SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8NST2 Cluster: Putative uncharacterized protein Cgl058...    36   1.4  
UniRef50_A4HMT4 Cluster: Putative uncharacterized protein; n=3; ...    35   2.4  
UniRef50_UPI0000F2D7E7 Cluster: PREDICTED: hypothetical protein;...    34   4.2  
UniRef50_UPI0000EBD350 Cluster: PREDICTED: hypothetical protein;...    34   5.5  
UniRef50_Q89IY7 Cluster: Transcriptional regulatory protein; n=1...    34   5.5  
UniRef50_Q9VDM1 Cluster: Putative odorant receptor 92a; n=4; Sop...    34   5.5  
UniRef50_UPI0000DD84C5 Cluster: PREDICTED: hypothetical protein;...    33   7.3  
UniRef50_Q2JGR8 Cluster: Transposase IS116/IS110/IS902; n=3; Act...    33   7.3  
UniRef50_UPI0000E46357 Cluster: PREDICTED: hypothetical protein;...    33   9.6  
UniRef50_Q0TX08 Cluster: Putative uncharacterized protein; n=1; ...    33   9.6  

>UniRef50_Q8NST2 Cluster: Putative uncharacterized protein Cgl0585;
           n=2; Corynebacterium glutamicum|Rep: Putative
           uncharacterized protein Cgl0585 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 503

 Score = 35.9 bits (79), Expect = 1.4
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = -3

Query: 424 RNTLLSRHETASSSH--RVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSH 251
           R+  +S+  +A + H  +V    P P  S A  G +GGAT   A S GG+ S T +  S 
Sbjct: 181 RDDAISQCFSALTDHGKQVCETEPKPLCSAASGGSSGGATSSAAASSGGSSSSTASSGSS 240

Query: 250 PGLS 239
            G S
Sbjct: 241 GGSS 244


>UniRef50_A4HMT4 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 668

 Score = 35.1 bits (77), Expect = 2.4
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = -3

Query: 403 HETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           H TASS   V +V P   + K   G AGG  H PA+ GGG   R   RT
Sbjct: 200 HGTASSE--VPSVAPFIGSKKRRRGGAGGK-HDPANGGGGERKRRAQRT 245


>UniRef50_UPI0000F2D7E7 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 1065

 Score = 34.3 bits (75), Expect = 4.2
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +1

Query: 190 FIPTRLGSVKEVSAPDMRAPGD-WSERGSARGCRRRCVQGGAW 315
           F  TR G + E   PD+   G  WS +G  RG  RR  +GG W
Sbjct: 867 FCVTRRGGLPE---PDLEVMGSPWSLQGRGRGVERRGTEGGVW 906


>UniRef50_UPI0000EBD350 Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 115

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = -3

Query: 379 RVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSHPG 245
           R A   P PA  K   G A G +HR A +GGG  SRT +R   PG
Sbjct: 18  RAAAERPRPALQKTAAG-APGRSHRAAGAGGG--SRTASRPGDPG 59


>UniRef50_Q89IY7 Cluster: Transcriptional regulatory protein; n=1;
           Bradyrhizobium japonicum|Rep: Transcriptional regulatory
           protein - Bradyrhizobium japonicum
          Length = 307

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -2

Query: 272 DPRSDQSPGAL-ISGALTSLTLPNLVGMNGRLAQSAFIHTVTKTI 141
           DP   Q+  +L +S  ++SL +P+L+G  G++A  A +HTV  TI
Sbjct: 92  DPARAQTEFSLSMSDYVSSLVMPDLLGHLGKVAPKARVHTVPNTI 136


>UniRef50_Q9VDM1 Cluster: Putative odorant receptor 92a; n=4;
           Sophophora|Rep: Putative odorant receptor 92a -
           Drosophila melanogaster (Fruit fly)
          Length = 408

 Score = 33.9 bits (74), Expect = 5.5
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +2

Query: 560 NVLNGKNLFVFYVILGINNFNQYIFAHVASFVIIWMTILICLHSSXIS 703
           NV+  + L  FY++LG  NFN Y+   +A F++  M+    L ++ ++
Sbjct: 42  NVIR-RYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVA 88


>UniRef50_UPI0000DD84C5 Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 234

 Score = 33.5 bits (73), Expect = 7.3
 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = -3

Query: 454 LFSKLPNL*RRNTLLSRHETA-SSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTP 278
           L  ++P   R      RH TA + + R     P PA  +A  GP   AT RP H G G P
Sbjct: 71  LTHRIPERARAQPGTPRHVTARAGAPRGNGFCPRPAGGRA--GPPAAAT-RPRHRGAGAP 127

Query: 277 SRTLARTSHP 248
            R   R   P
Sbjct: 128 PRPQLRPHAP 137


>UniRef50_Q2JGR8 Cluster: Transposase IS116/IS110/IS902; n=3;
           Actinomycetales|Rep: Transposase IS116/IS110/IS902 -
           Frankia sp. (strain CcI3)
          Length = 454

 Score = 33.5 bits (73), Expect = 7.3
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = -3

Query: 475 HIFLISKLFSKLPNL*RRNT-LLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPA 299
           H +L+S L +++  L RR   L  R +TA ++          AA    TGP G AT    
Sbjct: 218 HGYLLSVLLAQIDGLDRRIAELTERIDTAIAALPAPAHAAADAARGGETGPDGDATTGTG 277

Query: 298 HSGGGTPSR 272
             GGG  +R
Sbjct: 278 QGGGGAAAR 286


>UniRef50_UPI0000E46357 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 1583

 Score = 33.1 bits (72), Expect = 9.6
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = -3

Query: 424 RNTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGG--TPSRTLARTSH 251
           R T++ +   A  +  +A +      +  H  P+GG +  PAHSG G  TPS     T+H
Sbjct: 485 RKTVVKQKLRAGQAKSLAEIEADMKKASVHQSPSGGDS--PAHSGSGPGTPS----HTAH 538

Query: 250 PG 245
           PG
Sbjct: 539 PG 540


>UniRef50_Q0TX08 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 573

 Score = 33.1 bits (72), Expect = 9.6
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 11/114 (9%)
 Frame = -2

Query: 419 YVAFAXRNSLEFT*SSECPSRSGCIKGAYWSCRRGHAPPCTQRRRHPLADPRSDQSPGAL 240
           Y+  A R +++F  + +   +SG +  +      GH P C+      L+  +   + G  
Sbjct: 71  YLIGATRETVDFAGALDDAWQSGLVNESTIWLEMGHHPTCSGFISRTLSSTQ-QYTDGKA 129

Query: 239 ISGALTSLTLPNLVG------MNGRLAQSAFIH-----TVTKTIQAKTFPLNIS 111
           I  A +S+T P+L G      MNG    S+F+H     T+ K +  K+F   +S
Sbjct: 130 ILSAESSITDPSLQGVVDGHAMNGYGVASSFLHAEMAFTLAKRVSDKSFASAVS 183


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 883,854,383
Number of Sequences: 1657284
Number of extensions: 18384978
Number of successful extensions: 56040
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 51758
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55911
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 79112361923
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -