SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P08865 Cluster: 40S ribosomal protein SA; n=242; Eukary...   145   5e-34
UniRef50_Q4KTE2 Cluster: SA; n=2; Fungi/Metazoa group|Rep: SA - ...   131   7e-30
UniRef50_UPI0000E20E16 Cluster: PREDICTED: similar to 33 kDa pro...   128   5e-29
UniRef50_P32905 Cluster: 40S ribosomal protein S0-A; n=23; Fungi...   126   3e-28
UniRef50_Q9Y7L8 Cluster: 40S ribosomal protein S0-A; n=11; Ascom...   119   4e-26
UniRef50_A3AIV8 Cluster: Putative uncharacterized protein; n=1; ...   114   1e-24
UniRef50_Q08682 Cluster: 40S ribosomal protein Sa-1; n=19; Magno...   113   2e-24
UniRef50_P46770 Cluster: 40S ribosomal protein SA; n=1; Echinoco...   112   3e-24
UniRef50_Q01CH5 Cluster: B1056G08.113 gene product; n=6; Eukaryo...   107   2e-22
UniRef50_Q9XZ65 Cluster: Laminin receptor-like protein/ p40 ribo...   100   3e-20
UniRef50_O15585 Cluster: Ribosomal protein SA (P40) / laminin re...    97   1e-19
UniRef50_Q4N1J1 Cluster: 40S ribosomal protein SA, putative; n=1...    97   2e-19
UniRef50_Q7QWF5 Cluster: GLP_336_16528_17265; n=1; Giardia lambl...    90   2e-17
UniRef50_A0ECJ9 Cluster: Chromosome undetermined scaffold_9, who...    88   1e-16
UniRef50_UPI0000EB0B97 Cluster: UPI0000EB0B97 related cluster; n...    86   5e-16
UniRef50_A2FLG0 Cluster: Ribosomal protein, putative; n=7; Trich...    85   1e-15
UniRef50_Q0DUK0 Cluster: Os03g0182600 protein; n=1; Oryza sativa...    81   1e-14
UniRef50_Q8SS60 Cluster: 40S RIBOSOMAL PROTEIN SA or P40; n=1; E...    81   1e-14
UniRef50_Q4P1B8 Cluster: Putative uncharacterized protein; n=1; ...    80   2e-14
UniRef50_Q9AW71 Cluster: 40S ribosomal protein SSA; n=1; Guillar...    75   1e-12
UniRef50_A7NTT5 Cluster: Chromosome chr18 scaffold_1, whole geno...    73   3e-12
UniRef50_P57712 Cluster: 30S ribosomal protein S2P; n=2; Thermop...    66   5e-10
UniRef50_P95993 Cluster: 30S ribosomal protein S2P; n=13; Archae...    62   5e-09
UniRef50_UPI0000E48DD5 Cluster: PREDICTED: similar to 34/67 kD l...    62   8e-09
UniRef50_UPI0000DD86B9 Cluster: PREDICTED: similar to 40S riboso...    60   2e-08
UniRef50_Q4GXR5 Cluster: Ribosomal protein SAe; n=2; Adephaga|Re...    59   4e-08
UniRef50_A1RWV4 Cluster: Ribosomal protein S2; n=2; Archaea|Rep:...    59   4e-08
UniRef50_Q862Y3 Cluster: Similar to C10 protein; n=3; Eutheria|R...    59   6e-08
UniRef50_Q8TT39 Cluster: 30S ribosomal protein S2P; n=10; Euryar...    58   8e-08
UniRef50_P54109 Cluster: 30S ribosomal protein S2P; n=10; Euryar...    57   2e-07
UniRef50_UPI00015531E2 Cluster: PREDICTED: similar to Ribosomal ...    54   1e-06
UniRef50_UPI0000EB1146 Cluster: UPI0000EB1146 related cluster; n...    51   1e-05
UniRef50_Q9U5P8 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_P29202 Cluster: 30S ribosomal protein S2P; n=12; Euryar...    49   5e-05
UniRef50_A0RY14 Cluster: Ribosomal protein S2; n=2; Thermoprotei...    48   8e-05
UniRef50_Q8JIE5 Cluster: 67kD laminin receptor/ribosomal protein...    46   4e-04
UniRef50_A3H8R8 Cluster: Ribosomal protein S2; n=1; Caldivirga m...    46   4e-04
UniRef50_UPI0000D9C04A Cluster: PREDICTED: hypothetical protein;...    43   0.003
UniRef50_Q6PDB3 Cluster: LOC204010 protein; n=2; Eutheria|Rep: L...    43   0.004
UniRef50_Q74M65 Cluster: NEQ508; n=1; Nanoarchaeum equitans|Rep:...    41   0.017
UniRef50_UPI00005A3143 Cluster: PREDICTED: similar to 40S riboso...    39   0.068
UniRef50_Q3LVY7 Cluster: Ribosomal RNA S0; n=1; Bigelowiella nat...    38   0.12 
UniRef50_Q9XUS0 Cluster: Putative uncharacterized protein; n=2; ...    35   1.1  
UniRef50_Q7YWV7 Cluster: Putative uncharacterized protein; n=2; ...    35   1.1  
UniRef50_Q17641 Cluster: Putative uncharacterized protein; n=11;...    35   1.1  
UniRef50_UPI000155F1D6 Cluster: PREDICTED: similar to keratin as...    34   1.9  
UniRef50_Q8EUG1 Cluster: Ribosomal protein S2; n=1; Mycoplasma p...    34   1.9  
UniRef50_Q8DKR9 Cluster: Tll0788 protein; n=1; Synechococcus elo...    34   1.9  
UniRef50_UPI0000F1D36B Cluster: PREDICTED: hypothetical protein;...    32   7.8  
UniRef50_Q7NAW2 Cluster: RpsB; n=1; Mycoplasma gallisepticum|Rep...    32   7.8  
UniRef50_Q5A8K1 Cluster: Likely mitochondrial ribosomal protein;...    32   7.8  
UniRef50_P75560 Cluster: 30S ribosomal protein S2; n=4; Mycoplas...    32   7.8  

>UniRef50_P08865 Cluster: 40S ribosomal protein SA; n=242;
           Eukaryota|Rep: 40S ribosomal protein SA - Homo sapiens
           (Human)
          Length = 295

 Score =  145 bits (351), Expect = 5e-34
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 6e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>UniRef50_Q4KTE2 Cluster: SA; n=2; Fungi/Metazoa group|Rep: SA -
           Suberites domuncula (Sponge)
          Length = 325

 Score =  131 bits (317), Expect = 7e-30
 Identities = 62/84 (73%), Positives = 71/84 (84%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAAR + AIENPADV V++++ FGQRA+LKFA +TGA PIAGRFTPG FTNQIQ AF
Sbjct: 57  KLLLAARVIAAIENPADVCVLANKPFGQRAILKFAHYTGAFPIAGRFTPGTFTNQIQKAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLLIV D    HQPITEA+YV
Sbjct: 117 REPRLLIVSDARSDHQPITEAAYV 140



 Score = 95.9 bits (228), Expect = 4e-19
 Identities = 40/74 (54%), Positives = 50/74 (67%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA CNT+SPL ++D+AIPCN    +S+GLMWW              R+  W+V+ DL
Sbjct: 142 IPVIAFCNTNSPLRYIDVAIPCNNMGKNSLGLMWWLLCREVLRLRGTISRELPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           FFYRDPEE EK+EQ
Sbjct: 202 FFYRDPEEVEKEEQ 215


>UniRef50_UPI0000E20E16 Cluster: PREDICTED: similar to 33 kDa
           protein; n=4; Eutheria|Rep: PREDICTED: similar to 33 kDa
           protein - Pan troglodytes
          Length = 355

 Score =  128 bits (310), Expect = 5e-29
 Identities = 65/84 (77%), Positives = 70/84 (83%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+ AIEN ADV VISSR  GQRAVLKFAA TGATPIAG FTPG FT+QIQAAF
Sbjct: 137 KLLLAARAIAAIENLADVSVISSRNTGQRAVLKFAAATGATPIAGCFTPGTFTSQIQAAF 196

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRL +V DP   HQP+ EASYV
Sbjct: 197 REPRLPVVTDPRVDHQPLMEASYV 220



 Score = 95.1 bits (226), Expect = 7e-19
 Identities = 39/74 (52%), Positives = 49/74 (66%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+G+MWW              R+  W+V+ D 
Sbjct: 222 LPTIALCNTDSPLCYVDIAIPCNNKGAHSVGVMWWMLVPEVRRISGTISREHPWEVMTDP 281

Query: 437 FFYRDPEESEKDEQ 478
            FYRDPEE EK++Q
Sbjct: 282 CFYRDPEEIEKEKQ 295


>UniRef50_P32905 Cluster: 40S ribosomal protein S0-A; n=23;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S0-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 252

 Score =  126 bits (304), Expect = 3e-28
 Identities = 62/84 (73%), Positives = 67/84 (79%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KLVLAAR + AI NP DV  ISSR FGQRAVLKFAAHTGATPIAGRFTPG+FTN I  +F
Sbjct: 56  KLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSF 115

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           +EPRL+IV DP    Q I EASYV
Sbjct: 116 KEPRLVIVTDPRSDAQAIKEASYV 139



 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW-XXXXXXXXXXXXXPRDQXWDVVVD 433
           IPVIA  + DSP  FVD+AIPCN +  HSIGL+W+               R Q W ++ D
Sbjct: 141 IPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPD 200

Query: 434 LFFYRDPEESEK 469
           L+FYRDPEE E+
Sbjct: 201 LYFYRDPEEVEQ 212


>UniRef50_Q9Y7L8 Cluster: 40S ribosomal protein S0-A; n=11;
           Ascomycota|Rep: 40S ribosomal protein S0-A -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 292

 Score =  119 bits (286), Expect = 4e-26
 Identities = 57/84 (67%), Positives = 65/84 (77%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KLVLAAR +  IENPADV V+S+R +G RAVLKFAAHTGAT IAGRFTPG FTN I   +
Sbjct: 59  KLVLAARVIATIENPADVCVVSTRTYGHRAVLKFAAHTGATAIAGRFTPGNFTNYITRTY 118

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRL++V DP    Q I EAS+V
Sbjct: 119 REPRLIVVTDPRADAQAIKEASFV 142



 Score = 81.8 bits (193), Expect = 7e-15
 Identities = 40/79 (50%), Positives = 49/79 (62%)
 Frame = +2

Query: 242 SFICXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWD 421
           SF+  IPVIA C+TDS L  VDIAIP N K   SIGL+W+              R   WD
Sbjct: 140 SFV-NIPVIALCDTDSILNHVDIAIPTNNKGRKSIGLIWYLLAREVLRVRGTLSRSAPWD 198

Query: 422 VVVDLFFYRDPEESEKDEQ 478
           V+ DL+FYRDPEE E++E+
Sbjct: 199 VMPDLYFYRDPEEVEREEE 217


>UniRef50_A3AIV8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 280

 Score =  114 bits (274), Expect = 1e-24
 Identities = 54/82 (65%), Positives = 64/82 (78%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAAR +VAIENP D+ V S+R +GQRAVLKFA +TGA  IAGR TPG FTNQ+Q +F
Sbjct: 58  KLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSF 117

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E++
Sbjct: 118 SEPRLLILTDPRTDHQPIKESA 139



 Score = 42.3 bits (95), Expect = 0.006
 Identities = 15/22 (68%), Positives = 21/22 (95%)
 Frame = +2

Query: 416 WDVVVDLFFYRDPEESEKDEQQ 481
           WDV+VDLFFYRDPEE+++ E++
Sbjct: 171 WDVMVDLFFYRDPEEAKEQEEE 192


>UniRef50_Q08682 Cluster: 40S ribosomal protein Sa-1; n=19;
           Magnoliophyta|Rep: 40S ribosomal protein Sa-1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 298

 Score =  113 bits (272), Expect = 2e-24
 Identities = 53/82 (64%), Positives = 63/82 (76%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL +AAR +VAIENP D+ V S+R +GQRAVLKFA +TGA  IAGR TPG FTNQ+Q +F
Sbjct: 61  KLQMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSF 120

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            EPRLLI+ DP   HQPI E +
Sbjct: 121 SEPRLLILTDPRTDHQPIKEGA 142



 Score = 86.6 bits (205), Expect = 3e-16
 Identities = 36/74 (48%), Positives = 48/74 (64%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP+IA C+TDSP+ FVDI IP N K  HSIG ++W                Q WDV+VDL
Sbjct: 146 IPIIAFCDTDSPMRFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIAAGQKWDVMVDL 205

Query: 437 FFYRDPEESEKDEQ 478
           FFYR+PEE++ +++
Sbjct: 206 FFYREPEETKPEDE 219


>UniRef50_P46770 Cluster: 40S ribosomal protein SA; n=1;
           Echinococcus granulosus|Rep: 40S ribosomal protein SA -
           Echinococcus granulosus
          Length = 268

 Score =  112 bits (270), Expect = 3e-24
 Identities = 53/84 (63%), Positives = 62/84 (73%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+ AIENPADV +I  +   QR  LKF  +TG T + GRFTPGAFTNQIQ+ F
Sbjct: 57  KLLLAARAICAIENPADVVIIGGQPTWQRGALKFGHYTGTTSVPGRFTPGAFTNQIQSGF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           +EPRLLIV DP   HQP+ E S V
Sbjct: 117 KEPRLLIVCDPKGDHQPVREGSAV 140



 Score = 65.3 bits (152), Expect = 7e-10
 Identities = 36/79 (45%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVI  CNTDSPL  VDI IPCN    +SI LM W             PR Q  DV++DL
Sbjct: 142 IPVIGFCNTDSPLQCVDIGIPCN-NDKYSIALMLWMLAREVRRIWGLDPRSQPGDVIMDL 200

Query: 437 FFYR----DPEESEKDEQQ 481
           F  R    +P E  + E Q
Sbjct: 201 FLMREHVDEPPEGPEGEAQ 219


>UniRef50_Q01CH5 Cluster: B1056G08.113 gene product; n=6;
           Eukaryota|Rep: B1056G08.113 gene product - Ostreococcus
           tauri
          Length = 313

 Score =  107 bits (256), Expect = 2e-22
 Identities = 49/84 (58%), Positives = 63/84 (75%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAAR +VA+ENP DV   ++R +GQRAVLKFA +TGA  +AGR TPG +TNQ  A F
Sbjct: 80  KLMLAARVIVAVENPQDVIAQAARPYGQRAVLKFAQYTGAKALAGRHTPGTYTNQKDAVF 139

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EPR+L+V DP    QPI+E ++V
Sbjct: 140 AEPRVLVVTDPRTDAQPISETAFV 163



 Score = 79.4 bits (187), Expect = 4e-14
 Identities = 38/75 (50%), Positives = 45/75 (60%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TDSPL  VDIAIP N K+  SIG +++                  WDV+VDL
Sbjct: 165 IPTIAFCDTDSPLKNVDIAIPANNKAKQSIGCLYYLLARMVLQMRGTISPANPWDVMVDL 224

Query: 437 FFYRDPEESEKDEQQ 481
           FFYRDPEE E  EQ+
Sbjct: 225 FFYRDPEELEAKEQE 239


>UniRef50_Q9XZ65 Cluster: Laminin receptor-like protein/ p40
           ribosome associated-like protein; n=7; Trypanosoma|Rep:
           Laminin receptor-like protein/ p40 ribosome
           associated-like protein - Trypanosoma cruzi
          Length = 298

 Score = 99.5 bits (237), Expect = 3e-20
 Identities = 47/84 (55%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAAR + A+ENP DV V S+R FGQRA+ KF+   G + +AGRF PG FTNQIQ  F
Sbjct: 77  KLILAARVIAAVENPQDVTVCSTRLFGQRAIFKFSQLVGMSFLAGRFIPGTFTNQIQKKF 136

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            +PR+L+V DP    Q   EAS V
Sbjct: 137 MQPRVLLVTDPRTDQQAFREASLV 160



 Score = 91.9 bits (218), Expect = 7e-18
 Identities = 41/74 (55%), Positives = 49/74 (66%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA C+TD+PL FVDIAIPCN +  +SI +M+W             PR   WDV VDL
Sbjct: 162 IPVIAFCDTDAPLEFVDIAIPCNDRRRYSISMMYWLLAREVLRLRGTIPRSVPWDVKVDL 221

Query: 437 FFYRDPEESEKDEQ 478
           FFYRDPEE+ K E+
Sbjct: 222 FFYRDPEEALKHEE 235


>UniRef50_O15585 Cluster: Ribosomal protein SA (P40) / laminin
           receptor; n=3; Entamoeba histolytica|Rep: Ribosomal
           protein SA (P40) / laminin receptor - Entamoeba
           histolytica
          Length = 173

 Score = 97.5 bits (232), Expect = 1e-19
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   KLVLAARAVVAIEN--PADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQA 176
           KL LAAR +  I N  P+DV  ++ R    RA LKF  +TG T +AGRFTPG+FTNQIQ 
Sbjct: 66  KLSLAARVIAGISNETPSDVVAVAGREMAHRASLKFMKYTGCTAVAGRFTPGSFTNQIQK 125

Query: 177 AFREPRLLIVLDPAQXHQPITEASYV 254
            F EPRL+IV DP+  HQ + E+ Y+
Sbjct: 126 KFMEPRLIIVSDPSVDHQALRESGYI 151


>UniRef50_Q4N1J1 Cluster: 40S ribosomal protein SA, putative; n=11;
           Apicomplexa|Rep: 40S ribosomal protein SA, putative -
           Theileria parva
          Length = 274

 Score = 97.1 bits (231), Expect = 2e-19
 Identities = 45/84 (53%), Positives = 59/84 (70%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL +AARA+V + NP +V V+S+R +G RAVLKF+ + G+ PIAGR+ PG  TNQI   F
Sbjct: 57  KLKVAARAIVTVSNPEEVVVVSARPYGSRAVLKFSHYVGSHPIAGRWIPGTLTNQITQKF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EPRLL+  DP    Q + E+SYV
Sbjct: 117 IEPRLLVATDPRTDAQSLRESSYV 140



 Score = 84.2 bits (199), Expect = 1e-15
 Identities = 37/75 (49%), Positives = 47/75 (62%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +PVIA C+TDSPL +VDIAIPCN K   SI LM+W              R   WDV+VD 
Sbjct: 142 LPVIALCDTDSPLNYVDIAIPCNNKGKESIALMYWLLAREVLYLRDQLKRWMPWDVLVDT 201

Query: 437 FFYRDPEESEKDEQQ 481
           FF+RDPE+ E+  ++
Sbjct: 202 FFWRDPEQFEQKPEE 216


>UniRef50_Q7QWF5 Cluster: GLP_336_16528_17265; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_336_16528_17265 - Giardia lamblia
           ATCC 50803
          Length = 245

 Score = 90.2 bits (214), Expect = 2e-17
 Identities = 43/84 (51%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           K+V AAR +V I++PA++ V+++R   QRA+LKF  +T AT   GRF PG FTN++   +
Sbjct: 62  KIVFAARILVTIDDPAEIAVVANRPDAQRAILKFCKYTHATAFPGRFIPGNFTNRMNPNY 121

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EPRLL+V DP    Q I EASYV
Sbjct: 122 CEPRLLLVNDPVVDRQAILEASYV 145



 Score = 65.3 bits (152), Expect = 7e-10
 Identities = 31/74 (41%), Positives = 42/74 (56%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP I+ CN+D+ L F+D+AIPCN K+  SIGL++W              R + WDV  DL
Sbjct: 147 IPTISLCNSDANLKFIDVAIPCNNKTPMSIGLIYWLLAREVLRLKGSISRTEEWDVKPDL 206

Query: 437 FFYRDPEESEKDEQ 478
           F    PEE   +E+
Sbjct: 207 FVAL-PEEIPDEEE 219


>UniRef50_A0ECJ9 Cluster: Chromosome undetermined scaffold_9, whole
           genome shotgun sequence; n=4; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_9, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 268

 Score = 87.8 bits (208), Expect = 1e-16
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 4/85 (4%)
 Frame = +3

Query: 12  LAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPI-AGRFTPGAFTNQIQAA--- 179
           LAAR + AIE P DV V+SSR  GQRAV+KFA +T A+   + R+TPG  TNQ  +A   
Sbjct: 85  LAARVIAAIEQPQDVMVVSSRPIGQRAVIKFAHYTQASSTRSARWTPGTLTNQSNSASGK 144

Query: 180 FREPRLLIVLDPAQXHQPITEASYV 254
           F+EP+LLIV DP    Q I EASYV
Sbjct: 145 FQEPQLLIVTDPHLDRQAIVEASYV 169



 Score = 61.3 bits (142), Expect = 1e-08
 Identities = 25/65 (38%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  N+D+PL +VDI IP   + + SI +++W              +D+ WDV+VDL
Sbjct: 171 IPVIALTNSDTPLQYVDIPIPVGNRETKSISMIYWLLAREVKILRGELNKDEEWDVLVDL 230

Query: 437 FFYRD 451
           F++++
Sbjct: 231 FYHKE 235


>UniRef50_UPI0000EB0B97 Cluster: UPI0000EB0B97 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0B97 UniRef100
           entry - Canis familiaris
          Length = 258

 Score = 85.8 bits (203), Expect = 5e-16
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+  A  +VA+++P++V VISSR  GQ A+LK AA +GA+P  G FT G FT+Q+QA+ 
Sbjct: 38  KLLPVACTIVAVKHPSEVGVISSRNSGQWAMLKLAAASGASPTVGHFTSGTFTSQVQASC 97

Query: 183 REPRLLIVLDPAQXHQPITEASYVXFL*L-LXATQTP 290
           RE  LL++ DP   H  + EA YV  L + L  +Q+P
Sbjct: 98  RELCLLLITDPRADHPFLMEAPYVNLLTIALRNSQSP 134



 Score = 32.3 bits (70), Expect = 5.9
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +2

Query: 266 IAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IA  N+ SPL  + IAIP ++K +H++G   W
Sbjct: 126 IALRNSQSPLHCMGIAIPHDSKGAHTVGRRKW 157


>UniRef50_A2FLG0 Cluster: Ribosomal protein, putative; n=7;
           Trichomonas vaginalis G3|Rep: Ribosomal protein,
           putative - Trichomonas vaginalis G3
          Length = 256

 Score = 84.6 bits (200), Expect = 1e-15
 Identities = 43/83 (51%), Positives = 52/83 (62%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           K+ LAAR + A+E P DV  IS++ FG RAV KFA   GA  +  RFTPG FTN     F
Sbjct: 55  KIKLAARMIYAVEEPKDVLAISTKSFGTRAVHKFAEFLGANYVEQRFTPGLFTNYSIKNF 114

Query: 183 REPRLLIVLDPAQXHQPITEASY 251
            EPRL+IV DP    Q + EA+Y
Sbjct: 115 CEPRLMIVCDPNTDSQAVHEAAY 137



 Score = 71.7 bits (168), Expect = 8e-12
 Identities = 32/71 (45%), Positives = 41/71 (57%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TD+ L +VD  IPCNTK+ +S+GL+ W              R Q W V+ DL
Sbjct: 140 IPCIALCDTDAHLDYVDCVIPCNTKNKNSMGLVMWLLTREVLRLRGALTRTQEWSVLPDL 199

Query: 437 FFYRDPEESEK 469
           FFYRD  +  K
Sbjct: 200 FFYRDAADEAK 210


>UniRef50_Q0DUK0 Cluster: Os03g0182600 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os03g0182600 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 223

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 35/75 (46%), Positives = 47/75 (62%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+TDSP+ +VDI IP N K  +SIG ++W                  WDV+VDL
Sbjct: 64  IPTIAFCDTDSPMRYVDIGIPANNKGRNSIGCLFWLLARMVLQMRGTILPGHKWDVMVDL 123

Query: 437 FFYRDPEESEKDEQQ 481
           FFYRDPEE+++ E++
Sbjct: 124 FFYRDPEEAKEQEEE 138



 Score = 46.0 bits (104), Expect = 4e-04
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = +3

Query: 156 FTNQIQAAFREPRLLIVLDPAQXHQPITEAS 248
           FTNQ+Q +F EPRLLI+ DP   HQPI E++
Sbjct: 30  FTNQLQTSFSEPRLLILTDPRTDHQPIKESA 60


>UniRef50_Q8SS60 Cluster: 40S RIBOSOMAL PROTEIN SA or P40; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN SA
           or P40 - Encephalitozoon cuniculi
          Length = 252

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 38/83 (45%), Positives = 54/83 (65%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL++AARA   I++P+ + V+S++ FG++ V+KF    GATPI GRF PG+FTN      
Sbjct: 62  KLIIAARAFCGIKHPSSIAVVSTKTFGRKPVVKFCEAVGATPITGRFIPGSFTNSEVKRV 121

Query: 183 REPRLLIVLDPAQXHQPITEASY 251
            +PR+LIV D     Q I E+ Y
Sbjct: 122 YDPRVLIVSDTYADKQAILESQY 144



 Score = 38.3 bits (85), Expect = 0.090
 Identities = 27/75 (36%), Positives = 34/75 (45%), Gaps = 2/75 (2%)
 Frame = +2

Query: 251 CXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSI--GLMWWXXXXXXXXXXXXXPRDQXWDV 424
           C +P IA  NTD+ L  VDIAIP N +S  +I  G                  RD     
Sbjct: 145 CNLPTIAFVNTDNSLVGVDIAIPMNNRSPSAIAAGFFILSRLINYMKTGAELVRDMK--- 201

Query: 425 VVDLFFYRDPEESEK 469
            V+LF +RD  E E+
Sbjct: 202 EVELFLFRDSVELEQ 216


>UniRef50_Q4P1B8 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 251

 Score = 80.2 bits (189), Expect = 2e-14
 Identities = 41/87 (47%), Positives = 58/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   KLVLAAR---AVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQ 173
           K++ AAR    VV ++NPA++ V+SSR +   AVL FA  TGA  IA RFTPG+ TN + 
Sbjct: 27  KIIFAARILATVVTLKNPAEIPVVSSRQYDYCAVLTFAGQTGAINIADRFTPGSSTNYVT 86

Query: 174 AAFREPRLLIVLDPAQXHQPITEASYV 254
             F+E R++IV+DP   HQ + +A +V
Sbjct: 87  RWFKETRVIIVIDPHVSHQAMHKALFV 113



 Score = 35.1 bits (77), Expect = 0.84
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 299 FVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESE 466
           FVDIAIP N +  HS+ ++W               +     ++  +FFY DPE++E
Sbjct: 112 FVDIAIPGNVRGRHSVVILWCLLCRTVLRL-----KGGDLSMMPGMFFYHDPEKAE 162


>UniRef50_Q9AW71 Cluster: 40S ribosomal protein SSA; n=1; Guillardia
           theta|Rep: 40S ribosomal protein SSA - Guillardia theta
           (Cryptomonas phi)
          Length = 199

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           K+ LAARA+++IE+P  +  +SS    Q A++KF+       I  ++ PG  TN+    F
Sbjct: 50  KIELAARAIISIEHPKHIIAVSSNNIHQTAIIKFSQFIQCNCIVDKWIPGKLTNKTSKLF 109

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EPRLLI+ DP    Q + EASYV
Sbjct: 110 EEPRLLIISDPLLDKQALLEASYV 133



 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 24/61 (39%), Positives = 33/61 (54%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVI+ CNTDS L ++DIAIP N K  +S  L+ W              ++  W+V V+ 
Sbjct: 135 IPVISVCNTDSFLSYIDIAIPGNNKDRYSFALIIWLLTKKILIFKGELTKNCEWNVSVES 194

Query: 437 F 439
           F
Sbjct: 195 F 195


>UniRef50_A7NTT5 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 201

 Score = 73.3 bits (172), Expect = 3e-12
 Identities = 34/57 (59%), Positives = 40/57 (70%)
 Frame = +3

Query: 78  FGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEAS 248
           F Q A+LKFA +TGA  IAGR TPG  TNQ+Q +F EP LLI+ DP   HQPI E +
Sbjct: 33  FQQGAILKFAQYTGAHAIAGRHTPGTLTNQLQTSFSEPYLLILTDPITDHQPIKEVA 89



 Score = 57.6 bits (133), Expect = 1e-07
 Identities = 26/62 (41%), Positives = 33/62 (53%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP IA C+ DSP+ +VDI I  N K  H+IG ++W                  WDV+VDL
Sbjct: 93  IPTIAFCDIDSPMRYVDIDILTNNKGKHNIGCLFWLLTMMVLHMRHTIALGHKWDVMVDL 152

Query: 437 FF 442
           FF
Sbjct: 153 FF 154


>UniRef50_P57712 Cluster: 30S ribosomal protein S2P; n=2;
           Thermoplasma|Rep: 30S ribosomal protein S2P -
           Thermoplasma acidophilum
          Length = 199

 Score = 65.7 bits (153), Expect = 5e-10
 Identities = 33/81 (40%), Positives = 47/81 (58%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL++A + +   E P D+ V++ R +  R V KFA  TGAT I GRF PG  TN     +
Sbjct: 51  KLIVAGKMLARFE-PQDILVVAQRQYAFRPVAKFAEVTGATAITGRFNPGTLTNPSLKFY 109

Query: 183 REPRLLIVLDPAQXHQPITEA 245
           +E +++IV DP    Q + EA
Sbjct: 110 KEVKVIIVTDPLADVQAMKEA 130



 Score = 39.5 bits (88), Expect = 0.039
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IP+IA C+ ++   FVD+ IP N K   S+ +++W
Sbjct: 135 IPIIALCDANNKTDFVDLIIPTNNKGRRSLAVIYW 169


>UniRef50_P95993 Cluster: 30S ribosomal protein S2P; n=13;
           Archaea|Rep: 30S ribosomal protein S2P - Sulfolobus
           solfataricus
          Length = 231

 Score = 62.5 bits (145), Expect = 5e-09
 Identities = 29/71 (40%), Positives = 42/71 (59%)
 Frame = +3

Query: 42  NPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQ 221
           +P D+ V++SR +  R V KFA   G+  + GR  PG FTN   + + EP++L+V DP  
Sbjct: 93  DPQDIIVVASRPYAYRPVQKFAEVVGSRALVGRIIPGTFTNPYLSTYIEPKVLLVSDPRT 152

Query: 222 XHQPITEASYV 254
             Q I EA+ V
Sbjct: 153 DTQAIKEAAKV 163



 Score = 41.1 bits (92), Expect = 0.013
 Identities = 19/64 (29%), Positives = 30/64 (46%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IP++A  +TD+ + ++D+ IP N K   S+ L++W             P D    V V  
Sbjct: 165 IPIVAFADTDAKIDYIDLIIPANNKGRKSLALLYWALARQILRERRVIPPDGDLAVPVSE 224

Query: 437 FFYR 448
           F  R
Sbjct: 225 FEMR 228


>UniRef50_UPI0000E48DD5 Cluster: PREDICTED: similar to 34/67 kD
           laminin binding protein; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to 34/67 kD laminin
           binding protein - Strongylocentrotus purpuratus
          Length = 220

 Score = 61.7 bits (143), Expect = 8e-09
 Identities = 24/48 (50%), Positives = 32/48 (66%)
 Frame = +2

Query: 338 HSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESEKDEQQ 481
           HSIGLMWW              RD  W+++VDL+F+RDPEE+EK+EQ+
Sbjct: 48  HSIGLMWWMLSREVLRLRGAISRDVTWEIMVDLYFFRDPEEAEKEEQE 95


>UniRef50_UPI0000DD86B9 Cluster: PREDICTED: similar to 40S ribosomal
           protein SA (p40) (34/67 kDa laminin receptor); n=1; Homo
           sapiens|Rep: PREDICTED: similar to 40S ribosomal protein
           SA (p40) (34/67 kDa laminin receptor) - Homo sapiens
          Length = 99

 Score = 60.5 bits (140), Expect = 2e-08
 Identities = 29/45 (64%), Positives = 31/45 (68%)
 Frame = +3

Query: 93  VLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXH 227
           VLK    TGA PIAG FTPG FTNQIQAAF E + L+V DP   H
Sbjct: 45  VLKRTTATGAIPIAGHFTPGNFTNQIQAAFSELQFLVVTDPRADH 89


>UniRef50_Q4GXR5 Cluster: Ribosomal protein SAe; n=2; Adephaga|Rep:
           Ribosomal protein SAe - Meladema coriacea
          Length = 112

 Score = 59.3 bits (137), Expect = 4e-08
 Identities = 24/44 (54%), Positives = 29/44 (65%)
 Frame = +2

Query: 347 GLMWWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESEKDEQ 478
           GL+WW             PR+  W+VVVDLFFYRDPEE+EK+EQ
Sbjct: 1   GLVWWLLAREVLRLRGLIPRETKWEVVVDLFFYRDPEEAEKEEQ 44


>UniRef50_A1RWV4 Cluster: Ribosomal protein S2; n=2; Archaea|Rep:
           Ribosomal protein S2 - Thermofilum pendens (strain Hrk
           5)
          Length = 214

 Score = 59.3 bits (137), Expect = 4e-08
 Identities = 29/76 (38%), Positives = 40/76 (52%)
 Frame = +3

Query: 18  ARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRL 197
           A  ++A  +P+   V+S R +G R V KF    G  P+ GR  PG FTN   + F E  L
Sbjct: 63  AAKMIARYDPSKFVVVSGRQYGHRPVRKFCGLVGCKPMLGRVLPGTFTNPALSHFTEADL 122

Query: 198 LIVLDPAQXHQPITEA 245
           ++V DP    Q + EA
Sbjct: 123 MMVTDPRVDEQAVVEA 138



 Score = 44.0 bits (99), Expect = 0.002
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IPVIA C+TDSP+  VD+ IP N +   ++ L++W
Sbjct: 143 IPVIALCDTDSPISNVDLIIPTNNRGRKALALIFW 177


>UniRef50_Q862Y3 Cluster: Similar to C10 protein; n=3; Eutheria|Rep:
           Similar to C10 protein - Bos taurus (Bovine)
          Length = 130

 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +2

Query: 329 KSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESEKDEQ 478
           K +HS+GL+WW              R+  W+V+ DL+FYRDPEE EK+EQ
Sbjct: 1   KGAHSVGLIWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQ 50


>UniRef50_Q8TT39 Cluster: 30S ribosomal protein S2P; n=10;
           Euryarchaeota|Rep: 30S ribosomal protein S2P -
           Methanosarcina acetivorans
          Length = 225

 Score = 58.4 bits (135), Expect = 8e-08
 Identities = 30/82 (36%), Positives = 45/82 (54%)
 Frame = +3

Query: 9   VLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFRE 188
           +  A  +++  +PA + V+SSR +GQ     F+   G   + GRF PG+ TN     F E
Sbjct: 83  IRVASKLLSHYDPARILVVSSRQYGQHPARMFSRALGTRAMLGRFIPGSLTNPQIHGFFE 142

Query: 189 PRLLIVLDPAQXHQPITEASYV 254
           P ++IV DPA   Q + EAS +
Sbjct: 143 PDVIIVTDPAGDAQVLKEASSI 164



 Score = 36.7 bits (81), Expect = 0.27
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           +PV+A C+T++    VD+ IP N K   ++ L++W
Sbjct: 166 VPVVALCDTNNLTSNVDLVIPTNNKGRKALSLVYW 200


>UniRef50_P54109 Cluster: 30S ribosomal protein S2P; n=10;
           Euryarchaeota|Rep: 30S ribosomal protein S2P -
           Methanococcus jannaschii
          Length = 222

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           +L +AA+ +   E P D+  +S R +    + +F  +TG   +AGRF PG  TN     F
Sbjct: 52  RLRIAAKFLARYE-PEDILAVSRRIYTMGPLEEFGKYTGIRTVAGRFVPGTLTNPAYKGF 110

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EP ++ + DP    Q + EA+ +
Sbjct: 111 MEPEVVFISDPRVDRQALKEATEI 134



 Score = 34.7 bits (76), Expect = 1.1
 Identities = 10/35 (28%), Positives = 22/35 (62%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           +P++  C+T+    F+D+ IP N K   ++ L+++
Sbjct: 136 VPIVGLCDTEHLTSFIDLVIPTNNKGKKAVALIYY 170


>UniRef50_UPI00015531E2 Cluster: PREDICTED: similar to Ribosomal
           protein SA; n=1; Mus musculus|Rep: PREDICTED: similar to
           Ribosomal protein SA - Mus musculus
          Length = 181

 Score = 54.4 bits (125), Expect = 1e-06
 Identities = 36/82 (43%), Positives = 44/82 (53%)
 Frame = +3

Query: 6   LVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFR 185
           L+L A+  VA EN  +V +ISS   G          TGA P AG F P  F N IQA F+
Sbjct: 77  LLLEAQTTVANENSTNVRLISS--LGTN-------FTGAIPTAGSFIPRPFINLIQATFQ 127

Query: 186 EPRLLIVLDPAQXHQPITEASY 251
              LL+V  P    QP+TEAS+
Sbjct: 128 VTCLLVVTGPKMNQQPLTEASF 149


>UniRef50_UPI0000EB1146 Cluster: UPI0000EB1146 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB1146 UniRef100
           entry - Canis familiaris
          Length = 222

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 23/38 (60%), Positives = 28/38 (73%)
 Frame = +3

Query: 60  VISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQ 173
           V SSR  GQ+AVL FAA  G+ P +GRFTPG  T+Q+Q
Sbjct: 48  VTSSRTTGQQAVLSFAAAVGSAPTSGRFTPGTLTDQVQ 85



 Score = 44.4 bits (100), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA  + DS     DIA PCN K  HS+GLM W               +  W    D+
Sbjct: 95  LPPIALYDADSSWCSADIA-PCNIKGVHSVGLMCW--VLAGEALSFLNTHEWSWP---DV 148

Query: 437 FFYRDPEESEKDE 475
           +FYRDPE+ ++ +
Sbjct: 149 YFYRDPEKIKEGQ 161


>UniRef50_Q9U5P8 Cluster: Putative uncharacterized protein; n=1;
           Entodinium caudatum|Rep: Putative uncharacterized
           protein - Entodinium caudatum
          Length = 163

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 18/35 (51%), Positives = 29/35 (82%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           +PVIA CN+D+ L +VD AIPCN ++++SI ++W+
Sbjct: 46  LPVIAICNSDNMLKYVDCAIPCNNRNNYSIAMIWY 80



 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +3

Query: 129 IAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYV 254
           + GR++PG  TNQ    + EPRLLIV DP   +  I E+SYV
Sbjct: 3   VTGRWSPGMLTNQTTKKYVEPRLLIVSDPRTDYNAILESSYV 44


>UniRef50_P29202 Cluster: 30S ribosomal protein S2P; n=12;
           Euryarchaeota|Rep: 30S ribosomal protein S2P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 267

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 25/67 (37%), Positives = 33/67 (49%)
 Frame = +3

Query: 45  PADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQX 224
           P  +   SSR +G+    KFA   GA    GRF PG  TN     + EP +++V DP   
Sbjct: 137 PEQILAASSRQYGRFPAEKFAEAIGARVRTGRFIPGTLTNPDYDGYIEPDIVVVTDPIGD 196

Query: 225 HQPITEA 245
            Q + EA
Sbjct: 197 AQAVKEA 203



 Score = 35.1 bits (77), Expect = 0.84
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IPVIA C++++    VD+ +P N K   ++ +++W
Sbjct: 208 IPVIAMCDSNNTTSNVDLVVPTNNKGRKALSVVYW 242


>UniRef50_A0RY14 Cluster: Ribosomal protein S2; n=2;
           Thermoprotei|Rep: Ribosomal protein S2 - Cenarchaeum
           symbiosum
          Length = 208

 Score = 48.4 bits (110), Expect = 8e-05
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +3

Query: 9   VLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFRE 188
           + AA   +     +++ V S +   +  + KFA   G   I  RF PG  TN     + E
Sbjct: 56  IKAAAQFIEHTGASELIVCSGKDSARVPIRKFAELVGCKDIHKRFMPGTLTNPDLPKYME 115

Query: 189 PRLLIVLDPAQXHQPITEAS 248
           P+LL+V DP    Q +TEA+
Sbjct: 116 PKLLLVCDPQVDAQAVTEAT 135


>UniRef50_Q8JIE5 Cluster: 67kD laminin receptor/ribosomal protein;
           n=3; Euteleostomi|Rep: 67kD laminin receptor/ribosomal
           protein - Agalychnis callidryas (Red-eyed leaf frog)
          Length = 140

 Score = 46.0 bits (104), Expect = 4e-04
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 356 WWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESEKDEQ 478
           WW              R+  W+V+ DL+FYRDPEE EK+EQ
Sbjct: 1   WWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQ 41


>UniRef50_A3H8R8 Cluster: Ribosomal protein S2; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein S2 -
           Caldivirga maquilingensis IC-167
          Length = 215

 Score = 46.0 bits (104), Expect = 4e-04
 Identities = 26/82 (31%), Positives = 39/82 (47%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           ++ +AAR +     P+ V V S++ +  + +  F    G  P+ GR  PG  TN      
Sbjct: 62  RIRIAARMITRYP-PSRVMVHSTKPYAFKPIQMFCKFVGCLPVTGRLIPGTLTNPYLTHH 120

Query: 183 REPRLLIVLDPAQXHQPITEAS 248
            +  LL+V DP    Q I EAS
Sbjct: 121 IDIDLLMVADPKTDFQAINEAS 142



 Score = 45.2 bits (102), Expect = 8e-04
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IPVIA  +TDS   F+D+ IPCN K  +S+ L++W
Sbjct: 146 IPVIALVDTDSDPTFIDLMIPCNNKGRNSLALVFW 180


>UniRef50_UPI0000D9C04A Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 136

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -2

Query: 478 LFILFTFFRVTVEEQINHNIPALVTGKHTTKPXXFTCQQPPHQ 350
           LF L +FFR++VE  I H++P + TG   T    F  Q PPHQ
Sbjct: 93  LFFL-SFFRISVEVGIRHDLPRVFTGNGATHAQNFLSQHPPHQ 134


>UniRef50_Q6PDB3 Cluster: LOC204010 protein; n=2; Eutheria|Rep:
           LOC204010 protein - Homo sapiens (Human)
          Length = 197

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 27/64 (42%), Positives = 31/64 (48%)
 Frame = +3

Query: 93  VLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYVXFL*LL 272
           +LKFAA TGATPIAG FTPG F  + +        L  L P            +  L LL
Sbjct: 1   MLKFAAATGATPIAGHFTPGTFLTRSRQPTGSHGFLWFLTPGLTTSLSQRHLVLTHLPLL 60

Query: 273 XATQ 284
            ATQ
Sbjct: 61  YATQ 64



 Score = 39.5 bits (88), Expect = 0.039
 Identities = 14/21 (66%), Positives = 20/21 (95%)
 Frame = +2

Query: 416 WDVVVDLFFYRDPEESEKDEQ 478
           W+V+ +L+FYRDPEE+EK+EQ
Sbjct: 108 WEVMSNLYFYRDPEETEKEEQ 128


>UniRef50_Q74M65 Cluster: NEQ508; n=1; Nanoarchaeum equitans|Rep:
           NEQ508 - Nanoarchaeum equitans
          Length = 201

 Score = 40.7 bits (91), Expect = 0.017
 Identities = 25/97 (25%), Positives = 44/97 (45%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           +L LA++ +   E P ++ V+  R      + KF+  T      GR+ PG  TN     +
Sbjct: 49  RLRLASKMLSYYE-PNEILVVGRRETAITPIKKFSEITKVKAFPGRYPPGTLTNPQLKYY 107

Query: 183 REPRLLIVLDPAQXHQPITEASYVXFL*LLXATQTPH 293
            EP ++++ DP      + +A Y   + +L    T H
Sbjct: 108 MEPEVILITDPIMDKNALHDA-YESGITILALCDTNH 143



 Score = 37.1 bits (82), Expect = 0.21
 Identities = 16/61 (26%), Positives = 29/61 (47%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           I ++A C+T+    ++D  IP N + S S+ L++W              +D+   V V+ 
Sbjct: 133 ITILALCDTNHTKNYIDFCIPANNRGSKSLALIYWILAREYLRNRGVIGKDEQLKVPVEE 192

Query: 437 F 439
           F
Sbjct: 193 F 193


>UniRef50_UPI00005A3143 Cluster: PREDICTED: similar to 40S ribosomal
           protein SA (p40) (34/67 kDa laminin receptor); n=1;
           Canis lupus familiaris|Rep: PREDICTED: similar to 40S
           ribosomal protein SA (p40) (34/67 kDa laminin receptor)
           - Canis familiaris
          Length = 160

 Score = 38.7 bits (86), Expect = 0.068
 Identities = 29/76 (38%), Positives = 36/76 (47%)
 Frame = +3

Query: 114 TGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYVXFL*LLXATQTPH 293
           T A+PI+G      F NQ QAA  EPRLL+V  P   HQ +     + +L  L    TP 
Sbjct: 17  TAASPISG-----TFANQTQAARWEPRLLMVTHPRADHQ-LLRRHTLTWLSSLGVRPTPL 70

Query: 294 *XLWTLLSHATPSLPT 341
              WT    AT +  T
Sbjct: 71  SAAWTRPPPATAATAT 86


>UniRef50_Q3LVY7 Cluster: Ribosomal RNA S0; n=1; Bigelowiella
           natans|Rep: Ribosomal RNA S0 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 211

 Score = 37.9 bits (84), Expect = 0.12
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWW 361
           IP+I  CNTD+ + F+D  +P NT S  S  ++++
Sbjct: 134 IPIIGICNTDTNISFIDWVLPSNTNSKFSNAMIFY 168


>UniRef50_Q9XUS0 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 294

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 21/73 (28%), Positives = 30/73 (41%)
 Frame = +2

Query: 11  SGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRCFY*PDPSCIP*T 190
           S  SCC S      C+   +   +S+C T +C+  +C   C    T       PSC    
Sbjct: 38  SSSSCCSSSSSNSYCIPVCMAQCQSSCTTPICQ-QQCSNQCNQQCTSITISSGPSCSSCQ 96

Query: 191 SSLDCIGPCTXPS 229
           S+  C   CT P+
Sbjct: 97  SA--CSSACTTPT 107


>UniRef50_Q7YWV7 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 212

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 83  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 124


>UniRef50_Q17641 Cluster: Putative uncharacterized protein; n=11;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 197

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%)
 Frame = +2

Query: 14  GCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHR-CYAYCG 136
           GC CC        C R   T  R+ CCT  C   R C   CG
Sbjct: 83  GCGCCCCRPRCCCCCRRCCTCCRTCCCTRCCTCCRPCCCGCG 124


>UniRef50_UPI000155F1D6 Cluster: PREDICTED: similar to keratin
           associated protein 9.3; n=1; Equus caballus|Rep:
           PREDICTED: similar to keratin associated protein 9.3 -
           Equus caballus
          Length = 302

 Score = 33.9 bits (74), Expect = 1.9
 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 1/76 (1%)
 Frame = +2

Query: 5   TCSGCS-CCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRCFY*PDPSCI 181
           T S CS CC+       C     T  +S+CC   C   RC   C    T C+    P+C+
Sbjct: 2   THSCCSPCCQPTCSESSCCGQ--TCSQSSCCQPCCPQTRCQTTC--CRTTCY---QPTCV 54

Query: 182 P*TSSLDCIGPCTXPS 229
                  C  PC  P+
Sbjct: 55  TSCRPSCCSAPCCQPT 70


>UniRef50_Q8EUG1 Cluster: Ribosomal protein S2; n=1; Mycoplasma
           penetrans|Rep: Ribosomal protein S2 - Mycoplasma
           penetrans
          Length = 367

 Score = 33.9 bits (74), Expect = 1.9
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLM 355
           IPVIA CNT++    VD  IP N  S  S+ L+
Sbjct: 286 IPVIAICNTNANPDLVDYVIPANNHSIKSVYLL 318


>UniRef50_Q8DKR9 Cluster: Tll0788 protein; n=1; Synechococcus
           elongatus|Rep: Tll0788 protein - Synechococcus elongatus
           (Thermosynechococcus elongatus)
          Length = 226

 Score = 33.9 bits (74), Expect = 1.9
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 103 LPXTPVLRL---LRDVSHQVLLLT-RSKLHSVNLVS*LYWTLHXTINPLLKLHMSXSCDC 270
           +P T VLR+   +R++  Q LL T  S    ++L   +Y T+H  +  LL+  +  S DC
Sbjct: 70  VPLTGVLRIALMVRNIFGQWLLNTGESIFQRISLAGTIYHTIHKVLQQLLETILRDSRDC 129

Query: 271 FXQHRL 288
           F  HRL
Sbjct: 130 F--HRL 133


>UniRef50_UPI0000F1D36B Cluster: PREDICTED: hypothetical protein;
           n=3; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 816

 Score = 31.9 bits (69), Expect = 7.8
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -3

Query: 441 KNKSTTTSQXWSRGSTPRSLSXSRANNHHIKP-IEWEDLVLHGIAMSTNXSGESV 280
           K++     +  S GS PRS S     +H  K  + W  L+ H + +S + +G+SV
Sbjct: 611 KDREREKERSASSGSLPRSPSEGYIEDHTNKTSLSWPSLLSHSLDLSLSVTGDSV 665


>UniRef50_Q7NAW2 Cluster: RpsB; n=1; Mycoplasma gallisepticum|Rep:
           RpsB - Mycoplasma gallisepticum
          Length = 323

 Score = 31.9 bits (69), Expect = 7.8
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLM 355
           IPVIA CNT+S    + + IP N  +  S+ L+
Sbjct: 224 IPVIALCNTNSDPNVITLPIPANNYNIRSVTLL 256


>UniRef50_Q5A8K1 Cluster: Likely mitochondrial ribosomal protein;
           n=3; Saccharomycetales|Rep: Likely mitochondrial
           ribosomal protein - Candida albicans (Yeast)
          Length = 460

 Score = 31.9 bits (69), Expect = 7.8
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLM 355
           IP I  C+TD     +   IPCN  S  S+ LM
Sbjct: 396 IPTIGLCDTDMEPSLLTYPIPCNDDSVRSVNLM 428


>UniRef50_P75560 Cluster: 30S ribosomal protein S2; n=4;
           Mycoplasma|Rep: 30S ribosomal protein S2 - Mycoplasma
           pneumoniae
          Length = 294

 Score = 31.9 bits (69), Expect = 7.8
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +2

Query: 248 ICXIPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLM 355
           I  IPV+A CNT++    VD  IP N     S  L+
Sbjct: 193 ILRIPVVALCNTNTNPELVDFIIPANNHQPQSTCLL 228


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 466,356,462
Number of Sequences: 1657284
Number of extensions: 8550219
Number of successful extensions: 18467
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 17991
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18452
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 27710252790
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -