1 bits (92), Expect = 0.035
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI--TNAXREI 706
           +V+DSG   +H +P+ +      A+ R+D     LT+YL ++++ R Y+ +  T    EI
Sbjct: 159 LVIDSGYSFTHIIPVIDFSVQEQAVKRVDVGGKLLTNYLKEVISYRKYNMMEETYIVNEI 218

Query: 707 RS*TFKEKLCYV 742
                KE +CYV
Sbjct: 219 -----KESVCYV 225


>UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 731

 Score = 40.3 bits (90), Expect = 0.060
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 464
           YPI +G +  W     +  H F     ++P  H P++    P+    +RE +TQ +FE F
Sbjct: 163 YPIRNGEIVEWSCFFALLSHIFKT---LSPPFHTPIMFIAQPVWTARDREAITQFVFEKF 219

Query: 465 NTPA 476
            TPA
Sbjct: 220 QTPA 223


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 40.3 bits (90), Expect = 0.060
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           P + G + NWD   ++W + F  E+ +V   +  +++TE   N  + +E M +I+FE + 
Sbjct: 59  PFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQ 118

Query: 468 TPAMYVAIQAVLSLTR 515
             A+       LS  R
Sbjct: 119 FQAVLRVNAGALSAHR 134


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 40.3 bits (90), Expect = 0.060
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIM 452
           +  + P E G++ NWD    IW   F  + L + P E  +L+TE   N     E   Q++
Sbjct: 58  IVYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFNLPNIAETYDQMI 117

Query: 453 FETFNTPAMYVAIQAVL 503
           FE F   + +    A L
Sbjct: 118 FEEFEFQSYFRCAPAAL 134



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI 685
           IV+D G   +H VPI +G  +   + R+D     LT++L  +++ R ++ I
Sbjct: 153 IVIDMGYSYTHVVPIRDGQIVWEHVKRIDVGGKLLTNHLKHLISFRQWNMI 203


>UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma cruzi
          Length = 372

 Score = 39.9 bits (89), Expect = 0.080
 Identities = 20/57 (35%), Positives = 32/57 (56%)
 Frame = +2

Query: 491 PSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           PS A   ASGRT+ +VLD G   + T  + +GYAL + +     +   +T  L+++L
Sbjct: 125 PSVAWTLASGRTSAVVLDVGHNQATTTAVLDGYALRNTVASSSLAGRSVTGRLIEML 181


>UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Actin
           - Pandalus platyceros
          Length = 179

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 572 PIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           P   G+ALPHAIL L +           ++TE+ YSF T A REI     KEKLCY+
Sbjct: 42  PSMIGFALPHAILVLTWL----------VVTEKSYSFTTIAEREIVC-DIKEKLCYI 87



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +3

Query: 456 ETFNTPAMY-VAIQAVLSLTRPV-VPPVSCWTPATVSPTPCPS 578
           E+F+TPAMY ++   + S + P+ +P VS  T   VSPT CPS
Sbjct: 1   ESFSTPAMYCISASRLSSPSTPLAIPLVSSVTLLMVSPTWCPS 43


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + G + NWD  + +W + F ++   V   E P+L+TE   N ++ +E M +I++E ++  
Sbjct: 65  QRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLFNFQSIQEAMLEILYEEYDCD 124

Query: 474 AM 479
           A+
Sbjct: 125 AV 126



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           +V+D G   +H VP  +G     AI R+D     LT++L +I++ R
Sbjct: 153 LVVDMGYSFTHVVPFVKGVKQKEAIRRIDVGGKLLTNHLKEIISYR 198


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 467
           +PI+ G + +W     +  H  YN L   P    +LL   P       EK+TQ  FE F 
Sbjct: 101 WPIQDGRIVDWPCFYALLTHV-YNTLN-PPFHTAILLIAQPAWTPREHEKLTQFFFEKFK 158

Query: 468 TPAMYVAIQAVLSLT 512
           TPA +  + A L+ T
Sbjct: 159 TPA-FGLMDAALATT 172


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +1

Query: 130 MCKAGFAGDDAPRAVFPSI 186
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 7/73 (9%)
 Frame = +3

Query: 303 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-------EKMTQIMFET 461
           G+  NW+ +EK W + F  +L+  P E PVL+T  P +   N        E+  +I FE 
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT-IPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 462 FNTPAMYVAIQAV 500
           F  P + +  +++
Sbjct: 132 FKIPYLQIVNESL 144


>UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 669

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 288 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 464
           +P+  G + N        HH  +N+L  +P  H PV+L   P     N E +TQ +FE F
Sbjct: 97  WPLREGRIENLPAFCAFLHHV-HNQL--SPTLHTPVMLIAQPSWTAKNHEDLTQFIFEKF 153

Query: 465 NTPAMYVAIQAV 500
            TPA+ +   A+
Sbjct: 154 RTPALCIMDSAL 165


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           E+P+L+TEAP N    REK  +I  ET+  PA +++   VL+
Sbjct: 145 ENPLLMTEAPWNSPKAREKAIEISMETWGVPAFWLSKTPVLA 186



 Score = 37.5 bits (83), Expect = 0.43
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_A4T104 Cluster: Conserved hypothetical proline rich
           protein precursor; n=2; Mycobacterium|Rep: Conserved
           hypothetical proline rich protein precursor -
           Mycobacterium gilvum PYR-GCK
          Length = 617

 Score = 39.1 bits (87), Expect = 0.14
 Identities = 32/109 (29%), Positives = 47/109 (43%)
 Frame = +3

Query: 369 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTP 548
           VA    P ++  AP +P   R    Q   +    PA   A + V +   P   P    TP
Sbjct: 450 VAAAPAPRVVQAAPQSPAPQRVVAKQAAPQAVPRPAA-PATETVAA-PAPSTTPTPTPTP 507

Query: 549 ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           ++ +PTP PS+  T +PTPS   T     + T +   +P+      PTP
Sbjct: 508 SS-TPTPTPSSTPTPTPTPSSTPTPTPTPTPTPTPTPTPTPTPTPTPTP 555


>UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 552

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 479 VRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKI 658
           + R PS  L YA   TTG+V+D G+ V+  VP+ +GY +  AI  + +   ++ D L   
Sbjct: 307 ITRQPSLIL-YAYDVTTGVVVDIGERVN-IVPVIDGYVVESAICSIPYGSQQMGDSLRAS 364

Query: 659 LT 664
           L+
Sbjct: 365 LS 366


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 222
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKG 99



 Score = 38.3 bits (85), Expect = 0.24
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 5/80 (6%)
 Frame = +3

Query: 282 LKYPIEHG--IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQ 446
           L+Y  + G  +V NWD ME +  + F     +      + P+++TE   N    R  M +
Sbjct: 117 LRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNE 176

Query: 447 IMFETFNTPAMYVAIQAVLS 506
           I+FE ++ P++   I ++ S
Sbjct: 177 ILFECYSAPSVAYGIDSLFS 196


>UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 724

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 38/151 (25%), Positives = 61/151 (40%), Gaps = 12/151 (7%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP----------EEHPVLLTEAPLNPKA 425
           L L+ P + GIV +W   + IW H   N L   P              V++TEA LN + 
Sbjct: 126 LHLRLPHQSGIVVDWAAQKTIWDHVLTNHLAKLPGGIAKRGKLLAGKAVIMTEAYLNLEP 185

Query: 426 NREKMTQIMFETFNTPAM-YVAIQAVLSL-TRPVVPPVSCWTPATVSPTPCPSTRDTHSP 599
            +     ++FE +   A+   +  A++ L T      +    P   +    PS ++  S 
Sbjct: 186 AQHATDLLLFEHYGAQAVSRTSAAALIGLGTNVFRSDLPLSRPTKAANLEAPSQKEASS- 244

Query: 600 TPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
            P  V    G  S     R S ++AT ++ T
Sbjct: 245 -PEIVMEQGGASSTKRPLRTSRASATTTINT 274


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.18
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 195
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_UPI0000E48649 Cluster: PREDICTED: similar to hyalin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           hyalin - Strongylocentrotus purpuratus
          Length = 405

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 24/67 (35%), Positives = 28/67 (41%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFS 662
           V + A   LT P   P    TP T   +  P+T  T   TPS   T    DS T S   +
Sbjct: 284 VTVNAASVLTTPASTPTVVTTPDTARESATPTTPTTSPTTPSTELTTPTTDSTTPSTMLT 343

Query: 663 PSAATRS 683
            SA T S
Sbjct: 344 TSATTES 350


>UniRef50_UPI0000660530 Cluster: Serine/threonine-protein kinase
           DCAMKL2 (EC 2.7.11.1) (Doublecortin- like and CAM
           kinase-like 2).; n=1; Takifugu rubripes|Rep:
           Serine/threonine-protein kinase DCAMKL2 (EC 2.7.11.1)
           (Doublecortin- like and CAM kinase-like 2). - Takifugu
           rubripes
          Length = 736

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = +3

Query: 459 TFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDS 638
           T ++ A     +    ++RP  PP S  TP++++ T  P    + S TPS     +G  S
Sbjct: 326 THSSKAQAFVSECKAKVSRPAGPPKSSKTPSSLTSTKAPPKGPSRSKTPSTANDASGSQS 385

Query: 639 QTTS*RFSPS 668
              S R SPS
Sbjct: 386 ARKSSRSSPS 395


>UniRef50_Q4JK70 Cluster: Group 15 allergen protein; n=3;
           Dermatophagoides|Rep: Group 15 allergen protein -
           Dermatophagoides pteronyssinus (House-dust mite)
          Length = 558

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 26/65 (40%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPC-PSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATR 680
           S T P   P +  TP+T +PTP  PST  T +PTP    T     S TT    +PS  + 
Sbjct: 429 STTTPT--PTTPSTPSTTTPTPTTPSTPSTTTPTP----TTPSTPSTTTPTPTTPSTTST 482

Query: 681 SLPTP 695
           + PTP
Sbjct: 483 TTPTP 487



 Score = 37.9 bits (84), Expect = 0.32
 Identities = 26/65 (40%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPC-PSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATR 680
           S T P   P +  TP+T +PTP  PST  T +PTP    T     S TT    +PS  + 
Sbjct: 416 STTTPT--PTTPSTPSTTTPTPTTPSTPSTTTPTP----TTPSTPSTTTPTPTTPSTPST 469

Query: 681 SLPTP 695
           + PTP
Sbjct: 470 TTPTP 474


>UniRef50_Q0V4N1 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 288

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +3

Query: 507 LTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           +T  V+PP S  T AT SPTP P+   T +PTP+
Sbjct: 76  VTTTVIPPTSKKTSATPSPTPTPTPTPTPTPTPT 109


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +3

Query: 306 IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 476
           ++ NWD ME +  + F     +      + P++LTE   N    R  M +I+FE ++ PA
Sbjct: 179 VIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIANLGYTRRMMNEILFECYSAPA 238

Query: 477 MYVAIQAVLS 506
           +   I ++ S
Sbjct: 239 VAYGIDSLFS 248



 Score = 36.7 bits (81), Expect = 0.74
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           +A+V+DNGS + KAG++ D +PR + P ++ + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYR 144


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 38.3 bits (85), Expect = 0.24
 Identities = 15/65 (23%), Positives = 37/65 (56%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++  ++ +W+   + +H+ F + L +  +E P+L+TE        R+ + +  +E F+ P
Sbjct: 88  LKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYRQTLLETFYENFDFP 147

Query: 474 AMYVA 488
           A+++A
Sbjct: 148 ALFLA 152



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 237
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_UPI0000E817D4 Cluster: PREDICTED: similar to glycoprotein
           Ib; n=2; Gallus gallus|Rep: PREDICTED: similar to
           glycoprotein Ib - Gallus gallus
          Length = 702

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 6/118 (5%)
 Frame = +3

Query: 354 YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPV 533
           YN+    P+ HP++ + +P+ P ++ E  T     T   P +      + +L  P + P 
Sbjct: 295 YNDEESTPK-HPLVASLSPVYPPSSEEPTTAP--HTPTQPPLTTVSPLLTTLAGPSLAPT 351

Query: 534 SCWT--PATVSPTPCP--STRDTHSPTPSCVWTLAGRDSQT--TS*RFSPSAATRSLP 689
           +  T  P+TV+P+  P  ST  T +P PS V       + T  T+ R +P   T SLP
Sbjct: 352 TFLTTPPSTVAPSTAPPASTSSTTTP-PSTVQPSQPPSTATFHTAPRSTPHTPTISLP 408


>UniRef50_UPI000065CAA6 Cluster: Homolog of Gallus gallus "Ovomucin
            alpha-subunit.; n=1; Takifugu rubripes|Rep: Homolog of
            Gallus gallus "Ovomucin alpha-subunit. - Takifugu
            rubripes
          Length = 1499

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 30/87 (34%), Positives = 39/87 (44%)
 Frame = +3

Query: 483  VAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFS 662
            V +  V  +T PV   V  +T  T SP+P  S R T   T + V T A  +  TT     
Sbjct: 940  VVVVPVTEMTHPVSDRVETFTKTTTSPSPSWSPRHTTVSTMALV-TTADVEGTTTQ---Q 995

Query: 663  PSAATRSLPTPXGKFVREHSRRSCATS 743
             S  + +LPT       + SR S ATS
Sbjct: 996  VSFTSAALPTTTSTTASDTSRVSAATS 1022


>UniRef50_Q196W0 Cluster: Putative uncharacterized protein; n=1;
           Aedes taeniorhynchus iridescent virus|Rep: Putative
           uncharacterized protein - Aedes taeniorhynchus
           iridescent virus
          Length = 212

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 24/63 (38%), Positives = 31/63 (49%)
 Frame = +3

Query: 564 TPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHSRRSCATS 743
           T  PS R T SP+PS   T +    +TT  R SPS  T   P+P G+  +      C  +
Sbjct: 49  TKSPSRRTTRSPSPSRRTTRSSPSRRTT--RSSPSRRTTRSPSPSGRRKQGGPAVYCGNN 106

Query: 744 ALD 752
           ALD
Sbjct: 107 ALD 109


>UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;
           Leishmania|Rep: Actin-related protein 2, putative -
           Leishmania major
          Length = 392

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 15/51 (29%), Positives = 32/51 (62%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL 661
           +A+G   G+V++ G+G+SH  P+++G+ L  A   +  +   +T+ L ++L
Sbjct: 125 FANGTERGVVVECGEGLSHCTPVFDGFVLATAQRVVGVAGRAVTERLGQVL 175


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 12/45 (26%), Positives = 29/45 (64%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTR 515
           +HP+++TE   NP  +R   ++++FE +N P++   + ++ + +R
Sbjct: 123 QHPIVMTERLANPLFSRAMTSELLFELYNAPSVAFGVDSLFAFSR 167


>UniRef50_A7F4E6 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 507

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +3

Query: 549 ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHSRR 728
           AT++P     T  T + T S   TLA   S T+S + S + AT +LPTP       +   
Sbjct: 249 ATITPPQITGTA-TATVTDSSSSTLAS--SNTSSGQLSAATATTNLPTPFDSGFTSNVTS 305

Query: 729 SCATSALDFRSRXLAXGCIPXSFL 800
           +C++  ++F +      C+P S L
Sbjct: 306 TCSSFMMNFLADDSFKACLPFSLL 329


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45



 Score = 35.5 bits (78), Expect(2) = 0.42
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 458
           +K  +++G V +WD  ++ W     N L +      P  LTE   N   NR+K  +++ E
Sbjct: 88  IKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLE 147

Query: 459 TFNTPAMYVA 488
                A Y++
Sbjct: 148 GLQFEACYLS 157



 Score = 21.0 bits (42), Expect(2) = 0.42
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +3

Query: 594 SPTPSCVWTLAGR 632
           SPTP+C+   +GR
Sbjct: 157 SPTPTCISFASGR 169


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 19/49 (38%), Positives = 28/49 (57%)
 Frame = +1

Query: 109 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGDE
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDE 471


>UniRef50_UPI0000F30951 Cluster: UPI0000F30951 related cluster; n=1;
           Bos taurus|Rep: UPI0000F30951 UniRef100 entry - Bos
           Taurus
          Length = 2119

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 22/62 (35%), Positives = 27/62 (43%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLP 689
           T  V P  S  T AT +PTP P+T +T +PT +         S TT      S  T   P
Sbjct: 127 TTTVTPSPSSATTATETPTPTPTTTETTTPTSTTTTGTPTPTSTTTGTTTPTSTTTTGTP 186

Query: 690 TP 695
            P
Sbjct: 187 PP 188


>UniRef50_Q7U3X4 Cluster: Putative uncharacterized protein; n=1;
            Synechococcus sp. WH 8102|Rep: Putative uncharacterized
            protein - Synechococcus sp. (strain WH8102)
          Length = 2014

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 5/84 (5%)
 Frame = +3

Query: 459  TFNTPAMYVAIQA--VLSLTRPVVPPVSCWTP---ATVSPTPCPSTRDTHSPTPSCVWTL 623
            T  TP    A  +      T P   P    TP   AT +PTP P+   T +PTPS   T 
Sbjct: 1549 TIRTPGFVAARSSGTTSDSTTPTPTPSVTPTPTPSATPTPTPTPTPTPTPTPTPSATPTP 1608

Query: 624  AGRDSQTTS*RFSPSAATRSLPTP 695
            +   + T S   +P+ +  + PTP
Sbjct: 1609 SPSATPTPSPSATPTPSPSATPTP 1632



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +3

Query: 516  PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
            P   P +  TP T +PTP P+   T +P+PS   T +   + T S   +P+ +  + PTP
Sbjct: 1622 PTPSPSATPTP-TPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTP 1680



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +3

Query: 516  PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
            P   P    TP T S TP PS   T +P+PS   T +   + T S   +P+ +  + PTP
Sbjct: 1630 PTPTPTPTPTP-TPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTP 1688



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = +3

Query: 516  PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
            P   P    TP T +PTP P+   T +P+PS   T +   + T S   +P+      PTP
Sbjct: 1582 PSATPTPTPTP-TPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTP 1640



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +3

Query: 516  PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
            P   P +  TP+  S TP P+   T +PTPS   T +   + T S   +P+ +  + PTP
Sbjct: 1614 PTPSPSATPTPSP-SATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTP 1672


>UniRef50_A7RGS9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 566

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 3/119 (2%)
 Frame = +3

Query: 348 TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
           T Y++ R        + T  P   +      T+   ++ +TP+     ++ +  T P  P
Sbjct: 246 TLYSDKRTTSHGFTGVYTAKPDTIQQTTLFSTEQTTQSASTPSTLT--KSTMITTHPTYP 303

Query: 528 PVSCWTPA---TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
                +P    T +P+P  ST DT SPT S   T +   +Q+T+   SP+ +T   P+P
Sbjct: 304 TTDTPSPTQSTTDTPSPTQSTTDTPSPTQSTTDTPSS--TQSTTDTPSPTQSTTDTPSP 360


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           P   G++ +      IW + F N++ ++P +  +L+TE  LNP + +  + +I+FE F
Sbjct: 44  PFSEGLLIDVSMENDIWEYIF-NKMNISPGDIGLLVTEPFLNPSSLQHSLFEIIFEQF 100


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.43
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 207
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 2/69 (2%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMFETF 464
           P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+  R+ + +  FE +
Sbjct: 106 PYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECY 164

Query: 465 NTPAMYVAI 491
             P++ + +
Sbjct: 165 EIPSVMIGV 173


>UniRef50_A6W8W6 Cluster: DNA polymerase III, beta subunit; n=1;
           Kineococcus radiotolerans SRS30216|Rep: DNA polymerase
           III, beta subunit - Kineococcus radiotolerans SRS30216
          Length = 391

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +1

Query: 667 ARLLVHYQRRXGNSFVNIQGEAVLRRLLTFEAGDWPXV 780
           A +++    R G  F+ I G+ V  +L+T +AGDWP +
Sbjct: 106 ASIILTLLHRSGREFLRIAGDGVTYQLITMDAGDWPAI 143


>UniRef50_Q54D31 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 644

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 26/64 (40%), Positives = 30/64 (46%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS 683
           SL  P +P  S     T SPTP P+   T SPTPS   T     S T S   SP+ +   
Sbjct: 170 SLACPYLPTPSPTQTPTPSPTPSPTPSPTPSPTPSP--TQTPTLSPTPSPTPSPTPSPTQ 227

Query: 684 LPTP 695
            PTP
Sbjct: 228 TPTP 231


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 4/119 (3%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +++G  +G+ ++ G  V+  VPIY+G+ + HA+     S + +T  L   L  R Y  + 
Sbjct: 152 FSTGLVSGLSIELGHAVNTIVPIYQGFPIMHALEFSHISGAEITQCLENDL--RCYETLI 209

Query: 689 NAXREIRS----*TFKEKLCYVGS*LSKQXIGXRLHSKXFPFEESSYXXFPERFKVIQP 853
           +   E          KE +CY+ S    Q          F  EE SY    E+   I P
Sbjct: 210 DKFSEEEKQWIIKDIKENMCYIASDYEMQ----MQSEDNFTEEERSYELPDEQVIQITP 264



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 18/85 (21%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANRE 434
           + K+  + L  PI+ G + N + M++ W +   + L+++  ++  +L+ +   N K  + 
Sbjct: 67  KEKKLNVQLSNPIKDGKIDNVESMKEFWQYILEDGLQISELQQVNLLIIDQVKNSKEYKS 126

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           K+ ++ F+     ++     A LSL
Sbjct: 127 KLAEVFFDYLKVQSVLFMNSASLSL 151


>UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n=1;
           Schizosaccharomyces pombe|Rep: SWI/SNF and RSC complex
           subunit Arp9 - Schizosaccharomyces pombe (Fission yeast)
          Length = 523

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 4/77 (5%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 458
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 459 TFNTPAMYVAIQAVLSL 509
               P   +A + ++ L
Sbjct: 172 ECQVPGFTIAYEPLMGL 188


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 37.1 bits (82), Expect = 0.56
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>UniRef50_Q2JP36 Cluster: Protein kinase; n=2; Synechococcus|Rep:
           Protein kinase - Synechococcus sp. (strain
           JA-2-3B'a(2-13)) (Cyanobacteria bacteriumYellowstone
           B-Prime)
          Length = 746

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 516 PVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P   PV   TP  T +PTP P+   T +PTP+   T     + T   RF+P       PT
Sbjct: 559 PTPTPVPTPTPTPTPTPTPAPTPTPTPTPTPTPAPTPTPTPTLTPIPRFTPLVPRTPTPT 618

Query: 693 P 695
           P
Sbjct: 619 P 619


>UniRef50_Q3DVE9 Cluster: Putative Ig; n=2; cellular organisms|Rep:
           Putative Ig - Chloroflexus aurantiacus J-10-fl
          Length = 432

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 3/85 (3%)
 Frame = +3

Query: 495 AVLSLTRPVVPPVSCWTP---ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSP 665
           +V + T P     +  TP   AT S TP PS   + +P+PS   +     S T S   SP
Sbjct: 17  SVTASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSP 76

Query: 666 SAATRSLPTPXGKFVREHSRRSCAT 740
           SA   + P P        S  +  T
Sbjct: 77  SATASATPEPTASVTPSPSATASTT 101



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +3

Query: 549 ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           AT S TP PS   + +P+PS   +     S T S   SPSA   + P+P
Sbjct: 8   ATASTTPSPSVTASTTPSPSATASTTPSPSATASTTPSPSATASTTPSP 56



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSL 686
           T P     +  TP  T S TP PS   + +P+PS   ++    S T S   SPSA   + 
Sbjct: 72  TTPSPSATASATPEPTASVTPSPSATASTTPSPSATASVTPSPSATASVTPSPSATASTT 131

Query: 687 PTP 695
           P P
Sbjct: 132 PEP 134



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 4/80 (5%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVP-PVSCWTP---ATVSPTPCPSTRDTHSPTPSCVWTLAGRD 635
           +P+   ++    S T    P P +  TP   AT S TP PS   + +P+PS   T +   
Sbjct: 113 SPSATASVTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASTTPSPSA--TASTTP 170

Query: 636 SQTTS*RFSPSAATRSLPTP 695
             T S   SPSA     P+P
Sbjct: 171 EPTASVTPSPSATASVTPSP 190



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 24/75 (32%), Positives = 33/75 (44%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTT 647
           TP+      A    T  V P  S    AT S TP PS   + +P+PS   ++    S T 
Sbjct: 73  TPSPSATASATPEPTASVTPSPS----ATASTTPSPSATASVTPSPSATASVTPSPSATA 128

Query: 648 S*RFSPSAATRSLPT 692
           S    P+A+T   P+
Sbjct: 129 STTPEPTASTTPSPS 143



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 32/118 (27%), Positives = 42/118 (35%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           P     A   P A+          T  +P+   ++    S T  V P  S    AT S T
Sbjct: 76  PSATASATPEPTASVTPSPSATASTTPSPSATASVTPSPSATASVTPSPS----ATASTT 131

Query: 567 PCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHSRRSCAT 740
           P P+   T  P+PS   +     S T S   SPSA   + P P        S  +  T
Sbjct: 132 PEPTASTT--PSPSATASTTPSPSATASTTPSPSATASTTPEPTASVTPSPSATASVT 187



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = +3

Query: 549 ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           AT S TP PS   + +P+PS   T +     T S   SPSA   + P+P
Sbjct: 58  ATASTTPSPSATASTTPSPSA--TASATPEPTASVTPSPSATASTTPSP 104


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43



 Score = 35.9 bits (79), Expect = 1.3
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 357 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP-AMYVAIQAVLS 506
           N L V PE   + LTEA L P  +R+   +I+FE F  P A +++ Q   S
Sbjct: 128 NYLSVIPESSSICLTEANLCPAQSRQLSAEIIFEDFGFPLACFLSSQTASS 178


>UniRef50_Q0UPJ7 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 639

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +3

Query: 513 RPVVPPVSCWTPATVSPTPCPS-TRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLP 689
           +P   P   ++P++ SP P PS +    S TP+ V   AG  + T     S  A +RS  
Sbjct: 472 QPSDVPSFTFSPSSASPAPAPSASAPASSVTPAPVLPSAGPSNST-----SVPAQSRSSV 526

Query: 690 TPXGKFVREHSRRSCATS 743
            P G+F  + S +SC  S
Sbjct: 527 KPGGEFGEKPSSKSCTKS 544


>UniRef50_O10341 Cluster: Uncharacterized 29.3 kDa protein; n=7;
           Nucleopolyhedrovirus|Rep: Uncharacterized 29.3 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 279

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 25/61 (40%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 516 PVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P   P    TP+ T SPTP PS   T SPTPS   +     S T S   +PS      PT
Sbjct: 111 PSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPT 170

Query: 693 P 695
           P
Sbjct: 171 P 171



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P   P    TP+  +PTP P+   T +PTPS   T A   + T S   SP+ +    P+P
Sbjct: 41  PTPSPTPTPTPSP-TPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSP 99



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 22/60 (36%), Positives = 28/60 (46%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P   P    TP T +PTP P+     SPTP+   TL+   S T +   +PS      PTP
Sbjct: 53  PTPTPTPTPTP-TPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTP 111



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 25/60 (41%), Positives = 28/60 (46%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P   P    TP T SPTP PS   T SPTPS   T +   S T +   +PS      PTP
Sbjct: 119 PTPSPTPSPTP-TPSPTPTPSP--TPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTP 175



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 516 PVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P   P    TP+ T SPTP PS   + +PTPS   +     S T +   +PS      PT
Sbjct: 91  PSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPT 150

Query: 693 P 695
           P
Sbjct: 151 P 151



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +3

Query: 516 PVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P   P    TP+ T SPTP PS   + +PTPS   +     S T S    PS      P+
Sbjct: 131 PSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSPTPPPSPS 190

Query: 693 PXG 701
           P G
Sbjct: 191 PLG 193



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +3

Query: 516 PVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
           P   P    TP+ T +P+P PS   T SPTP+   T +   S T +   +PS      PT
Sbjct: 105 PSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPT 164

Query: 693 P 695
           P
Sbjct: 165 P 165



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 22/60 (36%), Positives = 28/60 (46%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P   P    TP+  +P+P PS   T SPTPS   T +   S T +   +PS      PTP
Sbjct: 127 PTPTPSPTPTPSP-TPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSPTP 185


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 36.7 bits (81), Expect = 0.74
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 474 AMYVAIQAVLS 506
            +Y    A L+
Sbjct: 124 GVYKTTAADLA 134


>UniRef50_A4X4V1 Cluster: Putative uncharacterized protein; n=1;
           Salinispora tropica CNB-440|Rep: Putative
           uncharacterized protein - Salinispora tropica CNB-440
          Length = 3437

 Score = 36.3 bits (80), Expect = 0.98
 Identities = 31/128 (24%), Positives = 51/128 (39%), Gaps = 3/128 (2%)
 Frame = +3

Query: 372 APEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPA 551
           AP + P L    P +  A+    T +      +    V+  A  S   P     S   PA
Sbjct: 450 APSQTPALRPTPPTSTSASVPTPTPVYASASTSAPASVSAPASTSAPAPASTSASASRPA 509

Query: 552 TVS---PTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGKFVREHS 722
           +VS   PT  P+     +PTP+   T A   + T++   +P++ + S   P        +
Sbjct: 510 SVSAAAPTSAPAPTSAPAPTPAPASTSAPAPASTSA--PAPASTSASASRPASVSAAAST 567

Query: 723 RRSCATSA 746
             + +TSA
Sbjct: 568 SAAASTSA 575



 Score = 33.9 bits (74), Expect = 5.3
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 3/85 (3%)
 Frame = +3

Query: 465  NTPAMYVA-IQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQ 641
            +TPA   A   A  S   P   P    TPAT +P P P++    +P P    T A     
Sbjct: 1448 STPASTPAPASAPASTPAPASTPAPASTPAT-APAPTPTSASRSAPAPVSAPTSASTSVS 1506

Query: 642  TTS*RFSPSAATRSLP--TPXGKFV 710
             ++   +P++ + S P  TP   +V
Sbjct: 1507 ASTPASTPASTSASAPASTPASTYV 1531


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 36.3 bits (80), Expect = 0.98
 Identities = 19/70 (27%), Positives = 35/70 (50%)
 Frame = +3

Query: 303 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 482
           G+ T+W+ +E+     +  +LRV PEE PV +T  P      R +  +++      P + 
Sbjct: 65  GVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDLSATVRSQFHELVLCKLRAPVLQ 124

Query: 483 VAIQAVLSLT 512
           + I   L++T
Sbjct: 125 L-ISEPLAVT 133



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +2

Query: 500 ALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTER 670
           A+  + GR+T +V+D G       PI +G  +   ILR  ++   L   LMK L +R
Sbjct: 131 AVTLSLGRSTALVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDR 187


>UniRef50_UPI0000EBC3B8 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Bos taurus|Rep: PREDICTED: hypothetical
           protein, partial - Bos taurus
          Length = 345

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +3

Query: 513 RPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTT 647
           RP  PP +   P + SPTP    R   SP+P   W L+GR S  +
Sbjct: 95  RPTQPPPTAGFPVSSSPTP--RLRTWPSPSPRTPWVLSGRTSSAS 137


>UniRef50_A7H9N7 Cluster: Heavy metal translocating P-type ATPase;
           n=2; Anaeromyxobacter|Rep: Heavy metal translocating
           P-type ATPase - Anaeromyxobacter sp. Fw109-5
          Length = 944

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +3

Query: 492 QAVLSLTRPVVPPVSCWTP-ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPS 668
           + V++  R    P    TP AT +PTP P+   T +PTP+   T     + T +   +P+
Sbjct: 576 RGVVATVRATPTPTPTATPTATPTPTPTPTPTPTPTPTPTPTSTSTPTPTPTPTPTATPT 635

Query: 669 AATRSLPTP 695
                 PTP
Sbjct: 636 PTPTPTPTP 644



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 22/80 (27%), Positives = 34/80 (42%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS 683
           S   P   P    TP T +PTP P+   T +PTP+   T     + T +   +P++   S
Sbjct: 620 STPTPTPTPTPTATP-TPTPTPTPTPTPTPTPTPTPTPTSTSTSTSTPTPTPTPTSTPTS 678

Query: 684 LPTPXGKFVREHSRRSCATS 743
            PT         +  + +TS
Sbjct: 679 TPTSTSTSTSTSTSTATSTS 698



 Score = 33.1 bits (72), Expect = 9.2
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P   P    TP T +PTP P++  T +PTP+   T     + T +   +P+      PTP
Sbjct: 598 PTPTPTPTPTP-TPTPTPTPTSTSTPTPTPTPTPTATPTPTPTPTPTPTPTPTPTPTPTP 656


>UniRef50_A4XIG4 Cluster: Type 3a, cellulose-binding domain protein
           precursor; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Type 3a, cellulose-binding domain protein
           precursor - Caldicellulosiruptor saccharolyticus (strain
           ATCC 43494 / DSM 8903)
          Length = 931

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 519 VVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           +VP  +  +  T SPTP P+   T +PTP+   T+    + T +   +P+      PTP
Sbjct: 763 IVPTSAPVSTTTASPTPTPTPASTVTPTPTPTPTVTPTPTPTPTPTSTPTVTPTPTPTP 821


>UniRef50_A4XC59 Cluster: NLP/P60 protein precursor; n=2;
           Salinispora|Rep: NLP/P60 protein precursor - Salinispora
           tropica CNB-440
          Length = 517

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 24/64 (37%), Positives = 29/64 (45%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS 683
           S   P   P S  +P T SPT  PS   + SP P+   +     + T S   SPSAA  S
Sbjct: 432 STPSPSTSPTSTPSPTT-SPTNTPSPTTSPSPPPTSTPSPTTSPTNTPSPTTSPSAAPTS 490

Query: 684 LPTP 695
            P P
Sbjct: 491 TPPP 494


>UniRef50_Q54CA1 Cluster: Putative uncharacterized protein; n=2;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1269

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +3

Query: 543  TPATVSPTPCP-STRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
            TP T  PTP P +T+ T +PTP+   T     + TT+   +P+  T   PT
Sbjct: 1062 TPTTKIPTPTPTTTKTTTTPTPTTTPTTTTTTTTTTTTTTTPTPTTTPTPT 1112


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           +HP+++TE     K  R+   +I+FE  + PA Y+A +A LS
Sbjct: 126 QHPMMVTEPTAECKQFRDCTLEILFEQLDVPAAYLAKRATLS 167



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSF 682
           A++ GR + +V+D G G S   P++EG +L   I       + L   L  IL +RG+ F
Sbjct: 168 AFSVGRQSAMVVDIGAGGSIASPVHEGISLQSTIQTSMVGGNALDMELCDILYKRGHEF 226


>UniRef50_Q4WZL9 Cluster: Ubiquitin conjugating enzyme (UbcF),
           putative; n=4; Trichocomaceae|Rep: Ubiquitin conjugating
           enzyme (UbcF), putative - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 312

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 27/83 (32%), Positives = 35/83 (42%), Gaps = 2/83 (2%)
 Frame = +3

Query: 360 ELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPAMYVAIQAVLSLTRPVVPPVS 536
           E    PE  P   T+A  N  A  E  T+    E+   P+ +   Q  + +  P VP   
Sbjct: 198 EAEPTPERDPEDTTDANANANAETETGTESSQKESEPRPSKHATPQQQVQVPVPSVPSAP 257

Query: 537 CWTPATVSPTPCPSTRDTHS-PT 602
             TPA    TP P+T  T S PT
Sbjct: 258 APTPAPTHTTPVPTTTATTSQPT 280


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = +3

Query: 363 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           L +A  E+P+L+TE+P N    REK  ++  E +  PA ++    VL+
Sbjct: 95  LELALGENPLLMTESPWNTPKAREKAIELAMEGWGVPAFWLTKTPVLA 142


>UniRef50_UPI0001553895 Cluster: PREDICTED: similar to C6orf205
           protein; n=2; Mus musculus|Rep: PREDICTED: similar to
           C6orf205 protein - Mus musculus
          Length = 1210

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 22/77 (28%), Positives = 33/77 (42%)
 Frame = +3

Query: 465 NTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQT 644
           +TP       +  S + P     +  T +  +PTP  +   T S +   + T A R S  
Sbjct: 264 STPTRTTTTSSTASRSTPTPTTTASSTASGSTPTPTTTVSSTGSGSTPTLTTTASRSSTP 323

Query: 645 TS*RFSPSAATRSLPTP 695
           T    + S A+RS PTP
Sbjct: 324 TWTTTTSSTASRSTPTP 340


>UniRef50_UPI0000E45E2F Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 254

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 27/81 (33%), Positives = 35/81 (43%), Gaps = 2/81 (2%)
 Frame = +3

Query: 459 TFNTPAMYVAIQ-AVLSLTRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGR 632
           T  TPA   A   A  + T P   P +  TPA T S TP P+T  T +PT +        
Sbjct: 79  TATTPAPTTATTPAPTTATTPA--PTTATTPAPTTSTTPAPTTATTPAPTTATTTAPMTA 136

Query: 633 DSQTTS*RFSPSAATRSLPTP 695
            +  TS    P+  T + P P
Sbjct: 137 TTPATSTATKPAPTTAAKPAP 157


>UniRef50_Q605T0 Cluster: Putative uncharacterized protein; n=2;
           Methylococcus capsulatus|Rep: Putative uncharacterized
           protein - Methylococcus capsulatus
          Length = 429

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 474 AMYVAIQAVLSLTRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS 650
           A+ + I     L  P   P +  TPA T +PTP PS     + TP+   T A   +   +
Sbjct: 130 AVALEIGGAADLGAPTPAPTATPTPAPTATPTPAPSATPAPTTTPAPTATPAPTGTPAPT 189

Query: 651 *RFSPSAATRSLPTP 695
            + SP+ A  + P P
Sbjct: 190 PKPSPTPAPTATPRP 204


>UniRef50_Q2J4M7 Cluster: Putative uncharacterized protein; n=3;
           Frankia|Rep: Putative uncharacterized protein - Frankia
           sp. (strain CcI3)
          Length = 533

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 22/72 (30%), Positives = 28/72 (38%)
 Frame = +3

Query: 393 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPC 572
           L  EA    ++     TQ   +T N P  +        L  P VPP +   P    PTP 
Sbjct: 407 LFVEAGALRRSRLAARTQFRADTRNRPPAHNDPDTTKPLGHPGVPPQAPMPPPIPMPTPT 466

Query: 573 PSTRDTHSPTPS 608
           P    T  PTP+
Sbjct: 467 PMPTPTPMPTPT 478


>UniRef50_A6W8I7 Cluster: ABC transporter CydDC cysteine exporter
           (CydDC-E) family permease/ATP- binding protein CydD;
           n=1; Kineococcus radiotolerans SRS30216|Rep: ABC
           transporter CydDC cysteine exporter (CydDC-E) family
           permease/ATP- binding protein CydD - Kineococcus
           radiotolerans SRS30216
          Length = 1120

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +3

Query: 471 PAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAG 629
           PA+  A     +LTRP  PP S   PA ++P+P P+   + +  P  V  LAG
Sbjct: 522 PALLAAADRTTTLTRPAAPPAS---PA-MAPSPAPARPGSGAARPGAVADLAG 570


>UniRef50_A0G3S3 Cluster: Putative uncharacterized protein
           precursor; n=4; Burkholderia|Rep: Putative
           uncharacterized protein precursor - Burkholderia
           phymatum STM815
          Length = 772

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +3

Query: 489 IQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPS 668
           ++AV +   P   P    TP T +PTP P+   T +PTP+   T     + T S   SPS
Sbjct: 122 VRAVAATPTPTPTPTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPAPSPS 180

Query: 669 A-ATRSLPTPXGK 704
           A +T S   P  K
Sbjct: 181 AGSTLSCGAPTQK 193


>UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep:
            Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 2146

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 528  PVSCWTPATVSPTPCPSTRDTHSPTPSCV--WTLAGRDSQTTS*RFSPSAATRSLPTP 695
            P S   P T SPTP P+   T SPTPS     T     S T +   +P+  T S PTP
Sbjct: 1858 PPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTP 1915


>UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 410

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query: 485 RHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL---MK 655
           +H +    YA G  TG+V+D G   +  +P++EG+ +  ++         LT+ L   MK
Sbjct: 143 QHDASLACYAHGIHTGVVVDYGWSCARAIPVFEGHPITQSVQIHPLGGLELTNLLFEKMK 202

Query: 656 ILTERGYSFI 685
              ++ Y+F+
Sbjct: 203 QNNKQIYTFL 212


>UniRef50_Q8WWQ4 Cluster: Mucin 5; n=5; Catarrhini|Rep: Mucin 5 - Homo
            sapiens (Human)
          Length = 1349

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = +3

Query: 456  ETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSP--TPSCVWTLAG 629
            +T  T A   +  +    T   VP  S  + +T S T  P+T  T  P  TPS V + + 
Sbjct: 1182 QTSKTSAATSSTTSGSGTTPSPVPTTSTTSASTTSTTSAPTTSTTSGPGTTPSPVPSTSI 1241

Query: 630  RDSQTTS*RFSPSAATRSLPT 692
              + TTS   +P+  T S PT
Sbjct: 1242 TSAATTSTTSAPTTRTTSAPT 1262



 Score = 35.1 bits (77), Expect = 2.3
 Identities = 42/161 (26%), Positives = 60/161 (37%), Gaps = 11/161 (6%)
 Frame = +3

Query: 297  EHGIVTNWDDMEKIWHHTFYNELRV----APEEHPVLLTE--APLNPKANREKMTQIM-- 452
            E G+V    D +  +      E+RV     P+  PV  T   AP  P       TQ    
Sbjct: 1000 EEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVTSTPVTAPSTPSGRATSPTQSTSS 1059

Query: 453  FETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAG 629
            ++   T  +          T     P +   PA T S T  P+T  T +PT S       
Sbjct: 1060 WQKSRTTTLVTTSTTSTPQTSTTSAPTTSTIPASTPSTTSAPTTSTTSAPTTSTTSAPTH 1119

Query: 630  RDSQ--TTS*RFSPSAATRSLPTPXGKFVREHSRRSCATSA 746
            R +   TTS   +P+ +T S PT         S  S +T++
Sbjct: 1120 RTTSGPTTSTTLAPTTSTTSAPTTSTNSAPTTSTISASTTS 1160



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 2/100 (2%)
 Frame = +3

Query: 399  TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPS 578
            T AP +  +     T     T  T A   +  +  + +    P  S  +  T S TP P 
Sbjct: 737  TSAPTSTSSAPTTNTTSAPTTSTTSAPITSTISAPTTSTTSTPQTSTISSPTTSTTPTPQ 796

Query: 579  TRDTHSPTPSCVW--TLAGRDSQTTS*RFSPSAATRSLPT 692
            T  T SPT S     T +   + TTS   +P  +  S PT
Sbjct: 797  TSTTSSPTTSTTSAPTTSTTSAPTTSTTSTPQTSISSAPT 836


>UniRef50_Q4P3I7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 2091

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 4/98 (4%)
 Frame = +3

Query: 465 NTPAMYVAIQAVLSLTRPV---VPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRD 635
           N+PA+  +I  V  + RP    VPP   +  A VS +P PS R+  SP      + AG D
Sbjct: 434 NSPAVDESISPVEVVIRPPSSPVPPHLSFQSAQVSRSPAPSFREALSPA-----SAAGVD 488

Query: 636 SQTTS*RFSPSAATRSL-PTPXGKFVREHSRRSCATSA 746
           + T +   S +A++  L P+     +  H   S AT+A
Sbjct: 489 AHTYAAAPSEAASSPGLNPSSSTASLTSHYAHSTATNA 526


>UniRef50_UPI0000EBC89F Cluster: PREDICTED: similar to Complement
           component 1, r subcomponent; n=1; Bos taurus|Rep:
           PREDICTED: similar to Complement component 1, r
           subcomponent - Bos taurus
          Length = 604

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 29/107 (27%), Positives = 44/107 (41%)
 Frame = +3

Query: 375 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPAT 554
           P   P  +  A   P A     T     T N+ ++  A  +   +  P+  P       T
Sbjct: 443 PTTTPTPIAPATSTPTATT---TTTATPTSNSTSIPTATSSATLVNTPITTP-------T 492

Query: 555 VSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
            + TP P+T  T +PTPS   T A   + TT+   +P++   S  TP
Sbjct: 493 ATTTPSPTTPYTATPTPSLTPTPASTPTATTTTTPTPTSTFTSTATP 539



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +3

Query: 465 NTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQT 644
           +TP       A  +     +P  +  + AT+  TP  +   T +P+P+  +T     S T
Sbjct: 455 STPTATTTTTATPTSNSTSIPTAT--SSATLVNTPITTPTATTTPSPTTPYTATPTPSLT 512

Query: 645 TS*RFSPSAATRSLPTPXGKF 707
            +   +P+A T + PTP   F
Sbjct: 513 PTPASTPTATTTTTPTPTSTF 533


>UniRef50_UPI0000E49F3E Cluster: PREDICTED: similar to
           HLA-B-associated transcript 3; n=6; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to HLA-B-associated
           transcript 3 - Strongylocentrotus purpuratus
          Length = 1195

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 22/72 (30%), Positives = 30/72 (41%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTT 647
           TPA         + T P  P  S W+P  V  T   ST  + +P  S   +  G  SQ T
Sbjct: 97  TPATPTTTSTTPASTAPATPTTSSWSPMEVDST---STTTSAAPATSAATSTTGSGSQAT 153

Query: 648 S*RFSPSAATRS 683
           S     +++T S
Sbjct: 154 SATTGTNSSTSS 165


>UniRef50_Q4SLF6 Cluster: Chromosome 7 SCAF14557, whole genome shotgun
            sequence; n=2; Tetraodontidae|Rep: Chromosome 7
            SCAF14557, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1886

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 465  NTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTL-AGRDSQ 641
            + P+   AI A   +T PVVPP++C   A  +  P P       P P+    L   RD+ 
Sbjct: 973  SVPSKLAAIMAGPPVTTPVVPPLACSPIAAAAAAPVPPAALAQGPVPTSAAVLDLSRDTD 1032

Query: 642  T 644
            +
Sbjct: 1033 S 1033


>UniRef50_Q9FC63 Cluster: Putative acyltransferase; n=1;
           Streptomyces coelicolor|Rep: Putative acyltransferase -
           Streptomyces coelicolor
          Length = 417

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQT 644
           TPA   A     +   P VPP +   PA  +P P P+T    +P P+ V      D+ +
Sbjct: 116 TPAPAPAPAPAPAPAEPFVPPAASAVPAPPAPAPAPTTPQAPAPAPAPVRAAPAEDASS 174


>UniRef50_Q9RFX5 Cluster: Multidomain beta-1,4-mannanase precursor;
           n=1; Caldibacillus cellulovorans|Rep: Multidomain
           beta-1,4-mannanase precursor - Caldibacillus
           cellulovorans
          Length = 930

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +3

Query: 519 VVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS 650
           + PP S  TP T +PTP P++  T +PTPS   T+    + T S
Sbjct: 243 ITPPPSGTTP-TPTPTPTPTSTPTPTPTPSVTPTVTPTSTPTPS 285


>UniRef50_A5CQA6 Cluster: Putative uncharacterized protein; n=1;
           Clavibacter michiganensis subsp. michiganensis NCPPB
           382|Rep: Putative uncharacterized protein - Clavibacter
           michiganensis subsp. michiganensis (strain NCPPB 382)
          Length = 1152

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +3

Query: 519 VVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           V  P    TP T +PTP P+   T +PTP+   T+A   + T +   +P+ A    PTP
Sbjct: 276 VPAPTPTATPTT-APTPTPTVAPTQAPTPTPTPTVAPTQAPTPT--PTPTVAPTQAPTP 331



 Score = 34.7 bits (76), Expect = 3.0
 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 4/67 (5%)
 Frame = +3

Query: 459 TFNTPAMYVA-IQAVLSLTRPVVPPVSCWTPA---TVSPTPCPSTRDTHSPTPSCVWTLA 626
           T  TP   VA  QA      P V P    TP    TV+PT  P+   T +PTP+   T A
Sbjct: 287 TAPTPTPTVAPTQAPTPTPTPTVAPTQAPTPTPTPTVAPTQAPTPTPTPTPTPTVAPTTA 346

Query: 627 GRDSQTT 647
              + TT
Sbjct: 347 PTPAPTT 353



 Score = 33.5 bits (73), Expect = 6.9
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P V P    TP T +PT  P+   T +PTP+   T A   + T +   +P+ A  + PTP
Sbjct: 293 PTVAPTQAPTP-TPTPTVAPTQAPTPTPTPTVAPTQAPTPTPTPT--PTPTVAPTTAPTP 349


>UniRef50_Q6YVF6 Cluster: Putative uncharacterized protein
           P0758B01.26; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0758B01.26 - Oryza sativa subsp. japonica (Rice)
          Length = 212

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 28/64 (43%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPS--AAT 677
           S  RP  PP S   PA   PTPC   R   +PT S  WT A   S+ TS   S S  A+T
Sbjct: 151 SRPRPSPPPCSP-APALSPPTPCSPGRMATAPTTS--WTTAMTPSRPTSSSASLSTPAST 207

Query: 678 RSLP 689
            S P
Sbjct: 208 ASAP 211


>UniRef50_Q2HGF8 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 976

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 486 AIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           A+ +VL+ +RP  PPV    PA+VS TP P+     +P P+
Sbjct: 314 ALASVLAASRPPTPPVK---PASVSATPVPAPTPVPAPAPT 351


>UniRef50_A4WK20 Cluster: Metallophosphoesterase precursor; n=4;
           Pyrobaculum|Rep: Metallophosphoesterase precursor -
           Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321)
          Length = 641

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 21/74 (28%), Positives = 25/74 (33%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           P   T     P        Q    T    A   A     + T P   P +   PAT  PT
Sbjct: 528 PTTTTPPTPTPPPTTTTTPQTTTVTTTPSATPTATPTTQTATSPTATPSATAPPATTQPT 587

Query: 567 PCPSTRDTHSPTPS 608
           P P+   T +P PS
Sbjct: 588 PAPTAAATATPAPS 601


>UniRef50_A5V249 Cluster: Integrin alpha beta-propellor repeat
           protein precursor; n=2; Roseiflexus|Rep: Integrin alpha
           beta-propellor repeat protein precursor - Roseiflexus
           sp. RS-1
          Length = 830

 Score = 34.7 bits (76), Expect = 3.0
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = +3

Query: 465 NTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTP--CPSTRDTHSPTPSCVWTLAGRDS 638
           +TP+   +     + T    P  +    +T SPTP   P+   T SPTPS   T     S
Sbjct: 508 STPSPTPSATPTFTSTPSPTPSATPTFTSTPSPTPSATPTFTSTPSPTPSATPTFTSTPS 567

Query: 639 QTTS*RFSPSAATRSLPTP 695
            T S   +P+  +  LPTP
Sbjct: 568 PTPS--ATPTFTSTPLPTP 584



 Score = 34.3 bits (75), Expect = 4.0
 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +3

Query: 528 PVSCWTP-ATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           P    TP AT S TP P+   T SPTPS   T     S T S   +P+  +   PTP
Sbjct: 446 PTFTSTPSATPSNTPSPTFTSTPSPTPSATPTFTSTPSPTPS--ATPTFTSTPSPTP 500


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 918,264,475
Number of Sequences: 1657284
Number of extensions: 21907481
Number of successful extensions: 92149
Number of sequences better than 10.0: 341
Number of HSP's better than 10.0 without gapping: 74728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 88267
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75423184424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -