SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5AMQ3 Cluster: Putative uncharacterized protein RGA2; ...    41   0.033
UniRef50_Q8N3F8 Cluster: MICAL-like protein 1; n=14; Amniota|Rep...    40   0.043
UniRef50_Q6CPS6 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    38   0.18 
UniRef50_Q8BGB5 Cluster: LIM domain-containing protein 2; n=11; ...    38   0.18 
UniRef50_Q24BZ2 Cluster: Zinc finger protein; n=1; Tetrahymena t...    37   0.40 
UniRef50_UPI00015558E1 Cluster: PREDICTED: hypothetical protein,...    37   0.53 
UniRef50_A7TK71 Cluster: Putative uncharacterized protein; n=1; ...    37   0.53 
UniRef50_Q8IEI9 Cluster: Putative uncharacterized protein PF13_0...    35   1.6  
UniRef50_Q49QW5 Cluster: Apterous; n=1; Euprymna scolopes|Rep: A...    35   2.2  
UniRef50_A5E415 Cluster: Putative uncharacterized protein; n=1; ...    35   2.2  
UniRef50_Q9DEY8 Cluster: Cytoskeleton-associated LIM domain prot...    34   2.9  
UniRef50_Q54QR1 Cluster: LIM domain-containing protein; n=2; Dic...    34   2.9  
UniRef50_A5DPM8 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q7ZUX0 Cluster: Zgc:55983; n=5; Danio rerio|Rep: Zgc:55...    34   3.8  
UniRef50_Q4SJ50 Cluster: Chromosome 4 SCAF14575, whole genome sh...    34   3.8  
UniRef50_Q2J8S9 Cluster: Bacteriophage (PhiC31) resistance gene ...    34   3.8  
UniRef50_Q8MUJ8 Cluster: MICAL long isoform; n=7; Drosophila mel...    34   3.8  
UniRef50_Q06407 Cluster: Rho-type GTPase-activating protein 2; n...    34   3.8  
UniRef50_Q9BT23 Cluster: LIM domain-containing protein 2; n=5; A...    34   3.8  
UniRef50_Q00WN4 Cluster: Leaf protein; n=4; Ostreococcus|Rep: Le...    33   5.0  
UniRef50_UPI00006CE528 Cluster: LIM domain containing protein; n...    33   6.6  
UniRef50_Q9VTW3 Cluster: CG4328-PA; n=4; Sophophora|Rep: CG4328-...    33   6.6  
UniRef50_Q8IU17 Cluster: CiGl protein; n=2; Ciona intestinalis|R...    33   6.6  
UniRef50_Q174H2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.6  
UniRef50_Q75BR6 Cluster: ACR205Wp; n=1; Eremothecium gossypii|Re...    33   6.6  
UniRef50_P61968 Cluster: LIM domain transcription factor LMO4; n...    33   6.6  
UniRef50_P20271 Cluster: Homeobox protein ceh-14; n=2; Caenorhab...    33   6.6  
UniRef50_UPI0000DB78BA Cluster: PREDICTED: similar to CG33521-PA...    33   8.7  
UniRef50_UPI00006CB06C Cluster: LIM domain containing protein; n...    33   8.7  
UniRef50_Q01Z45 Cluster: Glycosyl transferase, family 39; n=1; S...    33   8.7  
UniRef50_Q54SK5 Cluster: Histidine kinase; n=3; Eukaryota|Rep: H...    33   8.7  
UniRef50_Q17A11 Cluster: Mical; n=6; Eukaryota|Rep: Mical - Aede...    33   8.7  
UniRef50_Q759P3 Cluster: ADR232Wp; n=1; Eremothecium gossypii|Re...    33   8.7  
UniRef50_P39083 Cluster: Rho-type GTPase-activating protein 1; n...    33   8.7  
UniRef50_Q9U2R6 Cluster: Nuclear hormone receptor family member ...    33   8.7  

>UniRef50_Q5AMQ3 Cluster: Putative uncharacterized protein RGA2;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein RGA2 - Candida albicans (Yeast)
          Length = 1176

 Score = 40.7 bits (91), Expect = 0.033
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +1

Query: 349 DNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           + P  SS+         R +C +C Q+I E +  E+    +H HC  C  C+T
Sbjct: 16  ETPELSSQPSLDSNRQPRELCKKCNQLIVEGHAYELGDDRWHIHCFNCSKCNT 68


>UniRef50_Q8N3F8 Cluster: MICAL-like protein 1; n=14; Amniota|Rep:
           MICAL-like protein 1 - Homo sapiens (Human)
          Length = 863

 Score = 40.3 bits (90), Expect = 0.043
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           +G+   + S SE   G T  S C+ C Q ++   +   D + +H HC +C  C +   P
Sbjct: 142 QGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLP 200


>UniRef50_Q6CPS6 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome E of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 1045

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +1

Query: 373 SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S + +G  + SVC RC   I   +  E+    +H+HC  CY C
Sbjct: 2   SASPKGAAETSVCVRCTNHITMGHAYELGGNRWHTHCFSCYKC 44


>UniRef50_Q8BGB5 Cluster: LIM domain-containing protein 2; n=11;
           Amniota|Rep: LIM domain-containing protein 2 - Mus
           musculus (Mouse)
          Length = 128

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 23/77 (29%), Positives = 33/77 (42%)
 Frame = +1

Query: 307 AQWTCGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCA 486
           AQ T      G  G +    SKS +     K + C+ C + +    ++  DK  FH+ C 
Sbjct: 8   AQATPSHEAKGSSGSSTVQRSKSFSLRAQVKET-CAACQKTVYPMERLVADKLIFHNSCF 66

Query: 487 KCYFCHTVHRPTSTSAM 537
            C  CHT     S +AM
Sbjct: 67  CCKHCHTKLSLGSYAAM 83


>UniRef50_Q24BZ2 Cluster: Zinc finger protein; n=1; Tetrahymena
           thermophila SB210|Rep: Zinc finger protein - Tetrahymena
           thermophila SB210
          Length = 770

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEG-NTKRSVCSRCLQMINENNKIE--IDKQAFHSHC 483
           + +N G +     SEG N+ + +CS CLQ I EN+K    I K  FH  C
Sbjct: 404 DSNNKGDAQLPYQSEGGNSNQIICSICLQAIQENDKYRETICKHLFHQEC 453


>UniRef50_UPI00015558E1 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 871

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           E   P A++  E  EG    ++CS C   +    ++  D + FHS+C +C+FC    RP
Sbjct: 577 EPPGPLAAADREPGEG----ALCSLCGGHLYILEQLRADGRFFHSNCFRCHFCEAKLRP 631


>UniRef50_A7TK71 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 1025

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +1

Query: 406 VCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH-TVHRPTSTSAMVKSSASL 558
           VC+ C + I ++N  +I +  +H HC KCY C   + + +S   M  S  SL
Sbjct: 12  VCASCKEDIIDDNYFKIGEDKWHIHCFKCYKCEKKLSKDSSFLRMNNSKNSL 63


>UniRef50_Q8IEI9 Cluster: Putative uncharacterized protein
           PF13_0074; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF13_0074 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1800

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +1

Query: 322 GKFGNGQEGDNPGASSKSEASEG-NTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           GKF N    ++P    K++ +EG N KR    + L+ I   +   ++++   +H +    
Sbjct: 257 GKFPNQDRKEDPTDREKTDVNEGQNGKRLTQEKTLKQIPSTSPNNLEQKLQQTHISSSQQ 316

Query: 499 CHTVH-RPTSTSAMVKSSASL 558
            H +   PTS S    SS+S+
Sbjct: 317 KHLIKTTPTSDSTTTSSSSSV 337


>UniRef50_Q49QW5 Cluster: Apterous; n=1; Euprymna scolopes|Rep:
           Apterous - Euprymna scolopes
          Length = 423

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = +1

Query: 373 SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S  ++ + K  +C+ C  +I E   + +   A+H +C KCY C
Sbjct: 80  SVLTQDDHKPFICAGCGDLITERYYLNVANNAWHFNCLKCYEC 122


>UniRef50_A5E415 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1416

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           R VC +C  +I+E +  E+ +  +H  C  C  C+T
Sbjct: 53  REVCKKCSNLISEGHAYELGEDRWHIDCFNCSKCNT 88


>UniRef50_Q9DEY8 Cluster: Cytoskeleton-associated LIM domain
           protein; n=4; Clupeocephala|Rep: Cytoskeleton-associated
           LIM domain protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 629

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           R  C  CL+ +    K+  ++Q +H+ C +C +C+T
Sbjct: 283 RETCVTCLKTVYPLEKLVANQQIYHNTCFRCAYCNT 318


>UniRef50_Q54QR1 Cluster: LIM domain-containing protein; n=2;
            Dictyostelium discoideum|Rep: LIM domain-containing
            protein - Dictyostelium discoideum AX4
          Length = 1183

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +1

Query: 409  CSRCLQMINENNKI-EIDKQAFHSHCAKCYFCHTVHRPTSTSAMVKSSAS 555
            C  C + + E + I  IDK+ +H+ C KC  C  V R  + S    +S S
Sbjct: 1054 CCSCYKFLTEEDDIIVIDKEKYHNKCFKCSSCKEVIRGNNFSREQMTSTS 1103


>UniRef50_A5DPM8 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 1143

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           C RC + I E +  E+ +  +H HC KC  C T
Sbjct: 18  CKRCGEPIFEGHAYELGEDRWHIHCFKCSKCET 50


>UniRef50_Q7ZUX0 Cluster: Zgc:55983; n=5; Danio rerio|Rep: Zgc:55983
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 560

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 379 ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTV 510
           A++ +T  S CS C Q ++   +  +D + +H +C KC  C T+
Sbjct: 169 ANKSSTPSSNCSVCNQHVHLVQRHLVDGKLYHRNCFKCKECSTI 212


>UniRef50_Q4SJ50 Cluster: Chromosome 4 SCAF14575, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF14575, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 381

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = +1

Query: 367 SKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           + S +S  +T ++VC+ C Q I +   ++++   +H  C +C  C T  R  S+
Sbjct: 32  TSSTSSVPSTGKNVCASCGQEILDRYLLKVNNLIWHVRCLECSVCRTSLRQHSS 85


>UniRef50_Q2J8S9 Cluster: Bacteriophage (PhiC31) resistance gene
           PglZ; n=1; Frankia sp. CcI3|Rep: Bacteriophage (PhiC31)
           resistance gene PglZ - Frankia sp. (strain CcI3)
          Length = 893

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 214 DVLRARILQWMLQAHVLDRFRGECPSVHTNWAQWTCGKFGNG 339
           D+  A +L+W L A  L R+R   P+V T  + W  G+ G G
Sbjct: 169 DLDLAGLLRWSLDAEHLARWRALDPAVRTGMSGWLAGRGGRG 210


>UniRef50_Q8MUJ8 Cluster: MICAL long isoform; n=7; Drosophila
            melanogaster|Rep: MICAL long isoform - Drosophila
            melanogaster (Fruit fly)
          Length = 4723

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYPMEKTTVEGLVLHRNCLKCHHCHT 1106


>UniRef50_Q06407 Cluster: Rho-type GTPase-activating protein 2; n=2;
           Saccharomyces cerevisiae|Rep: Rho-type GTPase-activating
           protein 2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1009

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           N + S+C RC + I  +   E++ + +H  C  CY C
Sbjct: 7   NDQSSLCVRCNKSIASSQVYELESKKWHDQCFTCYKC 43


>UniRef50_Q9BT23 Cluster: LIM domain-containing protein 2; n=5;
           Amniota|Rep: LIM domain-containing protein 2 - Homo
           sapiens (Human)
          Length = 127

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 346 GDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G +    SKS +     K + C+ C + +    ++  DK  FH+ C  C  CHT
Sbjct: 20  GSSTVQRSKSFSLRAQVKET-CAACQKTVYPMERLVADKLIFHNSCFCCKHCHT 72


>UniRef50_Q00WN4 Cluster: Leaf protein; n=4; Ostreococcus|Rep: Leaf
           protein - Ostreococcus tauri
          Length = 807

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
 Frame = +1

Query: 340 QEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNK--IEIDKQAFHSHCAKCYFCHTVH 513
           + GD PG  S + AS+  T      R +  +N+  +  IE+D +   + CA+   C+ VH
Sbjct: 7   RSGD-PGPRS-ANASDATTSARRTRREIMKMNDGTERVIEVDDRFACAKCARGASCYAVH 64

Query: 514 RPTSTSAMVK 543
           R TS  A ++
Sbjct: 65  RATSAVASMR 74


>UniRef50_UPI00006CE528 Cluster: LIM domain containing protein; n=1;
           Tetrahymena thermophila SB210|Rep: LIM domain containing
           protein - Tetrahymena thermophila SB210
          Length = 423

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHC--AKCYFCHTV 510
           C++C  +I + N +E D Q FH+ C   +C +C+ +
Sbjct: 152 CNKCDLVIEQENHLEQDGQIFHARCLNLQCSYCNEI 187


>UniRef50_Q9VTW3 Cluster: CG4328-PA; n=4; Sophophora|Rep: CG4328-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 530

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 352 NPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC--HTVH 513
           N G   +   +  + + S C+ C Q I +   + + + +FH  C KC  C  H VH
Sbjct: 166 NSGMGMELGLAMASPQLSQCAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVH 221


>UniRef50_Q8IU17 Cluster: CiGl protein; n=2; Ciona intestinalis|Rep:
           CiGl protein - Ciona intestinalis (Transparent sea
           squirt)
          Length = 693

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHC 483
           NT   +C+ CL++ NEN ++ +      FH HC
Sbjct: 248 NTSEQLCAICLEVFNENEELRVIPCSHEFHKHC 280


>UniRef50_Q174H2 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 3816

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 15/57 (26%), Positives = 22/57 (38%)
 Frame = +1

Query: 337 GQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G+ G N  + +    +        C  C Q +    KI  +    H  C KC+ CHT
Sbjct: 217 GERGKNKTSKAALVLTSSGVAEK-CHFCKQRVYLMEKISAENLTLHRSCLKCHHCHT 272


>UniRef50_Q75BR6 Cluster: ACR205Wp; n=1; Eremothecium gossypii|Rep:
           ACR205Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 1079

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +1

Query: 373 SEASEGNTKRS----VCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S A+ G++ R+     C+RC   I   +  E+    +H+HC  CY C
Sbjct: 11  STATGGSSSRAGVVPSCTRCTLAITTGHAYELGGDRWHTHCFTCYKC 57


>UniRef50_P61968 Cluster: LIM domain transcription factor LMO4;
           n=11; Eumetazoa|Rep: LIM domain transcription factor
           LMO4 - Homo sapiens (Human)
          Length = 165

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)
 Frame = +1

Query: 352 NPGASSKSE-ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           NPG+SS+    + G+     C+ C   I +   +      +HS C KC  C        T
Sbjct: 3   NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT 62

Query: 529 SAMVKSSASLASN 567
           S   KS   L  N
Sbjct: 63  SCYTKSGMILCRN 75


>UniRef50_P20271 Cluster: Homeobox protein ceh-14; n=2;
           Caenorhabditis|Rep: Homeobox protein ceh-14 -
           Caenorhabditis elegans
          Length = 351

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +1

Query: 367 SKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S   A   N + ++CS C + I +    +++ + +HS C +C  C
Sbjct: 34  SNVNAGHPNNEEAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTC 78


>UniRef50_UPI0000DB78BA Cluster: PREDICTED: similar to CG33521-PA,
            isoform A; n=2; Apocrita|Rep: PREDICTED: similar to
            CG33521-PA, isoform A - Apis mellifera
          Length = 1443

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +1

Query: 406  VCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHR 516
            VC  C + +    K+E + + FH  C +C  C+ V R
Sbjct: 1347 VCESCEKKVYPLEKVETNNKIFHKQCFRCLQCNCVLR 1383


>UniRef50_UPI00006CB06C Cluster: LIM domain containing protein; n=1;
           Tetrahymena thermophila SB210|Rep: LIM domain containing
           protein - Tetrahymena thermophila SB210
          Length = 1097

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +1

Query: 406 VCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           VC +C ++I EN ++ I+   +H+ C  C  CH
Sbjct: 850 VCQKCKRVIKENEQL-INGSYYHTGCLTCQKCH 881


>UniRef50_Q01Z45 Cluster: Glycosyl transferase, family 39; n=1;
           Solibacter usitatus Ellin6076|Rep: Glycosyl transferase,
           family 39 - Solibacter usitatus (strain Ellin6076)
          Length = 574

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 1   FSLLFKFYFNTYLPKKVKFNYG*RSRTSQKAILC 102
           F LL+ F ++ Y P  VK  YG   RTS+  +LC
Sbjct: 272 FHLLWFFPWSLYFPAAVKLRYGNTDRTSRVRLLC 305


>UniRef50_Q54SK5 Cluster: Histidine kinase; n=3; Eukaryota|Rep:
           Histidine kinase - Dictyostelium discoideum AX4
          Length = 2388

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 21/78 (26%), Positives = 31/78 (39%)
 Frame = +1

Query: 334 NGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVH 513
           N    +N   SSK++   GN K +      Q I+ +NK        H H       H   
Sbjct: 263 NSSNNNNKNNSSKNKVGGGNNKNNGGDDSAQFISSDNKYNTVGNETHHHHHHQLHNHRHS 322

Query: 514 RPTSTSAMVKSSASLASN 567
               +S+ +KSS  L S+
Sbjct: 323 NVQGSSSPIKSSPKLISS 340


>UniRef50_Q17A11 Cluster: Mical; n=6; Eukaryota|Rep: Mical - Aedes
            aegypti (Yellowfever mosquito)
          Length = 3542

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = +1

Query: 409  CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            C  C Q +    KI  +    H  C KC+ CHT
Sbjct: 1009 CHFCKQRVYLMEKISAENLTLHRSCLKCHHCHT 1041


>UniRef50_Q759P3 Cluster: ADR232Wp; n=1; Eremothecium gossypii|Rep:
           ADR232Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 855

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = +1

Query: 403 SVCSRCLQMINENNKIEIDK-QAFHSHCAKCYFCH 504
           S+C  C   I E   +E DK + FH  C  CY CH
Sbjct: 764 SICRVCRDFI-EGECLENDKGETFHVSCLTCYLCH 797


>UniRef50_P39083 Cluster: Rho-type GTPase-activating protein 1; n=2;
           Saccharomyces cerevisiae|Rep: Rho-type GTPase-activating
           protein 1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1007

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           C RC + I   +  E+    +H+HC  CY C
Sbjct: 13  CVRCKEFITTGHAYELGCDRWHTHCFACYKC 43


>UniRef50_Q9U2R6 Cluster: Nuclear hormone receptor family member
           nhr-91; n=5; Caenorhabditis|Rep: Nuclear hormone
           receptor family member nhr-91 - Caenorhabditis elegans
          Length = 474

 Score = 32.7 bits (71), Expect = 8.7
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 100 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 157

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 158 RKCISKGMLTEAV 170


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 714,405,049
Number of Sequences: 1657284
Number of extensions: 14524389
Number of successful extensions: 42482
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 40471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42460
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54132236449
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -