SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2F5N3 Cluster: Progesterone membrane binding protein; ...   189   6e-47
UniRef50_Q9VXM4 Cluster: CG9066-PA; n=13; Eumetazoa|Rep: CG9066-...   133   4e-30
UniRef50_O15173 Cluster: Membrane-associated progesterone recept...   115   9e-25
UniRef50_O00264 Cluster: Membrane-associated progesterone recept...   105   8e-22
UniRef50_Q5DA00 Cluster: SJCHGC02657 protein; n=2; Schistosoma j...    96   8e-19
UniRef50_A3C683 Cluster: Putative uncharacterized protein; n=3; ...    88   2e-16
UniRef50_Q4PCZ7 Cluster: Putative uncharacterized protein; n=1; ...    88   2e-16
UniRef50_Q9TY05 Cluster: Vema (Mammalian ventral midline antigen...    83   6e-15
UniRef50_Q9XFM6 Cluster: Membrane steroid-binding protein 1; n=1...    83   6e-15
UniRef50_Q5A6R5 Cluster: Potential sterol binding protein; n=4; ...    82   1e-14
UniRef50_Q6CGC8 Cluster: Similar to DEHA0F16170g Debaryomyces ha...    82   1e-14
UniRef50_Q6K680 Cluster: Cytochrome b5 domain-containing protein...    78   2e-13
UniRef50_Q2UL06 Cluster: Predicted protein; n=17; Ascomycota|Rep...    78   2e-13
UniRef50_O13995 Cluster: Uncharacterized protein C25B8.01; n=1; ...    77   5e-13
UniRef50_UPI00005A4C7C Cluster: PREDICTED: similar to progestero...    74   3e-12
UniRef50_Q9SK39 Cluster: Putative steroid-binding protein 3; n=9...    74   3e-12
UniRef50_Q9VJY5 Cluster: CG16957-PA; n=1; Drosophila melanogaste...    74   4e-12
UniRef50_Q5KKK4 Cluster: Sterol metabolism-related protein, puta...    73   9e-12
UniRef50_A7RGM7 Cluster: Predicted protein; n=1; Nematostella ve...    69   8e-11
UniRef50_UPI0001555E6D Cluster: PREDICTED: similar to Membrane-a...    68   2e-10
UniRef50_Q12091 Cluster: Damage response protein 1; n=6; Sacchar...    68   2e-10
UniRef50_Q4PA55 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q5K7U7 Cluster: Sterol metabolism-related protein, puta...    67   3e-10
UniRef50_Q9UMX5 Cluster: Neudesin precursor; n=16; Euteleostomi|...    66   7e-10
UniRef50_Q28FI8 Cluster: Novel protein; n=1; Xenopus tropicalis|...    66   1e-09
UniRef50_Q08CU3 Cluster: Zgc:152703 protein; n=4; Danio rerio|Re...    64   2e-09
UniRef50_Q2HIW2 Cluster: At4g14965; n=5; eurosids II|Rep: At4g14...    64   2e-09
UniRef50_A7RVD3 Cluster: Predicted protein; n=2; Nematostella ve...    64   2e-09
UniRef50_A4RTI1 Cluster: Predicted protein; n=1; Ostreococcus lu...    63   5e-09
UniRef50_Q7PFB5 Cluster: ENSANGP00000024835; n=1; Anopheles gamb...    63   5e-09
UniRef50_Q4Q088 Cluster: Putative uncharacterized protein; n=3; ...    63   5e-09
UniRef50_UPI000023E491 Cluster: hypothetical protein FG06024.1; ...    63   7e-09
UniRef50_UPI0000DB6E94 Cluster: PREDICTED: similar to cytochrome...    62   9e-09
UniRef50_Q4DSD9 Cluster: Putative uncharacterized protein; n=1; ...    62   9e-09
UniRef50_Q7SC03 Cluster: Putative uncharacterized protein NCU094...    62   1e-08
UniRef50_A2QHP2 Cluster: Contig An04c0030, complete genome; n=6;...    62   2e-08
UniRef50_A7E6A3 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q4P0T2 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_Q16KM9 Cluster: Putative uncharacterized protein; n=1; ...    60   5e-08
UniRef50_A1CNI2 Cluster: Heme/steroid binding domain protein, pu...    60   5e-08
UniRef50_UPI0000D56BB2 Cluster: PREDICTED: similar to CG12056-PA...    59   1e-07
UniRef50_Q018M8 Cluster: COG1587: Uroporphyrinogen-III synthase;...    59   1e-07
UniRef50_A2CES0 Cluster: Novel protein; n=4; Clupeocephala|Rep: ...    58   1e-07
UniRef50_Q59VV5 Cluster: Potential sterol binding protein; n=6; ...    58   1e-07
UniRef50_A6RNV0 Cluster: Putative uncharacterized protein; n=1; ...    58   1e-07
UniRef50_UPI00015549AD Cluster: PREDICTED: similar to putative p...    58   2e-07
UniRef50_Q4WRF3 Cluster: Heme/steroid binding domain protein, pu...    58   3e-07
UniRef50_Q6C724 Cluster: Similar to DEHA0D10263g Debaryomyces ha...    57   3e-07
UniRef50_Q2UG60 Cluster: Predicted protein; n=3; Ascomycota|Rep:...    57   3e-07
UniRef50_Q0V1T5 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_UPI00015B5147 Cluster: PREDICTED: hypothetical protein;...    57   5e-07
UniRef50_UPI000058795F Cluster: PREDICTED: hypothetical protein;...    57   5e-07
UniRef50_A2Z940 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_Q581R4 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_Q8WUJ1 Cluster: Cytochrome b5 domain-containing protein...    56   8e-07
UniRef50_A4RIB7 Cluster: Putative uncharacterized protein; n=4; ...    56   1e-06
UniRef50_Q54S39 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q756V7 Cluster: AER144Cp; n=1; Eremothecium gossypii|Re...    54   3e-06
UniRef50_Q0DU60 Cluster: Os03g0205500 protein; n=5; Magnoliophyt...    53   6e-06
UniRef50_Q9W376 Cluster: CG12056-PA; n=2; Sophophora|Rep: CG1205...    53   6e-06
UniRef50_Q5KP22 Cluster: Sterol metabolism-related protein, puta...    52   1e-05
UniRef50_Q2UQX7 Cluster: Predicted protein; n=3; Eurotiomycetida...    52   1e-05
UniRef50_A7TMB2 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q4QFG4 Cluster: Putative uncharacterized protein; n=5; ...    50   7e-05
UniRef50_Q9XXA7 Cluster: Putative uncharacterized protein tag-13...    49   9e-05
UniRef50_Q57VA0 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_A3LW42 Cluster: Predicted protein; n=5; Saccharomycetal...    46   9e-04
UniRef50_Q0MYV5 Cluster: Putative cytochrome b5 domain-containin...    46   0.001
UniRef50_Q4Q2N9 Cluster: Putative uncharacterized protein; n=3; ...    46   0.001
UniRef50_Q22S10 Cluster: Cytochrome b5-like Heme/Steroid binding...    45   0.002
UniRef50_A7SHQ1 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.003
UniRef50_Q00ZN7 Cluster: Putative steroid membrane receptor Hpr6...    44   0.005
UniRef50_A0CJD6 Cluster: Chromosome undetermined scaffold_2, who...    43   0.006
UniRef50_Q6CWE2 Cluster: Similar to ca|CA1625|IPF6156 Candida al...    41   0.032
UniRef50_Q6NMU0 Cluster: AT07779p; n=2; Drosophila melanogaster|...    40   0.074
UniRef50_Q9VQ46 Cluster: CG15623-PA; n=2; Drosophila melanogaste...    38   0.17 
UniRef50_Q29LP2 Cluster: GA20245-PA; n=1; Drosophila pseudoobscu...    38   0.17 
UniRef50_Q4D362 Cluster: Putative uncharacterized protein; n=2; ...    37   0.40 
UniRef50_UPI0000E24C07 Cluster: PREDICTED: similar to Cytochrome...    35   2.1  
UniRef50_Q8BHV3 Cluster: Adult retina cDNA, RIKEN full-length en...    35   2.1  
UniRef50_A4RFR1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.7  
UniRef50_Q9SUK6 Cluster: Glycoprotein homolog; n=5; Brassicaceae...    33   6.4  
UniRef50_Q6LF57 Cluster: Putative uncharacterized protein; n=1; ...    33   6.4  
UniRef50_Q6PGW0 Cluster: Transcription elongation regulator 1; n...    33   8.5  
UniRef50_Q0TXS1 Cluster: Putative uncharacterized protein; n=1; ...    33   8.5  

>UniRef50_Q2F5N3 Cluster: Progesterone membrane binding protein;
           n=1; Bombyx mori|Rep: Progesterone membrane binding
           protein - Bombyx mori (Silk moth)
          Length = 226

 Score =  189 bits (460), Expect = 6e-47
 Identities = 92/119 (77%), Positives = 97/119 (81%)
 Frame = +3

Query: 213 KGCSLEKTT*IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFG 392
           K   L+K   + K MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFG
Sbjct: 54  KVAPLKKLPKLRKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFG 113

Query: 393 GRDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
           GRDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWE+        + D  G +  PG
Sbjct: 114 GRDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWEEQFRE----NYDLVGRLLRPG 168



 Score =  126 bits (304), Expect = 5e-28
 Identities = 56/56 (100%), Positives = 56/56 (100%)
 Frame = +1

Query: 55  MDSPPEVENVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYYKYKTHCSKVA 222
           MDSPPEVENVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYYKYKTHCSKVA
Sbjct: 1   MDSPPEVENVQAKHSGFFETLKTLFCQPFIYFVFVSTFVILYKFYYKYKTHCSKVA 56



 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 40/41 (97%), Positives = 41/41 (100%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKE 631
           QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDK+
Sbjct: 153 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKK 193



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = +1

Query: 631 KPNWNFHCKMTVALPSK 681
           K NWNFHCKMTVALPSK
Sbjct: 193 KTNWNFHCKMTVALPSK 209


>UniRef50_Q9VXM4 Cluster: CG9066-PA; n=13; Eumetazoa|Rep: CG9066-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 248

 Score =  133 bits (321), Expect = 4e-30
 Identities = 61/89 (68%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I +  T  ELRQYDGTQ  GRVL+AVNG ++DV++G RFYGPGGPYA F GRDA+R LAT
Sbjct: 79  IRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLAT 138

Query: 423 FSVTAPEKD-YDDLSDLNSMEMESVREWE 506
           FSV + +KD YDDLSDL+++EM+SVREWE
Sbjct: 139 FSVVSIDKDEYDDLSDLSAVEMDSVREWE 167



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKENQ 637
           QF+E Y+LVG+LLR GEEP NY D+E EE     + ND++E +
Sbjct: 169 QFKEKYELVGKLLRKGEEPTNYDDDEDEE----NVNNDEQERK 207


>UniRef50_O15173 Cluster: Membrane-associated progesterone receptor
           component 2; n=37; Euteleostomi|Rep: Membrane-associated
           progesterone receptor component 2 - Homo sapiens (Human)
          Length = 223

 Score =  115 bits (277), Expect = 9e-25
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 2/103 (1%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAP 440
           +LRQYDG++   R+L+AVNG +FDVT+G++FYGP GPY +F GRDA+RGLATF +   A 
Sbjct: 107 QLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDAL 165

Query: 441 EKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
             +YDDLSDLN+++MESVREWE   +       D+ G +  PG
Sbjct: 166 RDEYDDLSDLNAVQMESVREWEMQFKE----KYDYVGRLLKPG 204



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 189 QFKEKYDYVGRLLKPGEEPSEYTDEE 214


>UniRef50_O00264 Cluster: Membrane-associated progesterone receptor
           component 1; n=18; Eutheria|Rep: Membrane-associated
           progesterone receptor component 1 - Homo sapiens (Human)
          Length = 195

 Score =  105 bits (253), Expect = 8e-22
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP GPY VF GRDA+RGLATF +  
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDK 132

Query: 432 TAPEKDYDDLSDLNSMEMESVREWE 506
            A + +YDDLSDL + + E++ +WE
Sbjct: 133 EALKDEYDDLSDLTAAQQETLSDWE 157



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPND 622
           QF   Y  VG+LL+ GEEP  YSDEE E  D SA  ND
Sbjct: 159 QFTFKYHHVGKLLKEGEEPTVYSDEE-EPKDESARKND 195


>UniRef50_Q5DA00 Cluster: SJCHGC02657 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC02657 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 176

 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 45/84 (53%), Positives = 62/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVT-RGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           T  EL+ +DG+ E  R+L+AVNG IFDVT +G  FYG G PYA F G+DA+R LA F++ 
Sbjct: 48  TLEELQNFDGSGEHKRILLAVNGKIFDVTNKGQEFYGRGAPYAAFAGKDASRALACFNLE 107

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
             + +YDDLSDL + +M+++REWE
Sbjct: 108 TKD-EYDDLSDLTADQMKTLREWE 130



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEE 595
           QF E YD +GRLL+PGE  R Y   + ++
Sbjct: 132 QFSERYDHIGRLLKPGEPHRVYEINDGDD 160


>UniRef50_A3C683 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 291

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 40/84 (47%), Positives = 59/84 (70%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +TA EL QYDG+     +LMA+ G I+DV++   FYGPGGPYA+F G+DA+R LA  S  
Sbjct: 147 ITAEELLQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAGKDASRALAKMSF- 205

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
            P+   DD+S L+ +E+ ++++WE
Sbjct: 206 EPQDLTDDISGLSLLELSALQDWE 229


>UniRef50_Q4PCZ7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 204

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 9/94 (9%)
 Frame = +3

Query: 252 RMTAVELRQYDGT----QEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLA 419
           + T   L  YDGT    Q+G R+L+A+N  +FDVT+G  FYGPGGPY  F GRDA+RG+A
Sbjct: 92  KYTPRTLAIYDGTGTTDQDGSRILLAINRKVFDVTKGKNFYGPGGPYGNFAGRDASRGMA 151

Query: 420 TFS-----VTAPEKDYDDLSDLNSMEMESVREWE 506
             S     +T  +K  D L DL + E+++++EWE
Sbjct: 152 KQSFDLEMLTPLDKPIDKLEDLTASEVKNMKEWE 185


>UniRef50_Q9TY05 Cluster: Vema (Mammalian ventral midline antigen)
           related protein 1, isoform a; n=3; Caenorhabditis|Rep:
           Vema (Mammalian ventral midline antigen) related protein
           1, isoform a - Caenorhabditis elegans
          Length = 198

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 38/84 (45%), Positives = 50/84 (59%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           MT  ELR+YDG +    +L  +NG I+DVTRG  FYGPG  Y    G DATR L T    
Sbjct: 65  MTVEELRKYDGVKNE-HILFGLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGTMDQN 123

Query: 435 APEKDYDDLSDLNSMEMESVREWE 506
           A   ++DD + +++ E E+  EWE
Sbjct: 124 AVSSEWDDHTGISADEQETANEWE 147


>UniRef50_Q9XFM6 Cluster: Membrane steroid-binding protein 1; n=14;
           Magnoliophyta|Rep: Membrane steroid-binding protein 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 220

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL+QYDG+     +LMA+   I+DVT+   FYGPGGPYA+F G+DA+R LA  S  
Sbjct: 75  ITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSF- 133

Query: 435 APEKDYD-DLSDLNSMEMESVREWE 506
             EKD   D+S L   E++++++WE
Sbjct: 134 -EEKDLTWDVSGLGPFELDALQDWE 157


>UniRef50_Q5A6R5 Cluster: Potential sterol binding protein; n=4;
           Saccharomycetales|Rep: Potential sterol binding protein
           - Candida albicans (Yeast)
          Length = 155

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 41/102 (40%), Positives = 65/102 (63%), Gaps = 5/102 (4%)
 Frame = +3

Query: 228 EKTT*IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDAT 407
           +++T +  + T + L +Y+G ++  ++ +AV   +FDVT+G  FYGPGGPY  F GRDA+
Sbjct: 36  KESTIVEGKFTPISLTKYNG-KDSPKIFIAVKNRVFDVTQGGAFYGPGGPYENFAGRDAS 94

Query: 408 RGLATFS-----VTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
           RGLA  S     +T   +  D L+DL ++E ES+  WE++ E
Sbjct: 95  RGLAKNSFDPDVLTDINEPIDTLTDLTAVEKESLDGWEEHFE 136


>UniRef50_Q6CGC8 Cluster: Similar to DEHA0F16170g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0F16170g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 149

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 41/88 (46%), Positives = 59/88 (67%), Gaps = 5/88 (5%)
 Frame = +3

Query: 270 LRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS-----VT 434
           L +++GT +  RVLM V G ++DVT G +FYGPGGPY  F GRDA+RGLA  S     +T
Sbjct: 49  LAKFNGTDDP-RVLMGVKGKVYDVTAGKKFYGPGGPYENFAGRDASRGLAKTSFDPAMLT 107

Query: 435 APEKDYDDLSDLNSMEMESVREWEDNLE 518
             ++  D L+DL + E+E++ +WE  +E
Sbjct: 108 PIDQPLDTLADLENHELETLDKWEMTIE 135


>UniRef50_Q6K680 Cluster: Cytochrome b5 domain-containing
           protein-like; n=3; Oryza sativa|Rep: Cytochrome b5
           domain-containing protein-like - Oryza sativa subsp.
           japonica (Rice)
          Length = 102

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 37/92 (40%), Positives = 54/92 (58%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +A  +TA +LR YDG+     + ++V G ++DVT G  FYGPGG YAVF GR+A+R L  
Sbjct: 1   MAAELTAAQLRAYDGSDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGK 60

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
            S    +    DLS L+  E+  + +WE   +
Sbjct: 61  MSKDDADVS-GDLSGLSDKELGVLADWETKFQ 91


>UniRef50_Q2UL06 Cluster: Predicted protein; n=17; Ascomycota|Rep:
           Predicted protein - Aspergillus oryzae
          Length = 208

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 42/103 (40%), Positives = 63/103 (61%), Gaps = 7/103 (6%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLA- 419
           + +  T   L +++G  +G  V +AV G +FDV+ G  FYGPGGPY  F GRDA+RGLA 
Sbjct: 92  VFRTFTPTTLLEFNGV-DGKPVYLAVRGRVFDVSPGRNFYGPGGPYENFAGRDASRGLAC 150

Query: 420 -TFSVTAPEKD----YDDLSDLNSMEMESVREWEDN-LERIMI 530
            +F      KD     DDL DL++  +E+++ WE+  LE+ ++
Sbjct: 151 QSFDEEMLTKDLKAPLDDLKDLDAEALENLQSWEERFLEKYLV 193


>UniRef50_O13995 Cluster: Uncharacterized protein C25B8.01; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C25B8.01 - Schizosaccharomyces pombe (Fission yeast)
          Length = 166

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 37/89 (41%), Positives = 57/89 (64%), Gaps = 6/89 (6%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT- 434
           T  EL++Y+G++    V +A+ G +++VT G++FYGP GPY+ F G DA+RGLA  S   
Sbjct: 44  TPAELKEYNGSKNS-LVFLAIKGTVYNVTMGSKFYGPQGPYSAFAGHDASRGLAKNSFDD 102

Query: 435 --APEKD---YDDLSDLNSMEMESVREWE 506
              P+ D    DD SDLN  E +++ +W+
Sbjct: 103 EFIPDSDAEELDDCSDLNDEERQALNDWK 131


>UniRef50_UPI00005A4C7C Cluster: PREDICTED: similar to progesterone
           receptor membrane component; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to progesterone
           receptor membrane component - Canis familiaris
          Length = 132

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 37/65 (56%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +3

Query: 282 DGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAPEKDYD 455
           DG Q+   +LM +N  +F VT+G +FYGP GPY VF GRDA+RGLATF +   A + +YD
Sbjct: 65  DGIQDP-HILMTINCKVFIVTKGCKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD 123

Query: 456 DLSDL 470
           DLSDL
Sbjct: 124 DLSDL 128


>UniRef50_Q9SK39 Cluster: Putative steroid-binding protein 3; n=9;
           Magnoliophyta|Rep: Putative steroid-binding protein 3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 100

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           TA +L QY+GT E   + +A+ G +FDVT G  FYG GG Y++F G+DA+R L   S   
Sbjct: 4   TAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKN- 62

Query: 438 PEKDYD-DLSDLNSMEMESVREWEDNLE 518
            E+D    L  L   E+ ++ +WE   E
Sbjct: 63  -EEDVSPSLEGLTEKEINTLNDWETKFE 89


>UniRef50_Q9VJY5 Cluster: CG16957-PA; n=1; Drosophila
           melanogaster|Rep: CG16957-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 192

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + K  T  ELR+YDGT+  GR+L+A+   I+DV+R   +YG  G    + GRD +R L  
Sbjct: 69  LRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILIN 128

Query: 423 FSVTAPE-KDYDDLSDLNSMEMESVREWE 506
                 + +D+DDLSDL+  +M ++REWE
Sbjct: 129 SPEDLKDSEDFDDLSDLSRNQMNTLREWE 157


>UniRef50_Q5KKK4 Cluster: Sterol metabolism-related protein,
           putative; n=2; Filobasidiella neoformans|Rep: Sterol
           metabolism-related protein, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 167

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 45/106 (42%), Positives = 60/106 (56%), Gaps = 19/106 (17%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAV-----------NG--WIFDVTRGNRFYGPGGPYAVFGGR 398
           T  +L QYDGT  G R+L+A+           NG   +FDVT G  FYGP G Y  F GR
Sbjct: 51  TPAQLAQYDGTN-GDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGVYGNFAGR 109

Query: 399 DATRGLATFS------VTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
           DA+RG+A  S      +T+ ++  DDLSDL   E+E++R W  + E
Sbjct: 110 DASRGMAKQSFEPGKFLTSIDEPLDDLSDLTPSEIENMRGWHQHFE 155


>UniRef50_A7RGM7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 112

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           +  T  EL+ YDG  +   + +AVNG +FDVT    ++GP GP  +  G+DA+R L TFS
Sbjct: 4   REFTVRELKGYDGVNKE-LIYVAVNGKVFDVTSAWNYFGPAGPDCLLAGKDASRALVTFS 62

Query: 429 V-----TAPEKDYDDLSDLNSMEMESVREWE 506
           V     T      DDL+DLN ++ + + E+E
Sbjct: 63  VDNFYQTEQRDSMDDLNDLNPLQRDCLFEYE 93


>UniRef50_UPI0001555E6D Cluster: PREDICTED: similar to
           Membrane-associated progesterone receptor component 2;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           Membrane-associated progesterone receptor component 2 -
           Ornithorhynchus anatinus
          Length = 172

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 2/68 (2%)
 Frame = +3

Query: 372 GPYAVFGGRDATRGLATFSVT--APEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF 545
           GPY +F GRDA+RGLATF +   A   +YDDLSDLN ++MESVREWE   +       D+
Sbjct: 90  GPYGIFAGRDASRGLATFCLDKEALRDEYDDLSDLNPVQMESVREWEMQFKE----KYDY 145

Query: 546 *GLVKNPG 569
            G +  PG
Sbjct: 146 VGRLLKPG 153



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 138 QFKEKYDYVGRLLKPGEEPSEYTDEE 163


>UniRef50_Q12091 Cluster: Damage response protein 1; n=6;
           Saccharomycetales|Rep: Damage response protein 1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 152

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 5/88 (5%)
 Frame = +3

Query: 270 LRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPE-K 446
           L +++G  +  ++ +A+ G ++D TRG +FYGP GPY  F G DA+RGLA  S      K
Sbjct: 49  LSKFNG-HDDEKIFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIK 107

Query: 447 DYDD----LSDLNSMEMESVREWEDNLE 518
           D+D     L DL   +++++ EW+++ E
Sbjct: 108 DWDQPIDPLDDLTKEQIDALDEWQEHFE 135


>UniRef50_Q4PA55 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 118

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 32/79 (40%), Positives = 46/79 (58%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL+QYDGT E   V +AV G +FDV+     Y PG  Y +F G+D +RGL   S+  PE 
Sbjct: 24  ELKQYDGTDESKPVYVAVKGTVFDVSPKREMYSPGKGYHIFAGKDGSRGLGMSSL-KPED 82

Query: 447 DYDDLSDLNSMEMESVREW 503
              D S L+  +++ + +W
Sbjct: 83  AVADYSTLDDKQLKVLNDW 101


>UniRef50_Q5K7U7 Cluster: Sterol metabolism-related protein,
           putative; n=1; Filobasidiella neoformans|Rep: Sterol
           metabolism-related protein, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 303

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/90 (35%), Positives = 51/90 (56%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL ++DG+     + +A+ G +FDV+  +  YGPG  Y VF G+D ++GL   S+ 
Sbjct: 69  ITPSELAKHDGSDPSKPIYVAIKGKVFDVSPRSEMYGPGKGYNVFAGKDGSKGLGMSSLD 128

Query: 435 APEKDYDDLSDLNSMEMESVREWEDNLERI 524
            P     D S LN  +M ++ +WE   E+I
Sbjct: 129 -PTDAVADYSSLNESQMNTLNQWEAFFEKI 157


>UniRef50_Q9UMX5 Cluster: Neudesin precursor; n=16;
           Euteleostomi|Rep: Neudesin precursor - Homo sapiens
           (Human)
          Length = 172

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +FDVT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>UniRef50_Q28FI8 Cluster: Novel protein; n=1; Xenopus
           tropicalis|Rep: Novel protein - Xenopus tropicalis
           (Western clawed frog) (Silurana tropicalis)
          Length = 273

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           M+  EL  YDG      + +A+ G +FDV +G++ YGPGG Y+ F G+DA+R   T   T
Sbjct: 47  MSKEELSVYDGGPGSSGIYLAILGQVFDVHKGSKHYGPGGSYSFFAGKDASRAYMTGDFT 106

Query: 435 APEKD-YDDLSDLNSMEMESVREW 503
             EK   DD+++L+ ++M  +  W
Sbjct: 107 --EKGLVDDVTELSPLQMLHLHNW 128


>UniRef50_Q08CU3 Cluster: Zgc:152703 protein; n=4; Danio rerio|Rep:
           Zgc:152703 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 158

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/81 (35%), Positives = 49/81 (60%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL++YDG+++G  + MA+ G +FDVT G  FY  G PY    G+D+TR +A  S+  
Sbjct: 34  TDEELQRYDGSEDGQPIYMAIKGVVFDVTTGKEFYKKGAPYNALVGKDSTRAVAKMSLDP 93

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L   +++S+ +
Sbjct: 94  ADLTH-DTTGLTESQLQSLEK 113


>UniRef50_Q2HIW2 Cluster: At4g14965; n=5; eurosids II|Rep: At4g14965
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 245

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 35/86 (40%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query: 249 KRM-TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATF 425
           KR+ +A EL  Y+GT E   +L+ + G +FDVT+G   YG GG Y  F GRDA+R   + 
Sbjct: 39  KRLFSAEELALYNGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSG 98

Query: 426 SVTAPEKDYDDLSDLNSMEMESVREW 503
           + T  +   D L  L+S E++S+ +W
Sbjct: 99  NFTG-DGLTDSLQGLSSSEVKSIVDW 123


>UniRef50_A7RVD3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 224

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           ++  +L ++DG+Q    + +A+ G ++DV +G RFYGPG  Y VF GRD+T    T  + 
Sbjct: 2   LSTEDLAKHDGSQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVT-GMF 60

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
              K  DD S+L + ++  ++ W
Sbjct: 61  DRAKATDDCSNLKNEDLLGIKGW 83


>UniRef50_A4RTI1 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 118

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 34/92 (36%), Positives = 42/92 (45%), Gaps = 1/92 (1%)
 Frame = +3

Query: 246 AKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATF 425
           A   T   LR       G     A +G +FD T G  FYG GGPYA   GRDATR LAT 
Sbjct: 11  ATTFTPATLRALVERSNGALCAFACDGVVFDATLGKDFYGVGGPYAALNGRDATRALATM 70

Query: 426 SVTAPEKDYD-DLSDLNSMEMESVREWEDNLE 518
            +   + D       L   E++++ EW    E
Sbjct: 71  KINVSDADEALGARGLTEEELKTLGEWRAKFE 102


>UniRef50_Q7PFB5 Cluster: ENSANGP00000024835; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000024835 - Anopheles gambiae
           str. PEST
          Length = 217

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/84 (38%), Positives = 46/84 (54%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  ELR+Y+G QE   + + + G ++DVT G + YGPG  Y +F G DATR   T     
Sbjct: 3   TETELRKYNG-QETNLLYLVILGHVYDVTVGFKHYGPGQSYHMFIGHDATRSFVTGEFDQ 61

Query: 438 PEKDYDDLSDLNSMEMESVREWED 509
              +  D+S L   E+E +  W+D
Sbjct: 62  YTLELSDVSALKETELEQLLTWKD 85


>UniRef50_Q4Q088 Cluster: Putative uncharacterized protein; n=3;
           Trypanosomatidae|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 146

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           TA EL Q+ G + G  + M+V G ++D T G  FYGPG  YAVF G++ +R L    ++ 
Sbjct: 38  TAAELAQFTG-ENGTPIYMSVKGKVYDCTDGAAFYGPGNSYAVFAGKEVSRCLGKMLISD 96

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
            E +  +  DL    M+S+ EW
Sbjct: 97  EEANV-NWDDLTPEHMQSLDEW 117


>UniRef50_UPI000023E491 Cluster: hypothetical protein FG06024.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG06024.1 - Gibberella zeae PH-1
          Length = 269

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 28/56 (50%), Positives = 34/56 (60%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           MT  EL  YDG      +L+A+NG I+DV+ G R YGPGG Y+ F   DA RG  T
Sbjct: 108 MTLDELSLYDGRDPDRPILLAINGTIYDVSPGRRMYGPGGSYSYFAATDAARGFVT 163


>UniRef50_UPI0000DB6E94 Cluster: PREDICTED: similar to cytochrome b5
           domain containing 2; n=1; Apis mellifera|Rep: PREDICTED:
           similar to cytochrome b5 domain containing 2 - Apis
           mellifera
          Length = 206

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 1/123 (0%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K  T+ EL++Y   + G  + +++ G +FDVT+G + YGPG  Y  F GRDA+    T  
Sbjct: 8   KIFTSSELKKYTNLENG--LYISILGHVFDVTKGAKHYGPGATYHAFTGRDASLAFITGE 65

Query: 429 VTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPGTTRTKN-PKKQTR 605
                   DD+S L+  +++++ +W     +  I+     G   N   + TK   KKQ  
Sbjct: 66  FN-DNNLIDDISSLSIQQVKALNDWVQFYNKNYIYKGKLNGKYYNEDGSPTKELHKKQMF 124

Query: 606 PLC 614
           P C
Sbjct: 125 PPC 127


>UniRef50_Q4DSD9 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 179

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 31/82 (37%), Positives = 49/82 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  ELR+YDG Q+G  + ++V G +++V    +FYGPG PY  + G + +R LA    TA
Sbjct: 69  TKEELREYDGIQKGD-IYVSVKGVVYEVAP--QFYGPGQPYHAYAGHEISRCLAKSDTTA 125

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
            E + + + D N  E+E++  W
Sbjct: 126 KEANKNWMHDCNEEELEALEWW 147


>UniRef50_Q7SC03 Cluster: Putative uncharacterized protein
           NCU09480.1; n=3; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU09480.1 - Neurospora crassa
          Length = 291

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/56 (48%), Positives = 35/56 (62%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  EL  +DGT E   + +A+NG I+DV+   R YGPGG Y VF G DA+R   T
Sbjct: 126 LTPAELAAFDGTDESKPIYLAINGTIYDVSANRRTYGPGGSYHVFAGVDASRAYVT 181


>UniRef50_A2QHP2 Cluster: Contig An04c0030, complete genome; n=6;
           Pezizomycotina|Rep: Contig An04c0030, complete genome -
           Aspergillus niger
          Length = 164

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 35/83 (42%), Positives = 46/83 (55%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL + DGT      L+A+ G +FDVTR N+ Y P G Y VF G+D +R LA+ S+ 
Sbjct: 64  ITVEELSKCDGTDPNRPTLVAIKGIVFDVTR-NQAYSPSGQYHVFAGKDPSRALASSSLK 122

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
           A E    D  DL   E   + EW
Sbjct: 123 A-EDCKPDWYDLEDKEKTVLDEW 144


>UniRef50_A7E6A3 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 275

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/56 (48%), Positives = 35/56 (62%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  +L QYDGT     + +A+NG I+DV+ G R YGPGG Y  F G DA+R   T
Sbjct: 113 LTDADLVQYDGTNPSLPIYLALNGTIYDVSAGRRHYGPGGSYQFFAGVDASRAFVT 168


>UniRef50_Q4P0T2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 526

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 29/81 (35%), Positives = 42/81 (51%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL  Y+G      + +A+ G ++DVT G R YGPGG Y+ F GRDA+R   T        
Sbjct: 411 ELAMYNGRDPNKPIYVAILGDVYDVTEGRRIYGPGGYYSFFSGRDASRAYVTGCFKTHLT 470

Query: 447 DYDDLSDLNSMEMESVREWED 509
              D+ D +  +M  +  W+D
Sbjct: 471 --HDVRDFDDKQMNDLMTWKD 489


>UniRef50_Q16KM9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 257

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 26/83 (31%), Positives = 46/83 (55%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +YDG +    + + + G+++DV +G + YGPG  Y +F G DA+R   +     
Sbjct: 50  TEQELVEYDGREGSKGLYLVILGYVYDVQKGVKHYGPGEAYNMFVGHDASRSFISGDFEE 109

Query: 438 PEKDYDDLSDLNSMEMESVREWE 506
              +  D+S L   E++S+ +W+
Sbjct: 110 YSPELSDVSSLTDSELKSIVKWK 132


>UniRef50_A1CNI2 Cluster: Heme/steroid binding domain protein,
           putative; n=3; Aspergillus|Rep: Heme/steroid binding
           domain protein, putative - Aspergillus clavatus
          Length = 243

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 27/56 (48%), Positives = 34/56 (60%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  +L  Y+GT     + +AVNG IFDV+     YGPGG Y+ F GRDATR   T
Sbjct: 88  LTPAQLALYNGTDASLPIYLAVNGTIFDVSANPHVYGPGGGYSFFAGRDATRAFVT 143


>UniRef50_UPI0000D56BB2 Cluster: PREDICTED: similar to CG12056-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG12056-PA - Tribolium castaneum
          Length = 239

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 29/82 (35%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           TA +LR+++G      + +A+ G +FDV++G+  YGPG  Y  F  +DA+R   T   T 
Sbjct: 33  TAADLRRFNGIDHPN-LYLAILGKVFDVSKGSAHYGPGATYNFFVAKDASRSFITGQFTE 91

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
            + D D +SDL   ++ S+  W
Sbjct: 92  GQAD-DRVSDLGPGDLRSLNHW 112


>UniRef50_Q018M8 Cluster: COG1587: Uroporphyrinogen-III synthase;
           n=3; Ostreococcus|Rep: COG1587: Uroporphyrinogen-III
           synthase - Ostreococcus tauri
          Length = 901

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/83 (36%), Positives = 44/83 (53%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL  +DG      +L+A  G I+DVTRG  FYG G  Y  F G+D +R L   S+ 
Sbjct: 517 LTKRELATFDGKDPTKPILLAAKGVIYDVTRGRDFYGAGASYNAFAGKDCSRALGKVSLD 576

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
           A E    ++ D  + E +++  W
Sbjct: 577 A-ENLSANVRDFAASERDTLNGW 598


>UniRef50_A2CES0 Cluster: Novel protein; n=4; Clupeocephala|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 267

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/83 (32%), Positives = 47/83 (56%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  +L  Y+G +    + +A+ G +FDV +G + YGPGG Y  F G+DA+R   T   T
Sbjct: 54  LTKEQLSLYNGGKNSKGLYLAILGQVFDVEKGRKHYGPGGGYHFFTGKDASRAFITGDFT 113

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
                 +D+SD +  ++ ++ +W
Sbjct: 114 EAGLS-NDVSDFSESQIVALYDW 135


>UniRef50_Q59VV5 Cluster: Potential sterol binding protein; n=6;
           Saccharomycetales|Rep: Potential sterol binding protein
           - Candida albicans (Yeast)
          Length = 225

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL  Y+GT +   + +A++G +FDV+   + YGPGGPY    G+DA R   T    
Sbjct: 104 LTISELSLYNGTDKHLPIYLAIDGIVFDVSSSPKVYGPGGPYHELTGKDAARVYVTGCFN 163

Query: 435 APEKDYDDLSDLNSMEMES-VREWE 506
             ++   DL  L+  E E+ ++ W+
Sbjct: 164 KKDEYTYDLRGLDETEAENDIQSWQ 188


>UniRef50_A6RNV0 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 312

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/66 (45%), Positives = 40/66 (60%)
 Frame = +3

Query: 225 LEKTT*IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDA 404
           LE+T+ I +R +     +YDGT     + +A+NG I+DV+ G R YGPGG Y  F G DA
Sbjct: 140 LERTSSINRRGS---FPRYDGTNPDLPIYLALNGTIYDVSTGRRHYGPGGSYHFFAGVDA 196

Query: 405 TRGLAT 422
           TR   T
Sbjct: 197 TRAFVT 202


>UniRef50_UPI00015549AD Cluster: PREDICTED: similar to putative
           progesterone binding protein; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to putative
           progesterone binding protein - Ornithorhynchus anatinus
          Length = 222

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +3

Query: 372 GPYAVFGGRDATRGLATFSV--TAPEKDYDDLSDLNSMEMESVREWE 506
           GPY VF GRDA+RGLATF +   A + +YDDLSDL   + E++++WE
Sbjct: 138 GPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTYTQQETLKDWE 184



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 1/32 (3%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE-PEEAD 601
           QF   Y  VGRLL+ GEEP  YSD+E P++A+
Sbjct: 186 QFTFKYHHVGRLLKEGEEPTVYSDDEGPKDAN 217


>UniRef50_Q4WRF3 Cluster: Heme/steroid binding domain protein,
           putative; n=3; Eurotiomycetidae|Rep: Heme/steroid
           binding domain protein, putative - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 243

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/56 (48%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  +L  Y+GT     + +AVNG IFDV+     YGPGG Y  F GRDATR   T
Sbjct: 86  LTPDQLALYNGTDPSLPIYVAVNGTIFDVSANRLVYGPGGSYNFFAGRDATRAFVT 141


>UniRef50_Q6C724 Cluster: Similar to DEHA0D10263g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0D10263g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 227

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/56 (44%), Positives = 34/56 (60%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  +L  YDGT+ G  + + V G ++DV+     YGPGGPY  F GRDA R  +T
Sbjct: 107 LTDDQLSVYDGTRAGEPIYVGVGGKVYDVSANPLTYGPGGPYHFFAGRDAARAFST 162


>UniRef50_Q2UG60 Cluster: Predicted protein; n=3; Ascomycota|Rep:
           Predicted protein - Aspergillus oryzae
          Length = 121

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/83 (38%), Positives = 44/83 (53%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           +T  EL + DGT       +A+ G +FDV++ N  YGP G Y VF G+D++R LA  S+ 
Sbjct: 21  ITVEELSKCDGTDPNRPTWVAIKGIVFDVSK-NPAYGPNGSYRVFAGKDSSRALACSSL- 78

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
            PE       DL   E   + EW
Sbjct: 79  KPEDCRPKWDDLEDKEKTVLDEW 101


>UniRef50_Q0V1T5 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 628

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/57 (43%), Positives = 35/57 (61%)
 Frame = +3

Query: 252 RMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           R+T  +L  YDG+     + +A+NG I+DV+   + YGPGG Y VF G+DA R   T
Sbjct: 454 RLTDAQLAAYDGSDPSKPIYIALNGTIYDVSISPQTYGPGGSYHVFAGKDAARAFIT 510


>UniRef50_UPI00015B5147 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 234

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/82 (35%), Positives = 46/82 (56%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           TA  L++Y+   +G  + +A+ G +FDVT G++ YGPG  Y  F GRD +    T   T 
Sbjct: 12  TASALKKYNNLNDG--LYLAILGQVFDVTSGSKHYGPGETYHAFTGRDGSAAFITGDFTE 69

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
                DD+S L + +++S+  W
Sbjct: 70  SGL-IDDVSSLTNKQIQSLLTW 90


>UniRef50_UPI000058795F Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 281

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 27/85 (31%), Positives = 46/85 (54%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K  T   L+ YDG++    + +A+ G +FDV++G + YGPGG Y+ F GRD ++   +  
Sbjct: 70  KLFTVDSLKAYDGSRNSLGLHIAIMGKVFDVSKGTKHYGPGGGYSFFSGRDGSKAYISGD 129

Query: 429 VTAPEKDYDDLSDLNSMEMESVREW 503
             + E    D+  L   +M  + +W
Sbjct: 130 F-SEEGLTPDVEGLTPQDMIGLEDW 153


>UniRef50_A2Z940 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 167

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 35/50 (70%)
 Frame = +3

Query: 357 FYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDDLSDLNSMEMESVREWE 506
           FYGPGGPYA+F G+DA+R LA  S   P+    D+S L   E++++++WE
Sbjct: 43  FYGPGGPYALFAGKDASRALAKMSF-EPQDLTGDISGLGPFELDALQDWE 91


>UniRef50_Q581R4 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 153

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 29/92 (31%), Positives = 50/92 (54%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + +  TA EL++YDG ++   V ++V G +++V    +FYGPG PY ++ GR+ +R LA 
Sbjct: 53  VQRSFTADELQEYDGVRKSD-VYVSVKGVVYEVAP--QFYGPGQPYHIYAGREISRCLAK 109

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
             +T  E + D        E++ +  W    E
Sbjct: 110 SDLTGDEINKDWRPGSTEEELQQLEGWVKKFE 141


>UniRef50_Q8WUJ1 Cluster: Cytochrome b5 domain-containing protein 2;
           n=16; Amniota|Rep: Cytochrome b5 domain-containing
           protein 2 - Homo sapiens (Human)
          Length = 264

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F GRDA+R   T   +    
Sbjct: 42  ELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGL 101

Query: 447 DYDDLSDLNSMEMESVREW 503
             DD+SDL++ EM ++  W
Sbjct: 102 -VDDVSDLSAAEMLTLHNW 119


>UniRef50_A4RIB7 Cluster: Putative uncharacterized protein; n=4;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 122

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/79 (39%), Positives = 43/79 (54%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL +  G + GG+  +A+ G ++DVT GN+ Y PGG Y VF G DA+R L   S T  E 
Sbjct: 26  ELEKATG-ENGGKCYVAIKGLVYDVT-GNKAYQPGGSYHVFAGHDASRALGKTS-TKAEN 82

Query: 447 DYDDLSDLNSMEMESVREW 503
              D   L+  E   + +W
Sbjct: 83  VSPDWKTLDEKEQGVLNDW 101


>UniRef50_Q54S39 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 150

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 4/85 (4%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           E++ + G  E   + +A+ G I+DVT     YGPGG Y +F G DAT  LA  S    + 
Sbjct: 52  EIKDFKGIDETKPIFIAIKGKIYDVTAKKSTYGPGGSYHLFAGNDATVCLAKSSFEESDI 111

Query: 447 DY----DDLSDLNSMEMESVREWED 509
           +       L DL + + +S++ W D
Sbjct: 112 NQPWTNQSLDDLTADQKDSLKNWID 136


>UniRef50_Q756V7 Cluster: AER144Cp; n=1; Eremothecium gossypii|Rep:
           AER144Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 174

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 5/88 (5%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGR-VLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATR--GLATFS 428
           TA EL QY     G R VL+AV G +++VTR  R YG  GPY  F GRD +   G A + 
Sbjct: 73  TATELSQYSAGTGGTRPVLLAVLGHVYEVTRAPRLYGTKGPYRRFTGRDCSNLFGYAMWE 132

Query: 429 VTAPEKD--YDDLSDLNSMEMESVREWE 506
           + A        ++S+   ++++ +R W+
Sbjct: 133 LGAMRAAACSSNVSNTTEVQLQRIRGWQ 160


>UniRef50_Q0DU60 Cluster: Os03g0205500 protein; n=5;
           Magnoliophyta|Rep: Os03g0205500 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 318

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 12/94 (12%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRG-------- 413
           T  EL  Y+GT E   +L+ + G +FDVT+G   YGPGG Y  F G              
Sbjct: 34  TKEELAVYNGTDESLPILLGILGSVFDVTKGKSNYGPGGGYHHFAGSSWKLAKFQFLPEI 93

Query: 414 --LATFSVTAPEKD--YDDLSDLNSMEMESVREW 503
             + + S + P  D   D L  L+SME+ S+ +W
Sbjct: 94  DVIGSASTSFPSSDGLTDSLQGLSSMEVNSIVDW 127


>UniRef50_Q9W376 Cluster: CG12056-PA; n=2; Sophophora|Rep:
           CG12056-PA - Drosophila melanogaster (Fruit fly)
          Length = 287

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I    T  EL +++G +EG  + +A+ G +FDV+RG + YG G  Y  F GRDA+    +
Sbjct: 60  IGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFIS 119

Query: 423 --FSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIW 533
             F    PE   DD+  L   ++  +  W D  ++  ++
Sbjct: 120 GDFETYDPE-TADDVLTLKPDDLIGLAGWRDFYQKDYVY 157


>UniRef50_Q5KP22 Cluster: Sterol metabolism-related protein,
           putative; n=2; Filobasidiella neoformans|Rep: Sterol
           metabolism-related protein, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 211

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K  T ++L  +DG+ +   V +A++G ++DV+   R YG GG Y +  GRDA+R   T  
Sbjct: 67  KEFTPLQLAMFDGSPDRP-VYLAIDGIVYDVSANRRIYGKGGSYNMMAGRDASRAFITGC 125

Query: 429 VTAPEKDYDDLSDLNSMEMESVREWE 506
                    D+  L+  E+ S+  W+
Sbjct: 126 FETHLT--HDIRGLSKEELASLEHWK 149


>UniRef50_Q2UQX7 Cluster: Predicted protein; n=3;
           Eurotiomycetidae|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 250

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  +L  Y+G+     + +A+NG +FDV+     YGPGG Y  F G+DATR   T
Sbjct: 92  LTPSQLALYNGSDSTLPIYLAINGSVFDVSANPLVYGPGGHYNFFTGKDATRAFVT 147


>UniRef50_A7TMB2 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 218

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDAT 407
           +L+ Y G+ E  R+L+++ G +FDVT+G+ FYG  G Y  F G D T
Sbjct: 107 DLKAYRGSTEPERILLSIKGHVFDVTKGSSFYGKWGAYQRFTGTDCT 153


>UniRef50_Q4QFG4 Cluster: Putative uncharacterized protein; n=5;
           Trypanosomatidae|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 163

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 29/89 (32%), Positives = 50/89 (56%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + +  T  EL Q+DG ++  +V + V G I++V+    +YGP GPY+ F G D++R L  
Sbjct: 51  VPRAYTVEELAQFDGKKKP-QVFVGVKGIIYNVSL--EWYGPEGPYSAFAGCDSSRQLGK 107

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWED 509
             V   E +  D + L    ++++ EWE+
Sbjct: 108 VIVGRDEIN-ADWTTLAPEHLKTLHEWEE 135


>UniRef50_Q9XXA7 Cluster: Putative uncharacterized protein tag-131;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein tag-131 - Caenorhabditis elegans
          Length = 326

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  +L  +DGT++   + +A+ G +++V     +YGPG  Y  F GRDATR   T     
Sbjct: 102 TPEQLHFFDGTRDSKPIYLAILGRVYNVDGKKEYYGPGKSYHHFAGRDATRAFTTGDFQE 161

Query: 438 PEKDYDDLSDLNSMEMESVREW 503
                     L+  E+ S+R+W
Sbjct: 162 SGL-IATTHGLSHDELLSIRDW 182


>UniRef50_Q57VA0 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 159

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/88 (31%), Positives = 43/88 (48%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I +  T  EL +YDG +      + V G +++      FYG   PY  F GRD++R  A 
Sbjct: 49  IPRGYTVEELSEYDGVKSP-LAFVGVRGIVYN--GATSFYGNNAPYNAFAGRDSSRHFAK 105

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWE 506
             V   E +  D + L+   M+++ EWE
Sbjct: 106 MDVGRQEANM-DWTTLSPSHMKTLIEWE 132


>UniRef50_A3LW42 Cluster: Predicted protein; n=5;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 154

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLA 419
           T  +L +Y+GT +   + +A+ G+I+DV+  ++ YGPG  Y    G+D TR LA
Sbjct: 34  TRSQLAEYNGTDKP-EIYVAIRGYIYDVSNNSKSYGPGKSYHKLVGKDVTRLLA 86


>UniRef50_Q0MYV5 Cluster: Putative cytochrome b5 domain-containing
           protein-like protein; n=1; Emiliania huxleyi|Rep:
           Putative cytochrome b5 domain-containing protein-like
           protein - Emiliania huxleyi
          Length = 254

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 4/92 (4%)
 Frame = +3

Query: 255 MTAVELRQYDGTQ--EGGR--VLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           +T  EL ++DG    +G    + ++V G ++DV+ G  FYGPG  Y    G+DATR   T
Sbjct: 122 LTRDELAEFDGRPLPDGSPSPLYLSVLGRVYDVSSGGAFYGPGKSYHKLVGKDATRAFCT 181

Query: 423 FSVTAPEKDYDDLSDLNSMEMESVREWEDNLE 518
               AP       + L+  +    + W +  E
Sbjct: 182 -GCLAPSCLISSTAHLSETQRREAQRWVELYE 212


>UniRef50_Q4Q2N9 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 178

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/64 (39%), Positives = 36/64 (56%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + K  T  +L QYDG +   R+ M+V   +++V     FYGPG  Y VF G +A+R LA 
Sbjct: 71  VKKGYTREQLSQYDGVKNE-RIFMSVKMKVYEVAP--HFYGPGQHYHVFAGTEASRALAK 127

Query: 423 FSVT 434
             +T
Sbjct: 128 ADLT 131


>UniRef50_Q22S10 Cluster: Cytochrome b5-like Heme/Steroid binding
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Cytochrome b5-like Heme/Steroid binding
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 151

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           MT  EL ++DG Q   +V +A  G +FDV+    + G GG Y+ F G+D +  LA  S  
Sbjct: 50  MTLNELSKFDGKQNK-KVYLACKGLVFDVSDSEFYVGEGG-YSAFAGKDCSVNLARMSFE 107

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
             + +     +L   E + + +W
Sbjct: 108 VNDYNKYGQVELTLSERDVLDQW 130


>UniRef50_A7SHQ1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 98

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K  T  EL  ++G      + +AV G +FDV+     YG G  Y    G++ +R +A +S
Sbjct: 1   KLFTKDELATFNGRNSNSPIYVAVKGVVFDVSTSKDLYGYGESYNSMAGKECSRAIAKWS 60

Query: 429 VTAPEKDYDDLSDLNSMEMESVRE 500
           + A E    +L  L   E++ + +
Sbjct: 61  LAA-ENMNGNLDGLTKDELQRLEK 83


>UniRef50_Q00ZN7 Cluster: Putative steroid membrane receptor
           Hpr6.6/25-Dx; n=1; Ostreococcus tauri|Rep: Putative
           steroid membrane receptor Hpr6.6/25-Dx - Ostreococcus
           tauri
          Length = 244

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAV-FGGRDATRGLATFSVTAPEKDYDDLSDLNSM 479
           R+ ++V G  FDV+ G  +Y   G YA  F GRDATR   T    +     +D+  +   
Sbjct: 46  RIWLSVLGEAFDVSAGRTYYAGDGAYATCFAGRDATRAFGTGDF-SESGCVEDVRGMTLG 104

Query: 480 EMESVREWED 509
           E+   R W D
Sbjct: 105 ELAGARHWRD 114


>UniRef50_A0CJD6 Cluster: Chromosome undetermined scaffold_2, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_2,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 155

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 25/85 (29%), Positives = 41/85 (48%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K MT  +++  +G   G RV +A+  ++FDVT  +  Y P GPY VF G D +  L   +
Sbjct: 53  KVMTLKDVQHNNGLC-GKRVFVAIKNFVFDVTNSDA-YKPDGPYGVFAGHDISISLGKMN 110

Query: 429 VTAPEKDYDDLSDLNSMEMESVREW 503
           ++    D          E+ ++  W
Sbjct: 111 ISEEFLDMYGTVTQPEDEIANMNSW 135


>UniRef50_Q6CWE2 Cluster: Similar to ca|CA1625|IPF6156 Candida
           albicans; n=1; Kluyveromyces lactis|Rep: Similar to
           ca|CA1625|IPF6156 Candida albicans - Kluyveromyces
           lactis (Yeast) (Candida sphaerica)
          Length = 194

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 6/93 (6%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGR---VLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRG 413
           I    T  EL ++ G         +L+A+N  +FDV+   RFYG  G Y  F G D +  
Sbjct: 76  IPYNFTLQELSRFSGDNSKSNDQPILLAINRTVFDVSSSPRFYGAWGAYKKFTGTDCSNN 135

Query: 414 --LATFSVTAPEKD-YDDLSDLNSMEMESVREW 503
                F   A     + D+S  +  +M  + EW
Sbjct: 136 FQFGIFDYHAYSTPCHWDVSGFDESQMAKLAEW 168


>UniRef50_Q6NMU0 Cluster: AT07779p; n=2; Drosophila
           melanogaster|Rep: AT07779p - Drosophila melanogaster
           (Fruit fly)
          Length = 221

 Score = 39.5 bits (88), Expect = 0.074
 Identities = 26/89 (29%), Positives = 44/89 (49%)
 Frame = +3

Query: 252 RMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV 431
           +++  +L  +DGT+  GR+L+A+ G I+DV+     +G  G  +   GRD T  L +   
Sbjct: 58  KLSLDQLLGFDGTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFTNYLKS--- 114

Query: 432 TAPEKDYDDLSDLNSMEMESVREWEDNLE 518
                    + D ++ E+  V  WE  LE
Sbjct: 115 ---------IMDTHNSEINYVDRWESILE 134


>UniRef50_Q9VQ46 Cluster: CG15623-PA; n=2; Drosophila
           melanogaster|Rep: CG15623-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 201

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGL 416
           +T  EL  +DG+     +  A+NG I+D++ G   +   GPY++  G +A + L
Sbjct: 86  LTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL 139


>UniRef50_Q29LP2 Cluster: GA20245-PA; n=1; Drosophila
           pseudoobscura|Rep: GA20245-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 156

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 16/51 (31%), Positives = 32/51 (62%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDAT 407
           +T  +L +++ T +G R L+A+   ++DV+  +  +GP G YA + G++ T
Sbjct: 67  LTKKQLEEFNCTNKGRRYLVALRDVVYDVSNVSDDFGPKGSYAKWSGQELT 117


>UniRef50_Q4D362 Cluster: Putative uncharacterized protein; n=2;
            Trypanosoma cruzi|Rep: Putative uncharacterized protein -
            Trypanosoma cruzi
          Length = 1445

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 17/59 (28%), Positives = 33/59 (55%)
 Frame = +3

Query: 414  LATFSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPGTTRTKNP 590
            ++ F++ +P+  +D LS    +++E  R  ED+ E ++ W ++F  L   P +   KNP
Sbjct: 881  ISVFALPSPDDIFDMLSSRFGVKVEQHRTLEDSYEAMLQWVMEFFSLWFTPASRAEKNP 939


>UniRef50_UPI0000E24C07 Cluster: PREDICTED: similar to Cytochrome b5
           domain containing 2; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to Cytochrome b5 domain containing 2
           - Pan troglodytes
          Length = 99

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGG 395
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F G
Sbjct: 42  ELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAG 84


>UniRef50_Q8BHV3 Cluster: Adult retina cDNA, RIKEN full-length
           enriched library, clone:A930024F09 product:similar to
           HYPOTHETICAL 28.7 kDa PROTEIN; n=1; Mus musculus|Rep:
           Adult retina cDNA, RIKEN full-length enriched library,
           clone:A930024F09 product:similar to HYPOTHETICAL 28.7
           kDa PROTEIN - Mus musculus (Mouse)
          Length = 137

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGG 395
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F G
Sbjct: 42  ELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAG 84


>UniRef50_A4RFR1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 100

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFY 362
           + +  T   L  Y+G Q+G  V +AV G +FDVT G  FY
Sbjct: 61  VFRTFTPPTLIHYNG-QDGKPVYLAVRGRVFDVTAGRNFY 99


>UniRef50_Q9SUK6 Cluster: Glycoprotein homolog; n=5;
           Brassicaceae|Rep: Glycoprotein homolog - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 473

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -1

Query: 418 ASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCRSST 263
           + PL+ +L P +++  P   N  P + S  HP       PP  +P++  SS+
Sbjct: 249 SQPLIKNLTPPSSFSSPRKSNPIPNLASEFHPSPPPPPPPPPPLPAFYNSSS 300


>UniRef50_Q6LF57 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium falciparum 3D7|Rep: Putative uncharacterized
            protein - Plasmodium falciparum (isolate 3D7)
          Length = 2461

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 13/39 (33%), Positives = 22/39 (56%)
 Frame = -3

Query: 671  KATVILQ*KFQFGFLCRRWAERTCLLLRVLRPSSSWVLH 555
            K  +IL  K  + F+C +W E  CLLL + +  +  +L+
Sbjct: 1694 KTLLILLFKISYVFICLKWKEAFCLLLNIFKNENDEILY 1732


>UniRef50_Q6PGW0 Cluster: Transcription elongation regulator 1;
           n=10; Euteleostomi|Rep: Transcription elongation
           regulator 1 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1000

 Score = 32.7 bits (71), Expect = 8.5
 Identities = 15/56 (26%), Positives = 26/56 (46%)
 Frame = -1

Query: 439 GAVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCR 272
           G    +++       PP  A     P  R PL++S + P+T + + PP+  P + R
Sbjct: 11  GLAANSMSQQAALRFPPAVAPPAAPPARRQPLLSSPVPPYTLMRSPPPAARPPFTR 66


>UniRef50_Q0TXS1 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1137

 Score = 32.7 bits (71), Expect = 8.5
 Identities = 28/74 (37%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = -1

Query: 421  VASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYC-RSSTAVILFA 245
            V S L   L    A  PPG     P+  S   P   + T PPS VPS C R+STA+ + +
Sbjct: 989  VRSALAQELTASIAELPPGRMPSPPITRSVAQPL--LPTPPPSVVPSICDRNSTAMSMPS 1046

Query: 244  I--*VVFSREQPLN 209
            I       R +PLN
Sbjct: 1047 IDEYPAHHRPEPLN 1060


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 693,469,134
Number of Sequences: 1657284
Number of extensions: 14269710
Number of successful extensions: 43984
Number of sequences better than 10.0: 85
Number of HSP's better than 10.0 without gapping: 41363
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43860
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52892566912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -