SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30133.Seq
         (693 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q187Y3 Cluster: Putative membrane protein; n=2; Clostri...    35   2.2  
UniRef50_Q4Z752 Cluster: Putative uncharacterized protein; n=3; ...    34   3.8  
UniRef50_Q8I5F3 Cluster: Putative uncharacterized protein; n=1; ...    33   5.0  
UniRef50_UPI00006CB141 Cluster: hypothetical protein TTHERM_0061...    33   6.6  
UniRef50_Q2NEB7 Cluster: Predicted membrane-associated Zn-depend...    33   6.6  

>UniRef50_Q187Y3 Cluster: Putative membrane protein; n=2;
           Clostridium difficile|Rep: Putative membrane protein -
           Clostridium difficile (strain 630)
          Length = 226

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -1

Query: 195 CLVQYQFVEVINKTLKSDLNTKLELFTMYVFNLFFYLSL 79
           CL+ YQ V +  K LK + N  + L  +Y+F L+ YL+L
Sbjct: 15  CLI-YQIVVIKRKNLKVEKNVMIHLVWVYIFLLYIYLAL 52


>UniRef50_Q4Z752 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 747

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +2

Query: 167 TSTNWY*TKHLWHDGRSNSNCKLISTYNNLTDYS-FILHFS*SILYRDKHN*YI-YEVFS 340
           T+TN    K L+ DG+ N NCK    YN+L D S  ++++S +    +K    + Y +F+
Sbjct: 584 TNTN---IKDLYIDGKKNENCKCNYNYNSLNDISDLLINYSKNCKISNKFCGLLKYAIFN 640

Query: 341 RD 346
           +D
Sbjct: 641 KD 642


>UniRef50_Q8I5F3 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 829

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +2

Query: 113 IVNNSNLVFKSLFNVLLIT--STNWY*TKHLWHDGRSNSNCKLISTYNNL 256
           + NNS  +FK  F+ L+IT    ++  +KH W+D +S+  C L +  +N+
Sbjct: 203 VTNNSVEIFKISFDNLIITPIKKHFIKSKHCWYDEKSSYICLLSANKSNV 252


>UniRef50_UPI00006CB141 Cluster: hypothetical protein TTHERM_00616620;
            n=2; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00616620 - Tetrahymena thermophila SB210
          Length = 2682

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -2

Query: 641  NCSLLNFDAQ*P-RYFELLYSAVLTFIIFTLLEVVFFXFYILRIICAKNLTRNIIV 477
            NC L++F    P  YF LL+  V   +++  L +VFF FY   +I  K L    IV
Sbjct: 2266 NCFLVDFSGNIPITYFSLLWMLVNP-LLYLGLALVFFLFYSFYLIIIKKLQEPSIV 2320


>UniRef50_Q2NEB7 Cluster: Predicted membrane-associated Zn-dependent
           protease; n=1; Methanosphaera stadtmanae DSM 3091|Rep:
           Predicted membrane-associated Zn-dependent protease -
           Methanosphaera stadtmanae (strain DSM 3091)
          Length = 429

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -1

Query: 228 QFELLLPSCHRCLVQYQFVEVINKTLKSDLN-TKLELFTMYVFNLFFYLSLVVIL 67
           ++   LP C RC +  +F  ++N     +LN   +E  T Y+ +LF  + +V+I+
Sbjct: 364 KYTKFLPGCIRCWISRRFNWILNFISHHELNDNTVEHITRYISSLFIVILVVLII 418


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 503,164,517
Number of Sequences: 1657284
Number of extensions: 8462967
Number of successful extensions: 19990
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 18847
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19914
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54545459628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -