SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115; Bilateria|...   150   3e-35
UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:...   148   1e-34
UniRef50_UPI0000E4A877 Cluster: PREDICTED: similar to beta-tubul...   141   2e-32
UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-P...   140   2e-32
UniRef50_Q8J1D5 Cluster: Beta-tubulin; n=5; Pezizomycotina|Rep: ...   124   3e-27
UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, b...   120   3e-26
UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep: Beta-...   113   5e-24
UniRef50_A2FXL6 Cluster: Tubulin beta chain, putative; n=1; Tric...   103   3e-21
UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain cont...   100   7e-20
UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome sh...    92   1e-17
UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970; Eukaryot...    89   1e-16
UniRef50_Q3HRW7 Cluster: Alpha-tubulin-like protein; n=3; Eukary...    88   2e-16
UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Re...    88   2e-16
UniRef50_A4HVG1 Cluster: Alpha tubulin; n=2; Leishmania|Rep: Alp...    88   2e-16
UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n...    87   3e-16
UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493; Eukaryota...    86   9e-16
UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1...    84   3e-15
UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin, a...    84   4e-15
UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN fu...    81   2e-14
UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1; ...    80   6e-14
UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=...    77   3e-13
UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa...    72   2e-11
UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep: Alph...    71   3e-11
UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta tub...    70   6e-11
UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa...    67   3e-10
UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces c...    67   3e-10
UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome sh...    66   6e-10
UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular ...    66   6e-10
UniRef50_Q402S5 Cluster: Beta-tubulin; n=6; Trichocomaceae|Rep: ...    66   8e-10
UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia ryukyuensis...    66   1e-09
UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin al...    65   1e-09
UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba his...    63   7e-09
UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8; Prosthecobact...    60   4e-08
UniRef50_P34475 Cluster: Tubulin gamma chain; n=2; Caenorhabditi...    60   4e-08
UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase doma...    58   2e-07
UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1; Monocercomo...    58   2e-07
UniRef50_P78672 Cluster: Beta-tubulin; n=3; Hypocreales|Rep: Bet...    58   3e-07
UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;...    57   5e-07
UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps ...    56   6e-07
UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozo...    55   2e-06
UniRef50_UPI00005A4366 Cluster: PREDICTED: similar to tubulin, a...    54   3e-06
UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium ...    54   3e-06
UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain cont...    53   6e-06
UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain cont...    53   8e-06
UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia...    52   1e-05
UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium...    52   1e-05
UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain cont...    52   1e-05
UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5; Eukaryota...    52   1e-05
UniRef50_UPI0000F1FF49 Cluster: PREDICTED: hypothetical protein;...    52   1e-05
UniRef50_Q4S982 Cluster: Chromosome 3 SCAF14700, whole genome sh...    52   1e-05
UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genom...    52   1e-05
UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to epsilon-tu...    52   2e-05
UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain cont...    50   5e-05
UniRef50_A2FJ63 Cluster: Putative uncharacterized protein; n=1; ...    50   7e-05
UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7; Prosthecobac...    49   1e-04
UniRef50_Q9XFV1 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain cont...    49   1e-04
UniRef50_O22416 Cluster: Tubulin Uni3; n=1; Chlamydomonas reinha...    48   2e-04
UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin), pu...    48   2e-04
UniRef50_A7R175 Cluster: Chromosome undetermined scaffold_340, w...    48   3e-04
UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain cont...    47   4e-04
UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin, e...    47   5e-04
UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium ...    46   0.001
UniRef50_O93807 Cluster: Tubulin gamma chain; n=8; Saccharomycet...    46   0.001
UniRef50_UPI00003977B9 Cluster: hypothetical protein Haso0200227...    45   0.002
UniRef50_Q9SEA4 Cluster: Tubulin gamma chain, nucleomorph; n=1; ...    45   0.002
UniRef50_Q862L2 Cluster: Similar to alpha-tubulin isoform 1; n=1...    45   0.002
UniRef50_Q4CWT7 Cluster: Delta tubulin, putative; n=4; Trypanoso...    45   0.002
UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    44   0.004
UniRef50_A0BQ86 Cluster: Chromosome undetermined scaffold_120, w...    44   0.004
UniRef50_UPI0000E1EF15 Cluster: PREDICTED: similar to alpha-2-tu...    44   0.005
UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lambl...    44   0.005
UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6; Trypano...    44   0.005
UniRef50_A4H729 Cluster: Alpha tubulin; n=5; Trypanosomatidae|Re...    43   0.008
UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    43   0.008
UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, wh...    43   0.008
UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n...    42   0.011
UniRef50_UPI0000E7FE1E Cluster: PREDICTED: hypothetical protein;...    42   0.014
UniRef50_Q8I2I0 Cluster: Delta tubulin, putative; n=1; Plasmodiu...    42   0.019
UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|R...    42   0.019
UniRef50_P53378 Cluster: Tubulin gamma chain; n=5; Saccharomycet...    41   0.025
UniRef50_A0JJL8 Cluster: Beta-tubulin; n=13; Sordariomycetes|Rep...    41   0.033
UniRef50_UPI0000EB04B1 Cluster: UPI0000EB04B1 related cluster; n...    40   0.058
UniRef50_Q8T887 Cluster: Delta-tubulin; n=1; Ciona intestinalis|...    40   0.076
UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus lineol...    40   0.076
UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30; Eukaryota|...    39   0.10 
UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:...    38   0.18 
UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n...    38   0.23 
UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome sh...    38   0.23 
UniRef50_Q6AU00 Cluster: Alpha tubulin; n=1; Oryza sativa (japon...    38   0.23 
UniRef50_Q9UJT1 Cluster: Tubulin delta chain; n=35; Euteleostomi...    38   0.23 
UniRef50_Q7R6N2 Cluster: GLP_170_87302_88000; n=1; Giardia lambl...    38   0.31 
UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium...    37   0.41 
UniRef50_A2F2M2 Cluster: Tubulin/FtsZ family, GTPase domain cont...    37   0.41 
UniRef50_A5KEA7 Cluster: Delta tubulin, putative; n=1; Plasmodiu...    37   0.54 
UniRef50_UPI00015B628B Cluster: PREDICTED: hypothetical protein;...    36   0.71 
UniRef50_Q6A208 Cluster: Delta tubulin; n=1; Oikopleura dioica|R...    36   0.71 
UniRef50_Q8J1W3 Cluster: Beta-tubulin; n=1; Colletotrichum sp.|R...    29   0.85 
UniRef50_UPI0000EB22D9 Cluster: Tubulin delta chain (Delta tubul...    36   1.2  
UniRef50_A7ARU2 Cluster: Tubulin, putative; n=1; Babesia bovis|R...    36   1.2  
UniRef50_Q8K5B7 Cluster: Neuron-specific class III beta-tubulin;...    35   1.6  
UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin, d...    35   2.2  
UniRef50_Q4DS09 Cluster: Zeta tubulin, putative; n=4; Trypanosom...    35   2.2  
UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium ...    35   2.2  
UniRef50_Q3SEG6 Cluster: Beta_tubulin,putative; n=1; Paramecium ...    35   2.2  
UniRef50_Q8AVA7 Cluster: Cryptic tubulin; n=3; Tetrapoda|Rep: Cr...    34   2.9  
UniRef50_Q4XML3 Cluster: Delta tubulin, putative; n=5; Plasmodiu...    34   3.8  
UniRef50_Q4QCZ3 Cluster: Zeta tubulin, putative; n=2; Leishmania...    34   3.8  
UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to epsilon-tu...    33   5.0  
UniRef50_Q5VRE3 Cluster: Putative uncharacterized protein OSJNBa...    33   5.0  
UniRef50_Q2A9A4 Cluster: Putative uncharacterized protein; n=2; ...    33   5.0  
UniRef50_Q3SEG5 Cluster: Alpha tubulin,putative; n=1; Paramecium...    33   5.0  
UniRef50_A1CSU2 Cluster: Guanyl-nucleotide exchange factor, puta...    33   5.0  
UniRef50_Q2XVP6 Cluster: Beta 5-tubulin; n=2; Eutheria|Rep: Beta...    33   6.6  
UniRef50_A0BY58 Cluster: Chromosome undetermined scaffold_136, w...    33   6.6  
UniRef50_UPI00006CCC73 Cluster: Tubulin/FtsZ family, GTPase doma...    33   8.8  
UniRef50_A1UNB8 Cluster: Putative uncharacterized protein; n=6; ...    33   8.8  
UniRef50_Q7X8G8 Cluster: OSJNBb0016D16.22 protein; n=4; Oryza sa...    33   8.8  
UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain cont...    33   8.8  
UniRef50_O44453 Cluster: Putative uncharacterized protein; n=2; ...    33   8.8  

>UniRef50_P52275 Cluster: Tubulin beta-2 chain; n=115;
           Bilateria|Rep: Tubulin beta-2 chain - Caenorhabditis
           elegans
          Length = 450

 Score =  150 bits (364), Expect = 3e-35
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG LFRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDVIR+EAEG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMSSFSVVPSPKVSDTVVEPYNATL 187



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 29/42 (69%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGI P G + G++DL
Sbjct: 1   MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDL 42



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +2

Query: 503 GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 126 GCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSD 177


>UniRef50_P04350 Cluster: Tubulin beta-4 chain; n=4602; root|Rep:
           Tubulin beta-4 chain - Homo sapiens (Human)
          Length = 444

 Score =  148 bits (358), Expect = 1e-34
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ G YVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSD 177


>UniRef50_UPI0000E4A877 Cluster: PREDICTED: similar to beta-tubulin,
           partial; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to beta-tubulin, partial -
           Strongylocentrotus purpuratus
          Length = 224

 Score =  141 bits (341), Expect = 2e-32
 Identities = 58/84 (69%), Positives = 74/84 (88%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ G+YVPR VL+DL+P T+D+V SGPFG +FRPDNF++GQ+ A NNWA
Sbjct: 14  QLERINVYYNEAAGGQYVPRAVLLDLEPGTLDSVHSGPFGQIFRPDNFIFGQSGAENNWA 73

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
           KGH+TEG E++ S +DV+R+EAEG
Sbjct: 74  KGHFTEGAELIHSVMDVVRKEAEG 97



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 42/125 (33%), Positives = 61/125 (48%), Gaps = 4/125 (3%)
 Frame = +3

Query: 327 DLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEG 506
           +L  + MD VR    GC    D     Q+ A NNWAKGH+TEG +++ S +D++R+EA+G
Sbjct: 82  ELIHSVMDVVRKEAEGC----DCI---QSGAGNNWAKGHFTEGAKLIHSVMDIVRKEAKG 134

Query: 507 WIACKFSDVTLARWRYRFRIRYATS*TGYAKSI----PTELY*PFQSFQVPECRICVVEP 674
              C      +  ++    +   T  +G A  I    P  +   F     P+    VVEP
Sbjct: 135 ---CD----CIQGFQLTHSLGGGTG-SGVATKIREEYPDRIMTSFSVVPSPKASDDVVEP 186

Query: 675 YNTTL 689
           YN TL
Sbjct: 187 YNATL 191



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 17/24 (70%), Positives = 21/24 (87%)
 Frame = +2

Query: 587 RIREEYPDRIILTFSVFPSPRVSD 658
           +IREEYPDRI+ +FSV PSP+ SD
Sbjct: 158 KIREEYPDRIMTSFSVVPSPKASD 181


>UniRef50_Q9VAX7 Cluster: CG4869-PA; n=8; Eukaryota|Rep: CG4869-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 522

 Score =  140 bits (340), Expect = 2e-32
 Identities = 72/145 (49%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q ERI+VYYNEAS+GKYVPR VLIDL+P TMD+VR  P G LFRPDNFVYGQ+ A NNWA
Sbjct: 43  QHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S L+V+R+E+EG    +   +  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNSFSVVPSPKVSDTVVEPYNATL 187



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWE+ISDEHGIDP+G YHG+S L
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESAL 42



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSD 177


>UniRef50_Q8J1D5 Cluster: Beta-tubulin; n=5; Pezizomycotina|Rep:
           Beta-tubulin - Nephromopsis leucostigma
          Length = 239

 Score =  124 bits (298), Expect = 3e-27
 Identities = 63/132 (47%), Positives = 80/132 (60%)
 Frame = +3

Query: 285 EASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEI 464
           +AS  KYVPR VL+DL+P TMDAVR+GPF  LFRPDNFV+GQ+ A NNWAKGHYTEG E+
Sbjct: 4   QASNNKYVPRAVLVDLEPGTMDAVRAGPFXQLFRPDNFVFGQSGAGNNWAKGHYTEGAEL 63

Query: 465 LESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQV 644
           ++  LDV+RREAEG    +   +T +              +   +  P  +   F     
Sbjct: 64  VDQVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRMMATFSVVPS 123

Query: 645 PECRICVVEPYN 680
           P+    VVEPYN
Sbjct: 124 PKVSDTVVEPYN 135


>UniRef50_UPI00005A581E Cluster: PREDICTED: similar to tubulin, beta
           3; n=2; Canis lupus familiaris|Rep: PREDICTED: similar
           to tubulin, beta 3 - Canis familiaris
          Length = 363

 Score =  120 bits (289), Expect = 3e-26
 Identities = 50/84 (59%), Positives = 66/84 (78%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYY EAS+ KY+PR + +DL+P T+D+VRSG FG LFRPDNF++GQ+   NNW 
Sbjct: 43  QLERISVYYKEASSHKYMPRAIRVDLEPGTLDSVRSGAFGHLFRPDNFIFGQSGDGNNWG 102

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
           KGHYTEG E+++S LD++     G
Sbjct: 103 KGHYTEGAELVDSVLDMLTHSLGG 126



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 30/42 (71%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q   CGNQI  KFWEVISD+H IDPSG Y GDSDL
Sbjct: 1   MREIVHIQASQCGNQIRAKFWEVISDKHSIDPSGNYVGDSDL 42



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           +N++ EEYPDRI+ TFSV P P+VSD
Sbjct: 137 INKVPEEYPDRIMNTFSVMPLPKVSD 162


>UniRef50_Q26236 Cluster: Beta-tubulin; n=5; Eukaryota|Rep:
           Beta-tubulin - Reticulomyxa filosa
          Length = 473

 Score =  113 bits (271), Expect = 5e-24
 Identities = 52/145 (35%), Positives = 83/145 (57%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           +L++I VY+ EA   +YVPR +L+DL+P  ++ +++ P G +F+PDNF++G + A NNW 
Sbjct: 49  RLDKIGVYFREAGEKRYVPRAILVDLEPGILEVIKAAPTGKMFKPDNFIFGASGAGNNWG 108

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG +++E  ++V+RREAE   A +   +T +                     P  
Sbjct: 109 KGHYTEGAQLIEECVEVVRREAESCDAPQGFQITQSLGGGTGSGLGTLLLNRIRDGFPDR 168

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   +  +  P+    VVEPYN TL
Sbjct: 169 ITATYSVYPSPKVSDVVVEPYNATL 193



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           +REI+++QVG CGNQIG  FWE +  EH +   G
Sbjct: 2   VREIVHVQVGQCGNQIGNVFWETMCKEHHLAEDG 35


>UniRef50_A2FXL6 Cluster: Tubulin beta chain, putative; n=1;
           Trichomonas vaginalis G3|Rep: Tubulin beta chain,
           putative - Trichomonas vaginalis G3
          Length = 168

 Score =  103 bits (248), Expect = 3e-21
 Identities = 43/65 (66%), Positives = 55/65 (84%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLE INVY+NEA   +YVPR VL+D++P TMD+VR+G +G LFRPDNF++GQ+ A NNWA
Sbjct: 44  QLENINVYFNEAINTRYVPRAVLVDMEPGTMDSVRAGQYGQLFRPDNFIFGQSGAGNNWA 103

Query: 435 KGHYT 449
           KG+YT
Sbjct: 104 KGYYT 108



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 30/42 (71%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           +REI+++Q G CGNQIG KFWEV+SDEHG+DP+G Y+GDSDL
Sbjct: 2   VREIVHIQAGQCGNQIGTKFWEVVSDEHGVDPTGKYYGDSDL 43


>UniRef50_Q227Z6 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 436

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 40/83 (48%), Positives = 60/83 (72%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLE+I+VYYN+  A KYVPR +LIDL PA ++++ +   G LF+P+N + GQ+ A NNWA
Sbjct: 43  QLEKIDVYYNQTKADKYVPRAILIDLDPALLNSINTSQIGQLFKPENLIIGQDPAENNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            GHY  G + ++  ++ +R+EAE
Sbjct: 103 IGHYILGPQYIDQVMETVRKEAE 125



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 27/42 (64%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+N+Q+G  GNQIG  +WE IS EHGI P+G + GDSDL
Sbjct: 1   MREILNIQIGQAGNQIGTAYWEEISKEHGIQPTGVHKGDSDL 42



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 + +++EEYPDRI  TFS+FPS ++SD
Sbjct: 128 DCLQGFQMIHSIGGGTGSGMGTLLLQKLKEEYPDRITETFSIFPSTKISD 177


>UniRef50_Q4SEQ2 Cluster: Chromosome 3 SCAF14614, whole genome
           shotgun sequence; n=2; Euteleostomi|Rep: Chromosome 3
           SCAF14614, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 407

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 41/98 (41%), Positives = 62/98 (63%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 52  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 111

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRY 554
           HYT G EI++  LD IR+    +  C    VT+ + RY
Sbjct: 112 HYTIGKEIIDLVLDRIRKLVRFYCVCGRFLVTIGQLRY 149



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/56 (35%), Positives = 27/56 (48%)
 Frame = +1

Query: 115 R*INKMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           R ++  RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   RRLSTQRECISIHVGQAGAQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 56


>UniRef50_P68363 Cluster: Tubulin alpha-1B chain; n=970;
           Eukaryota|Rep: Tubulin alpha-1B chain - Homo sapiens
           (Human)
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>UniRef50_Q3HRW7 Cluster: Alpha-tubulin-like protein; n=3;
           Eukaryota|Rep: Alpha-tubulin-like protein - Solanum
           tuberosum (Potato)
          Length = 237

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 60/89 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG 106

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFS 527
           HYT G EI++  LD IR+ ++  +A K S
Sbjct: 107 HYTIGKEIVDLCLDRIRKLSDTVLAFKVS 135



 Score = 40.7 bits (91), Expect = 0.033
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE I++ +G  G Q+G   WE+   EHGI P G
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG 34


>UniRef50_Q86ZZ0 Cluster: Alpha-tubulin; n=2; Pansporablastina|Rep:
           Alpha-tubulin - Trachipleistophora hominis
          Length = 386

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 37/76 (48%), Positives = 56/76 (73%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           +++E+    YVPRTV+IDL+P  +++V+ GPF  LF P+  ++G+  AANN+A+GHYT G
Sbjct: 27  FFSESCENTYVPRTVMIDLEPGVIESVQKGPFKKLFHPEQLIHGKEDAANNYARGHYTVG 86

Query: 456 VEILESALDVIRREAE 503
            EIL+ +LD IR+  E
Sbjct: 87  KEILDESLDRIRKLTE 102


>UniRef50_A4HVG1 Cluster: Alpha tubulin; n=2; Leishmania|Rep: Alpha
           tubulin - Leishmania infantum
          Length = 327

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 57/81 (70%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR + +DL+P  +D VR+G +  LF P+  V G+  AANN+A+G
Sbjct: 139 DAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANNYARG 198

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++ ALD IR+ A+
Sbjct: 199 HYTIGKEIVDLALDRIRKLAD 219



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD 246
           MRE I + +G  G Q+G   WE+   EHGI P G    D
Sbjct: 93  MREAICIHIGQAGCQVGNTCWELFCLEHGIQPDGSMPSD 131


>UniRef50_UPI00005639CD Cluster: UPI00005639CD related cluster; n=1;
           Mus musculus|Rep: UPI00005639CD UniRef100 entry - Mus
           musculus
          Length = 377

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 44/85 (51%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA+ G YV R  L+DL+P+T+D+V SGPFG        V+GQ+ A NN  
Sbjct: 43  QLERISVYYNEATGGNYVSRAALVDLEPSTVDSVCSGPFG---SSQKTVFGQSGAGNN-P 98

Query: 435 KGHYTEGVEILESALDVIRREAEGW 509
           +   TEG E+++ ALDV+ +EAE +
Sbjct: 99  RVTNTEGAELVDVALDVVHKEAESY 123



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/41 (65%), Positives = 32/41 (78%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           +EI+ L+ G CGNQ+G KFW VISD H I P+G YHGDSDL
Sbjct: 2   QEIMLLEAGQCGNQMGAKFWIVISDGHSIKPTGTYHGDSDL 42


>UniRef50_P09733 Cluster: Tubulin alpha-1 chain; n=493;
           Eukaryota|Rep: Tubulin alpha-1 chain - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 447

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 37/81 (45%), Positives = 55/81 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E  + +++E   GK+VPR + +DL+P  +D VR+GP+  LF P+  + G+  AANN+A+G
Sbjct: 48  EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARG 107

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EIL   LD IR+ A+
Sbjct: 108 HYTVGREILGDVLDRIRKLAD 128



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE+I++ VG  G QIG   WE+ S EHGI P G
Sbjct: 1   MREVISINVGQAGCQIGNACWELYSLEHGIKPDG 34


>UniRef50_Q8N532 Cluster: TUBA1C protein; n=9; Amniota|Rep: TUBA1C
           protein - Homo sapiens (Human)
          Length = 325

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 35/78 (44%), Positives = 53/78 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G EI++  LD I +
Sbjct: 107 HYTIGKEIIDLVLDRIHK 124



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>UniRef50_UPI00005A03AE Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to tubulin, alpha 1 - Canis familiaris
          Length = 300

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 36/81 (44%), Positives = 55/81 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N  ++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 91  DSFNTLFSETGAGKHVPRAVFVDLEPTVIDKVRTGTYRQLFHPEQLITGKEDAANNYAQG 150

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G EI++  LD I++ A+
Sbjct: 151 HYTIGKEIIDLVLDRIQKLAD 171



 Score = 37.9 bits (84), Expect = 0.23
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDP 225
           RE I++ VG  G QIG   WE+   EHGI P
Sbjct: 46  RECISIHVGQAGVQIGNACWELYCREHGIQP 76


>UniRef50_Q3UX10 Cluster: In vitro fertilized eggs cDNA, RIKEN
           full-length enriched library, clone:7420443F16
           product:similar to Alpha tubulin; n=4; Murinae|Rep: In
           vitro fertilized eggs cDNA, RIKEN full-length enriched
           library, clone:7420443F16 product:similar to Alpha
           tubulin - Mus musculus (Mouse)
          Length = 446

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 53/157 (33%), Positives = 82/157 (52%), Gaps = 11/157 (7%)
 Frame = +3

Query: 252 PQLERINV----YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCA 419
           P++E +N     +++E  AGK+VPRT+ +DL+P  +D +R G +  LF P+  V G+  A
Sbjct: 47  PKVEHMNASLDTFFHETRAGKHVPRTLFMDLEPTVIDGIRVGRYHSLFHPEQLVNGKEDA 106

Query: 420 ANNWAKGHYTEGVEILESALDVIRREAE------GWIACK-FSDVTLARWRYRFRIRYAT 578
           AN +A+G Y+ G E++E  L+ IR+ AE      G++  + F   T + +      R + 
Sbjct: 107 ANTYARGRYSVGSEVIELVLERIRKLAEQCSGLQGFLIYRSFGGGTGSGFTSLLMERLSV 166

Query: 579 S*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               Y K I  E    F  +  P     VVEPYN  L
Sbjct: 167 E---YCKKIKLE----FSVYPSPRISTAVVEPYNAIL 196



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE +++ +G  G QIG   WE+   EHGI P G
Sbjct: 1   MRECLSIHIGQAGVQIGDACWELYCLEHGIQPDG 34


>UniRef50_A6RQ51 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 573

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 49/141 (34%), Positives = 68/141 (48%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           ++  + E   GKYVPR++ +DL P+ +D +R+G +  LF P+  + G+  AANN+A+GHY
Sbjct: 55  LDTVFTETGNGKYVPRSIFVDLDPSPIDEIRTGDYRSLFHPELLISGKEDAANNYARGHY 114

Query: 447 TEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*P 626
           T G EIL+  L  I     G     F  + L R             T Y K    E    
Sbjct: 115 TIGKEILDGFL--IFHSFGGGTGSGFGSLLLERLS-----------TDYGKKSKLE---- 157

Query: 627 FQSFQVPECRICVVEPYNTTL 689
           F  +  P     VVEPYN  L
Sbjct: 158 FAVYPAPRVSTAVVEPYNAVL 178


>UniRef50_Q9VRX3 Cluster: Probable tubulin beta chain CG32396; n=1;
           Drosophila melanogaster|Rep: Probable tubulin beta chain
           CG32396 - Drosophila melanogaster (Fruit fly)
          Length = 462

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 35/83 (42%), Positives = 56/83 (67%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINV++N  ++ ++  RT+LID + +T+  + +     L+RP+NFV G   A NN+A
Sbjct: 44  QLERINVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFA 101

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G++T+G  IL+  L+  RRE E
Sbjct: 102 RGYHTDGAAILDQVLENTRREVE 124



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGID-PSGCYHGDSDL 255
           MREI+ LQ+G  GN IG  FW VIS EHG+D  SG + G S L
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPL 43


>UniRef50_A1CPB9 Cluster: Tubulin gamma chain; n=9; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus clavatus
          Length = 488

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 31/84 (36%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ ++   +Y+PR +L+DL+P  + +++SGP+  ++ P+NF  GQ    A NNW 
Sbjct: 60  DRKDVFFYQSDDTRYIPRAILLDLEPRVLHSIQSGPYKNIYNPENFFIGQQGIGAGNNWG 119

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y  G  + E   D+I REA+G
Sbjct: 120 AG-YAAGEVVQEEVFDMIDREADG 142


>UniRef50_Q7Z1L8 Cluster: Alpha-tubulin; n=2; Eukaryota|Rep:
           Alpha-tubulin - Schmidtea polychroa (Freshwater
           planarian flatworm) (Dugesiapolychroa)
          Length = 489

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 28/75 (37%), Positives = 52/75 (69%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           N ++ ++ + +YVPR + IDL+P  +D +R+G +  LF PD+ + G+  AA+N+A+GH+T
Sbjct: 49  NTFFFQSPSDQYVPRVLSIDLEPTVVDEIRTGTYRQLFHPDSLINGEEDAASNFARGHFT 108

Query: 450 EGVEILESALDVIRR 494
            G  I++ A+  +R+
Sbjct: 109 IGKSIIDVAMAQLRK 123



 Score = 35.9 bits (79), Expect = 0.94
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           M+EII + +G  G Q+    WE+   EHGI   G
Sbjct: 1   MKEIICINIGQAGIQMANAIWELFCQEHGITADG 34


>UniRef50_Q2U1M2 Cluster: Beta tubulin; n=649; root|Rep: Beta
           tubulin - Aspergillus oryzae
          Length = 817

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +3

Query: 255 QLERINVYYNEA--SAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANN 428
           Q E+++VY++E       YVPR +L+D K  T D + +GP    F   N ++    A   
Sbjct: 434 QREKLDVYFSEVITEPQNYVPRAILLDSKSDTRDRICTGPLRTFFHRRNLLFKGYGAGQC 493

Query: 429 WAKGHYTEGVEILESALDVIRREAE 503
           WA G++T G E+++ A+D++RREAE
Sbjct: 494 WAVGYHTAGAELIDEAMDMVRREAE 518



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSDL 661
           +CLQ F+                 ++R+R+EYPDR+I TFS+FPS RV D+
Sbjct: 521 ECLQGFQIVHSLGGGTGGGMGSLLISRLRDEYPDRVIATFSIFPS-RVPDV 570



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +1

Query: 166 GNQIGGKFWEVISDEHGIDPSGCYHG 243
           GN IG  FWE I+DEHG+D SG + G
Sbjct: 405 GNNIGSAFWEAITDEHGLDTSGKFTG 430


>UniRef50_Q0D0J3 Cluster: Tubulin gamma chain; n=6; Fungi/Metazoa
           group|Rep: Tubulin gamma chain - Aspergillus terreus
           (strain NIH 2624)
          Length = 450

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 2/71 (2%)
 Frame = +3

Query: 300 KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWAKGHYTEGVEILES 473
           +Y+PR +L+DL+P  +++++SGP+  ++ P+NF  GQ    A NNW  G Y  G  + E 
Sbjct: 54  RYIPRAILLDLEPRVLNSIQSGPYRNIYNPENFFIGQQGIGAGNNWGAG-YAAGEVVQEE 112

Query: 474 ALDVIRREAEG 506
             D+I REA+G
Sbjct: 113 IFDMIDREADG 123


>UniRef50_A6RFR4 Cluster: Tubulin gamma chain; n=1; Ajellomyces
           capsulatus NAm1|Rep: Tubulin gamma chain - Ajellomyces
           capsulatus NAm1
          Length = 655

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 29/84 (34%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ ++   +Y+PR +L+DL+P  ++ +++G +  ++ P+NF  G+    A NNWA
Sbjct: 283 DRKDVFFYQSDDTRYIPRAILLDLEPRVLNTIQTGAYRNIYNPENFFIGRQGIGAGNNWA 342

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y  G  + E   D+I REA+G
Sbjct: 343 AG-YAAGEIVQEEVFDMIDREADG 365



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 100 SVTRNR*INKM-REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           S T +  + KM REII +Q G CGN +G +FW+ +  EHGI+  G
Sbjct: 228 STTASSKVRKMPREIITIQAGQCGNNVGSQFWQQLCLEHGINKDG 272


>UniRef50_Q4S6A2 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=6; Euteleostomi|Rep: Chromosome 9
           SCAF14729, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 416

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +  ++      +   D  + G+  AANN+A+G
Sbjct: 48  DSFNTFFSETGAGKHVPRAVFVDLEPTVIANLKIKNVYVVL--DELITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 106 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 162

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 163 KSKLE----FAIYPAPQVSTAVVEPYNSIL 188



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           +RE I++ VG  G QIG   WE+   EHGI P G    D  L     +  T
Sbjct: 2   LRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNT 52


>UniRef50_P23258 Cluster: Tubulin gamma-1 chain; n=213; cellular
           organisms|Rep: Tubulin gamma-1 chain - Homo sapiens
           (Human)
          Length = 451

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>UniRef50_Q402S5 Cluster: Beta-tubulin; n=6; Trichocomaceae|Rep:
           Beta-tubulin - Thysanophora penicillioides
          Length = 62

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 27/40 (67%), Positives = 34/40 (85%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFG 374
           QLER+NVY+  AS  +YVPR VL+DL+P TMDA+R+GPFG
Sbjct: 22  QLERMNVYFTAASGDRYVPRAVLVDLEPGTMDAIRAGPFG 61


>UniRef50_A7M6D9 Cluster: Alpha-tubulin; n=1; Dugesia
           ryukyuensis|Rep: Alpha-tubulin - Dugesia ryukyuensis
          Length = 534

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/75 (36%), Positives = 47/75 (62%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  +G +VPR + IDL+P  +D +R+  +  L+ PD  +     AANN+A+GH+T
Sbjct: 49  HTFFQEVPSGNFVPRAINIDLEPTVIDEIRTANYRHLWHPDYLINCCEDAANNFARGHFT 108

Query: 450 EGVEILESALDVIRR 494
            G  ++E  LD +R+
Sbjct: 109 VGKNVIERFLDQLRK 123



 Score = 37.9 bits (84), Expect = 0.23
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE+I++ VG  G Q+    WE+   EHGI+  G
Sbjct: 1   MREVISINVGQAGIQMANAAWELFCIEHGIEADG 34


>UniRef50_UPI0000DB78C0 Cluster: PREDICTED: similar to Tubulin
           alpha-6 chain (Alpha-tubulin 6) (Alpha-tubulin isotype
           M-alpha-6); n=1; Apis mellifera|Rep: PREDICTED: similar
           to Tubulin alpha-6 chain (Alpha-tubulin 6)
           (Alpha-tubulin isotype M-alpha-6) - Apis mellifera
          Length = 542

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/81 (35%), Positives = 54/81 (66%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           +++E+   K  PRT++IDL+P+ +D +++G +  LF PD+ V G+  A+NN+A+G+++ G
Sbjct: 53  FFSESQVRKLTPRTMIIDLEPSVIDEIKTGDYKQLFSPDSLVTGKQDASNNYARGYHSIG 112

Query: 456 VEILESALDVIRREAEGWIAC 518
            E +     V+ R ++ W AC
Sbjct: 113 REAIPL---VLSRISKIWEAC 130



 Score = 39.9 bits (89), Expect = 0.058
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSGC 234
           EII + +G  G Q+    WE+   EHGI P+GC
Sbjct: 6   EIITIFIGQAGTQLANACWELFCLEHGISPNGC 38


>UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba
           histolytica|Rep: Tubulin gamma chain - Entamoeba
           histolytica
          Length = 451

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY-GQNCAANNWAK 437
           +R +V++ +A   +YVPR++ IDL+P  +D++R+  +   + P+NF+    N A N+WA 
Sbjct: 45  DRKDVFFYQADDQRYVPRSINIDLEPRVLDSIRTSEWRNFYNPENFIIPTNNGAGNSWAN 104

Query: 438 GHYTEGVEILESALDVIRREAE 503
           G+YT   E +    ++I RE E
Sbjct: 105 GYYT--TEKMSEIEEIIDREVE 124



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII L VG CGNQ+G +F++ I  EHGI P G
Sbjct: 3   REIITLNVGQCGNQLGSEFFKKICSEHGILPDG 35


>UniRef50_A5HWB6 Cluster: Bacterial tubulin B; n=8;
           Prosthecobacter|Rep: Bacterial tubulin B -
           Prosthecobacter vanneervenii
          Length = 442

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 26/79 (32%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           + V++++   GKY+PR +L+DL+P  +  +  G    LF     +     AANNWA+G+ 
Sbjct: 66  MEVFFHKVRDGKYIPRAILVDLEPGVIARIEGGDMAQLFDESCIIRKIPGAANNWARGYN 125

Query: 447 TEGVEILESALDVIRREAE 503
            EG  I++  ++VI    E
Sbjct: 126 VEGERIIDQIMNVIDAAVE 144



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           +REI+++ VG CGNQI  +FW ++  EHG+  +G
Sbjct: 19  VREILSIHVGQCGNQIADRFWRLVLREHGLTEAG 52



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           + R+R+ YP + I TFSV PSP +SD
Sbjct: 171 LERLRQAYPKKRIFTFSVAPSPLISD 196


>UniRef50_P34475 Cluster: Tubulin gamma chain; n=2;
           Caenorhabditis|Rep: Tubulin gamma chain - Caenorhabditis
           elegans
          Length = 444

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGP-FGCLFRPDNFVYGQN--CAANNW 431
           ++ ++ + +A    YVPR VL+DL+P  ++ +   P F  LF  DN     +   A NNW
Sbjct: 47  DKKDLLFYQADDDHYVPRAVLVDLEPRVINGMMQSPNFSNLFNTDNIFMSDHGGGAGNNW 106

Query: 432 AKGHYTEGVEILESALDVIRREAE 503
           A G Y +G E+ E  +D+I REAE
Sbjct: 107 ASG-YCQGQEVQEKIMDIIIREAE 129



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSK 264
           ++ + VG CGNQ+   FW+ + DEHGI+  G    + D+N K
Sbjct: 7   LMTVHVGQCGNQLAQAFWKSMVDEHGINERGQTTHEDDMNDK 48


>UniRef50_UPI00006CA67A Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 452

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/80 (37%), Positives = 43/80 (53%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E +  +++E+   KYVPR V +DL    +D +R       FR D  + G+    +N  +G
Sbjct: 45  ENVTCFFSESEKQKYVPRCVFLDLDATPIDEIRKKS-SSFFRKDCLISGKEDCGSNCVRG 103

Query: 441 HYTEGVEILESALDVIRREA 500
            YT G EI + ALD IR EA
Sbjct: 104 KYTLGKEICDIALDQIRLEA 123



 Score = 33.5 bits (73), Expect = 5.0
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTC 276
           M EIIN+ VG  G Q G ++W+ I  EH I+  G        +++  TC
Sbjct: 1   MGEIINVFVGQYGVQSGQEYWKQICLEHNINSYGQKLTQQQDDNENVTC 49


>UniRef50_Q3ZJ98 Cluster: Tubulin gamma subunit; n=1;
           Monocercomonoides sp. PA203|Rep: Tubulin gamma subunit -
           Monocercomonoides sp. PA203
          Length = 479

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 4/86 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNF----VYGQNCAANN 428
           +R +V++ +A   ++VPR VLIDL+P  +  +++GP    F P+NF    +     A NN
Sbjct: 45  DRKDVFFYQADDDRFVPRAVLIDLEPKVIGGIKNGPMKHFFNPENFFMPKISEGRGAGNN 104

Query: 429 WAKGHYTEGVEILESALDVIRREAEG 506
           W  G Y    +  E   D+I RE +G
Sbjct: 105 WGAG-YEMASKTHEELFDLIDREVDG 129



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           M EI+ +Q G CGNQIG +FW+ I+ EHGI+  G
Sbjct: 1   MFEILTIQCGQCGNQIGNEFWKNITTEHGIELDG 34


>UniRef50_P78672 Cluster: Beta-tubulin; n=3; Hypocreales|Rep:
           Beta-tubulin - Gibberella pulicaris
          Length = 93

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 22/38 (57%), Positives = 28/38 (73%)
 Frame = +1

Query: 142 INLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           ++LQ G CGNQIG  FW+ IS EHG+D +G Y G S+L
Sbjct: 1   VHLQTGQCGNQIGAAFWQTISGEHGLDSNGVYSGTSEL 38



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVP 311
           QLER++VY+NEAS  KYVP
Sbjct: 39  QLERMSVYFNEASGNKYVP 57


>UniRef50_UPI0000E1F213 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 580

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/95 (35%), Positives = 46/95 (48%)
 Frame = +3

Query: 405 GQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS* 584
           GQ  A  NWAKGHYTEG E++ES + V+R+EAE     +   +T +  R           
Sbjct: 312 GQCGARKNWAKGHYTEGAELMESVMVVVRKEAESCNCLQGFQLTHSLGRGTASGMGTLLI 371

Query: 585 TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +   +  P  +   F     P+    V EPYNTTL
Sbjct: 372 SKIREEYPDRIISTFSVLPSPKVSDTVGEPYNTTL 406


>UniRef50_UPI0000660846 Cluster: Homolog of Notothenia coriiceps
           "Alpha tubulin.; n=1; Takifugu rubripes|Rep: Homolog of
           Notothenia coriiceps "Alpha tubulin. - Takifugu rubripes
          Length = 306

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 26/70 (37%), Positives = 42/70 (60%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N ++ E+ AGK     V +D +P  +D VRSG +  L  P+  + G+  AANN+A+G
Sbjct: 20  DSFNTFFGESGAGK-----VFVDQEPTVIDEVRSGSYRQLLHPEQLISGKEDAANNYARG 74

Query: 441 HYTEGVEILE 470
           HYT   +I++
Sbjct: 75  HYTLWKKIID 84


>UniRef50_Q8SRD2 Cluster: Tubulin gamma chain; n=1; Encephalitozoon
           cuniculi|Rep: Tubulin gamma chain - Encephalitozoon
           cuniculi
          Length = 434

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSK 264
           MRE++ LQVG CGNQ+G +FW+ +  EHGI   G      DL  +
Sbjct: 1   MREVVTLQVGQCGNQMGAEFWKTLCKEHGISMCGVLQDSRDLGDR 45



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQ--NCAANNWA 434
           +R +V++ +A    +VPR +L+DL+P  +    S      F  ++         A NNW 
Sbjct: 44  DRKDVFFYQADDNVFVPRAILVDLEPRVISQAPS-----FFSQESIFLSNEGGGAGNNWG 98

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G Y  G  +    +D+I+REAEG
Sbjct: 99  HG-YCVGKAMGNDVIDMIQREAEG 121


>UniRef50_UPI00005A4366 Cluster: PREDICTED: similar to tubulin,
           alpha 1; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to tubulin, alpha 1 - Canis familiaris
          Length = 128

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 279 YNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           ++E  AGK+VPR V +DLKP  +D V +G +  LF P   + G+  AA N+A
Sbjct: 77  FSETDAGKHVPRAVSVDLKPRVIDEVHNGTYHQLFHPQQLIAGKKDAAKNYA 128


>UniRef50_Q3SEG3 Cluster: Beta tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Beta tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/82 (31%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-AANNWAK 437
           ++INV++NE S  +++PR + +DL+P ++D +       +  P N  + +NC + NN+A 
Sbjct: 44  QKINVFFNENSRQQFLPRCLFLDLEPKSIDKLFIQK-DVIIDP-NCCFSRNCGSGNNYAV 101

Query: 438 GHYTEGVEILESALDVIRREAE 503
           G YTEG E+++    ++ +  E
Sbjct: 102 GRYTEGAELMDKCKHILDKYFE 123


>UniRef50_Q5B300 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 804

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +3

Query: 279 YNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           + E   GK+VPR++ +DL P+ +D +R+G +  LF P+  + G+  AANN     Y
Sbjct: 526 FTELGNGKFVPRSIFVDLDPSPIDEIRTGTYRHLFHPEQLISGKEDAANNCLTSEY 581


>UniRef50_Q24D61 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/83 (31%), Positives = 49/83 (59%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q E+ NVY+ E   G Y  R++ +D  P  ++ ++      LF   +F+YG + + NN++
Sbjct: 43  QKEKFNVYFLETIKGSYCARSIQVDSDPDFINEIQQSYIQNLFSQSSFIYGNSSSNNNFS 102

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G Y++ +E+L+   + IR +AE
Sbjct: 103 QG-YSQ-LELLDQVQEEIRLQAE 123



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 23/41 (56%), Positives = 28/41 (68%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSD 252
           MREIIN+Q+G  GNQIG  FWE +  EH +DP G  +  SD
Sbjct: 1   MREIINIQIGKGGNQIGLDFWEALHIEHSLDPYGDLNHSSD 41


>UniRef50_Q22CD2 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 443

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 26/76 (34%), Positives = 44/76 (57%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           +++E  +G++VPR+V +DL   ++D V+ G    LF  +  V   +  AN +A+G+Y   
Sbjct: 49  FFSETQSGQFVPRSVYLDLDSNSIDEVKVGSQKQLFNHEFLVSKNDEKANTFARGNYQVS 108

Query: 456 VEILESALDVIRREAE 503
            E +E  LD +RR  E
Sbjct: 109 SEFIEFCLDKVRRLTE 124



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDP 225
           M EII++ +G  G Q+G   WE+   EH I P
Sbjct: 1   MEEIISIHIGQSGIQVGNSCWELFCLEHQIQP 32


>UniRef50_Q7R2Q0 Cluster: GLP_546_6876_8351; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_546_6876_8351 - Giardia lamblia ATCC
           50803
          Length = 491

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC---AANNW 431
           +R +V++ ++    YVPR +L+D +P  +  +R+GP   L  P+N VY  +    A N W
Sbjct: 65  DRKDVFFYQSDDEHYVPRAILLDTEPGVISHIRNGPIKELINPEN-VYIDSTGGGAGNIW 123

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
            KG +  G    E  +++I REA+G
Sbjct: 124 TKG-FQCGEAGFEKIVEIIDREADG 147



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           RE+I +Q G CGNQIG  FW  +  EHGI+P G
Sbjct: 22  REVITIQCGQCGNQIGEVFWNRLCTEHGINPDG 54


>UniRef50_Q3SEF7 Cluster: Alpha-tubulin,putative; n=3; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 426

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/75 (36%), Positives = 43/75 (57%)
 Frame = +3

Query: 279 YNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGV 458
           YNE     Y P T+ +DL    ++ V+       ++ ++FV G+  AANN+ + HYT G 
Sbjct: 38  YNENETN-YFPLTLFMDLDDRMVNEVKKNKL-INYKTNSFVTGKEDAANNYCRAHYTIGK 95

Query: 459 EILESALDVIRREAE 503
           EI++  LD IR++ E
Sbjct: 96  EIVDKCLDNIRKQVE 110


>UniRef50_Q23WP5 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 450

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/81 (29%), Positives = 46/81 (56%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E +  ++ E+ + K  P +V IDL    +D +++G    L++PD  +  +      +++G
Sbjct: 46  ENLLSFFQESVSEKITPISVFIDLDTEQIDEIKNGQCRTLYKPDCLISSKEDTGGLFSRG 105

Query: 441 HYTEGVEILESALDVIRREAE 503
           +YT G  IL+ ++D IR+ AE
Sbjct: 106 YYTAGRSILDHSIDQIRKIAE 126



 Score = 37.9 bits (84), Expect = 0.23
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           M++II + +G CG +IG + W++  +EH I+ SG
Sbjct: 1   MKQIITICLGQCGIRIGNQVWKLFCEEHKIELSG 34


>UniRef50_A2EAH1 Cluster: Gamma tubulin, putative; n=5;
           Eukaryota|Rep: Gamma tubulin, putative - Trichomonas
           vaginalis G3
          Length = 457

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYG--QNCAANNWA 434
           +R ++++  +  G+Y+PR +LIDL+P  +  +++      F  +N   G   + A N W 
Sbjct: 46  DRKDIFFYSSDDGRYIPRAILIDLEPRVIMGIKNSELKDFFNAENMYIGVEGSGAGNVWG 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G Y EG    E+  +++RRE E
Sbjct: 106 TG-YAEGEAHYEAFSEIVRREVE 127



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 19/33 (57%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           ++II +QVG CGN IG +FW+ +S EHGI P G
Sbjct: 3   KKIITIQVGQCGNSIGLEFWKTLSTEHGIGPDG 35


>UniRef50_UPI0000F1FF49 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 168

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/42 (52%), Positives = 31/42 (73%)
 Frame = +3

Query: 378 LFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           + R + F   Q+ A NNWAK HYTEG +I++S LDV+R+E+E
Sbjct: 126 IIRMEVFEKRQSGAGNNWAKKHYTEGAKIVDSVLDVVRKESE 167


>UniRef50_Q4S982 Cluster: Chromosome 3 SCAF14700, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF14700, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 97

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>UniRef50_A7NXT4 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 100

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/42 (54%), Positives = 27/42 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI ++Q G C NQI  K WEV+  EH ID  G Y GD +L
Sbjct: 1   MREIFHVQGGQCRNQIEAKLWEVVCIEHDIDSIGRYQGDMEL 42



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 14/20 (70%), Positives = 19/20 (95%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPR 314
           QLE++NVYYNEA+ G++VPR
Sbjct: 43  QLEQVNVYYNEANCGRFVPR 62


>UniRef50_UPI0000DB71EB Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Apis mellifera|Rep: PREDICTED:
           similar to epsilon-tubulin 1 - Apis mellifera
          Length = 420

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/68 (39%), Positives = 36/68 (52%)
 Frame = +3

Query: 300 KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESAL 479
           K   R +LID++ + +  +R GP   LF     V     +ANNWA G+YT G E  +   
Sbjct: 42  KVKARAILIDMEDSVIGEIRRGPVRDLFDQTCVVTNYPGSANNWAVGYYTHGTEYYDKLE 101

Query: 480 DVIRREAE 503
           D IRR AE
Sbjct: 102 DNIRRMAE 109



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           M + I++QVG CGNQIG  FW +   E+ +    C+   SDL
Sbjct: 1   MSQFISVQVGQCGNQIGSVFWPLALHEYDL----CFKSMSDL 38


>UniRef50_Q24D62 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 459

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 40/145 (27%), Positives = 66/145 (45%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q E+I VY++E +  +Y  R++LID  P ++  ++   FG LF  + F+  Q  AAN + 
Sbjct: 43  QREQIGVYFDEQNDKRYKARSLLIDGDPNSIFQIQQSSFGNLFNSNCFIQDQWSAANCFG 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KG   +  E+++  +D IR   E     +   V  +              +   +  P +
Sbjct: 103 KGR--QFYELIDLVMDQIRILVEKSDQMQGFQVMRSLGGGTGSGLGDVLLSKLREEYPNQ 160

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F  F   +   CVVEPYN  L
Sbjct: 161 IITNFCIFPSSQISDCVVEPYNCVL 185



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/34 (58%), Positives = 24/34 (70%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MREIINLQ+G  GN+IG  FWE +  EH +D  G
Sbjct: 1   MREIINLQIGQGGNKIGQCFWESLCTEHQLDQDG 34



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 13/26 (50%), Positives = 22/26 (84%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           ++++REEYP++II  F +FPS ++SD
Sbjct: 150 LSKLREEYPNQIITNFCIFPSSQISD 175


>UniRef50_A2FJ63 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 119

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 22/52 (42%), Positives = 34/52 (65%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREA 500
           +D V +G +  LF P+  + G+  AAN++A+GHYT   EI++  LD IR+ A
Sbjct: 14  IDEVHTGKYRQLFHPEQLISGKEDAANDYARGHYTVSKEIIDFTLDRIRKLA 65


>UniRef50_A5HWB9 Cluster: Bacterial tubulin A2; n=7;
           Prosthecobacter|Rep: Bacterial tubulin A2 -
           Prosthecobacter debontii
          Length = 497

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +3

Query: 285 EASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEI 464
           + S+  YVPR+V++DL+P+ ++ +++   G LF P N +     A  N+A G+   G E+
Sbjct: 58  DGSSASYVPRSVMVDLEPSVINQIKA-TTGSLFNPANLITRMEGAGGNFAVGYMGAGREV 116

Query: 465 LESAL 479
           L  A+
Sbjct: 117 LPEAM 121



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 127 KMREIINLQVGSCGNQIGGKFWEVISDEHGIDPS 228
           K+   + + VG  GNQI   FW  +  EHGIDP+
Sbjct: 2   KVNNTLVVSVGQAGNQIASSFWRTLCLEHGIDPT 35


>UniRef50_Q9XFV1 Cluster: Putative uncharacterized protein; n=1;
           Chlamydomonas sp. HS-5|Rep: Putative uncharacterized
           protein - Chlamydomonas sp. HS-5
          Length = 91

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKG--STCTTTRHRLGN 303
           MRE I++ +G  G Q+G   WE+   EHGI P G    D  +      ST ++ R    +
Sbjct: 1   MREAISIHIGQAGCQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDVSTRSSLRRAPAS 60

Query: 304 MFLARFLST*SRPRWTR*GRDPSDAYSDRT 393
             LA    T S P  TR  R P+ + S R+
Sbjct: 61  TSLAPSSLTWSPPSSTRSARAPTASCSTRS 90


>UniRef50_Q22YZ9 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 498

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 19/28 (67%), Positives = 22/28 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH 213
           MRE+I +QVG CGNQIG KFWE+   EH
Sbjct: 1   MRELITIQVGQCGNQIGAKFWELAIKEH 28



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 17/64 (26%), Positives = 33/64 (51%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R++++D++    + +     G LF    F+   + A NNWA GH+  G +  ++  + IR
Sbjct: 69  RSIIVDMEEGVTNQLLKSDIGDLFDQRQFINDVSGAGNNWAHGHFFYGNKYRDNMSERIR 128

Query: 492 REAE 503
           +  E
Sbjct: 129 KAVE 132


>UniRef50_O22416 Cluster: Tubulin Uni3; n=1; Chlamydomonas
           reinhardtii|Rep: Tubulin Uni3 - Chlamydomonas
           reinhardtii
          Length = 532

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 5/86 (5%)
 Frame = +3

Query: 261 ERINVYYN-EASAGKYVPRTVLIDLKPATMDAVRSGPF--GCLFR--PDNFVYGQNCAAN 425
           + ++ Y+   A    Y  R+VLID++P  +   RS     G  +R     ++  Q+ + N
Sbjct: 35  DAVHEYFRPSADPNLYTARSVLIDMEPKVVAGARSAAAASGSWWRYPSSGYLVMQSGSGN 94

Query: 426 NWAKGHYTEGVEILESALDVIRREAE 503
           NWA+G +  G ++ E ALD++R+E E
Sbjct: 95  NWAQGFHGYGPQVHEDALDLVRKEVE 120


>UniRef50_Q4UCK3 Cluster: Tubulin gamma-chain (Gamma-tubulin),
           putative; n=2; Theileria|Rep: Tubulin gamma-chain
           (Gamma-tubulin), putative - Theileria annulata
          Length = 490

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC--AANNWAKGH 443
           +V++ +    +Y PR +LIDL+P  + ++ +     LF P+N    ++   A NNW  G 
Sbjct: 48  DVFFFQTGTNRYYPRALLIDLEPRVISSILNSENKNLFNPENVFLSKDSMGAGNNWGVG- 106

Query: 444 YTEGVEILESALDVIRREAE 503
           YT G +  +   +++ RE +
Sbjct: 107 YTYGNQFNDELSEIVDREVD 126



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/33 (54%), Positives = 22/33 (66%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           +EI+ L VG CGN IG +FW  I  EHGI+  G
Sbjct: 3   KEIVTLHVGQCGNNIGNEFWNQICLEHGINKDG 35


>UniRef50_A7R175 Cluster: Chromosome undetermined scaffold_340,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_340, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 568

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = +2

Query: 518 QVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           +V +C T              +++I++EYPDR++L FSVFPSP+VSD
Sbjct: 17  KVSKCATHLVEVLVLGIGTLLISKIKKEYPDRMMLAFSVFPSPKVSD 63


>UniRef50_Q22UN3 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 431

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 42/79 (53%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           INVY+ E     Y PR+++ DL    ++ V++G    LF+ +     Q  + N + +G+Y
Sbjct: 44  INVYFEEVKQDVYKPRSIIADLDDQEINRVQNGFLKRLFQSNTSFSKQESSQNIFPRGYY 103

Query: 447 TEGVEILESALDVIRREAE 503
           + G E+ E     I+++ E
Sbjct: 104 SHGAELKEEIEYEIQKQVE 122


>UniRef50_UPI00015B54E0 Cluster: PREDICTED: similar to Tubulin,
           epsilon 1; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to Tubulin, epsilon 1 - Nasonia vitripennis
          Length = 478

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/64 (37%), Positives = 32/64 (50%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++ + +   R GP   LF     V     + NNWA G+YT G+E      + IR
Sbjct: 86  RAVLIDMEDSVVGRFRQGPLRNLFDQTCTVTNYPGSGNNWAVGYYTHGIEYHNKLEETIR 145

Query: 492 REAE 503
           R  E
Sbjct: 146 RTVE 149



 Score = 41.5 bits (93), Expect = 0.019
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGI 219
           M + + +QVG CGNQIG  FW ++  E+G+
Sbjct: 1   MSQFVTVQVGQCGNQIGSAFWPLVLHEYGV 30


>UniRef50_Q3SEH6 Cluster: Iota_tubulin,putative; n=2; Paramecium
           tetraurelia|Rep: Iota_tubulin,putative - Paramecium
           tetraurelia
          Length = 408

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/68 (29%), Positives = 40/68 (58%)
 Frame = +3

Query: 300 KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESAL 479
           K +PRT+L+D +  T+D +R       + P+NFV G++     +A G+Y +  ++ +  +
Sbjct: 39  KGIPRTILVDNEENTLDKIRGNKNLSYYDPNNFVCGKSAKCLTFASGYYGQN-DLFDEIV 97

Query: 480 DVIRREAE 503
           + +R+E E
Sbjct: 98  ERVRKEQE 105



 Score = 35.9 bits (79), Expect = 0.94
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHG 216
           M++II +QVG  GNQIG   W  + D+ G
Sbjct: 1   MKQIITIQVGQSGNQIGNAIWNQMMDDCG 29


>UniRef50_O93807 Cluster: Tubulin gamma chain; n=8;
           Saccharomycetales|Rep: Tubulin gamma chain - Candida
           albicans (Yeast)
          Length = 502

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           E I LQVG CGNQ+G ++W+ ++ EHGI   G
Sbjct: 4   ETITLQVGQCGNQVGLQYWQQLATEHGIQSDG 35



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 2/79 (2%)
 Frame = +3

Query: 273 VYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQ--NCAANNWAKGHY 446
           +++  + +  Y PR++LID++P+ +   +S     +F P N       N AANNW  G Y
Sbjct: 79  LFFTLSDSNTYTPRSILIDMEPSVI--AKSTSALPMFNPRNVHLSNQGNGAANNWING-Y 135

Query: 447 TEGVEILESALDVIRREAE 503
             G E  E+ L++I RE +
Sbjct: 136 KYGTEEEETLLNLIDREVD 154


>UniRef50_UPI00003977B9 Cluster: hypothetical protein Haso02002277;
           n=1; Haemophilus somnus 2336|Rep: hypothetical protein
           Haso02002277 - Haemophilus somnus 2336
          Length = 198

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = -3

Query: 476 SRLQNLYSFSVVSLRPVVGRTVLSVDEIVRSE*ASEGSRPHRVHRGRLQVDKNRARNIFP 297
           +++ NL +  VV+   VVG  +L+ DE++R E  + G+ PH +     +V+KN  R++ P
Sbjct: 62  AQVNNLLANGVVTTGEVVGCILLATDELLRVEELAVGASPHLIDDSGFKVNKNSTRDVLP 121

Query: 296 SRCL 285
           S  L
Sbjct: 122 STSL 125


>UniRef50_Q9SEA4 Cluster: Tubulin gamma chain, nucleomorph; n=1;
           Guillardia theta|Rep: Tubulin gamma chain, nucleomorph -
           Guillardia theta (Cryptomonas phi)
          Length = 424

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/89 (23%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLF-RPDNFVYGQNCAANNWAKGHY 446
           NV++ E++   ++PRT++ DL     + +    +  ++ +  +F+  +N   N+W KG+Y
Sbjct: 46  NVFFEESNESFFIPRTIIFDLSERDFNYIMKSNYSKMYDKNRHFILNKN-TGNSWLKGYY 104

Query: 447 TEGVEILESALDVIRREAEGWIACKFSDV 533
            EG+       +++R+  E   + K+ +V
Sbjct: 105 -EGISNCNLVDNILRKRIEKMNSVKYFNV 132


>UniRef50_Q862L2 Cluster: Similar to alpha-tubulin isoform 1; n=1;
           Bos taurus|Rep: Similar to alpha-tubulin isoform 1 - Bos
           taurus (Bovine)
          Length = 99

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/37 (43%), Positives = 26/37 (70%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPF 371
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTY 83


>UniRef50_Q4CWT7 Cluster: Delta tubulin, putative; n=4;
           Trypanosoma|Rep: Delta tubulin, putative - Trypanosoma
           cruzi
          Length = 571

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 3/69 (4%)
 Frame = +3

Query: 306 VPRTVLIDLKPATMDAV-RSGPFGCLFRPD--NFVYGQNCAANNWAKGHYTEGVEILESA 476
           +PR V+ID++P  ++ + ++   G  +RP     +     +ANNWA G++ +G    E  
Sbjct: 146 LPRCVMIDMEPKVIEGILKNTKNGGAYRPHVRQCITRDEGSANNWACGYFQQGSSRKEEI 205

Query: 477 LDVIRREAE 503
           LD +RRE+E
Sbjct: 206 LDSLRRESE 214


>UniRef50_Q4P3J3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 291

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 408 QNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           +    NN+AKG+YTEG E+L+  LDV R+EAE
Sbjct: 27  RKATGNNFAKGYYTEGAELLDQVLDVARKEAE 58



 Score = 40.7 bits (91), Expect = 0.033
 Identities = 15/26 (57%), Positives = 23/26 (88%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           + ++REE+PDR++ T+SV PSP+VSD
Sbjct: 85  LTKLREEFPDRMLATWSVLPSPKVSD 110


>UniRef50_Q3SEF9 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 551

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/47 (44%), Positives = 24/47 (51%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGS 270
           MREII+L +G  G QIG   WE+   EH I P G    D  L    S
Sbjct: 1   MREIISLHIGQAGLQIGNSLWELFCLEHSIQPDGTVPTDRILEGLNS 47



 Score = 40.7 bits (91), Expect = 0.033
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           ++  ++ +  G+YVPR +  D  P T++A+++GP   LF        Q  +   WA+   
Sbjct: 49  VDSLFSLSQYGRYVPRAIFFDEDPTTINAIKNGPSRGLFNRSYIHQCQKESGGCWARSFG 108

Query: 447 T-EGVEILESALDVIRREAE 503
           T    E  E   D IR++ E
Sbjct: 109 TIMNQEGEEKIADKIRKQVE 128


>UniRef50_A0BQ86 Cluster: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_120,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 289

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 1/137 (0%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           +++E    K+  R++ IDL   T+D ++   F  LFRP   + G++ A + +A G+Y  G
Sbjct: 100 FFSETGNNKHSQRSLFIDLDRNTIDELKRSQFRELFRPQQMILGKDSAIDIYAGGYYGVG 159

Query: 456 VEILE-SALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQ 632
            +      +  + R+ + +I  +   +TL    Y ++ +YA       +SI +       
Sbjct: 160 KKYYRCRKIAWVFRDLQYFILLE-EVLTLDLHIYYWK-QYAIHEEFGKQSINS-----VA 212

Query: 633 SFQVPECRICVVEPYNT 683
           +F  P+    ++EPYNT
Sbjct: 213 TFPSPQIESSIIEPYNT 229


>UniRef50_UPI0000E1EF15 Cluster: PREDICTED: similar to
           alpha-2-tubulin; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to alpha-2-tubulin - Pan troglodytes
          Length = 137

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 348 DAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALD 482
           D VR+  +  LF P+  + G   AANN A GHYT G EI++  L+
Sbjct: 93  DGVRTDIYRQLFHPEQLMSGMEDAANNCAHGHYTAGKEIIDLVLE 137


>UniRef50_Q7QZN1 Cluster: GLP_680_43068_44504; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_680_43068_44504 - Giardia lamblia
           ATCC 50803
          Length = 478

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/28 (60%), Positives = 20/28 (71%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH 213
           MREI+ +Q G CGNQIG +FW  I  EH
Sbjct: 1   MREILVVQTGQCGNQIGAEFWRTILGEH 28


>UniRef50_Q4QC95 Cluster: Epsilon tubulin, putative; n=6;
           Trypanosomatidae|Rep: Epsilon tubulin, putative -
           Leishmania major
          Length = 470

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +3

Query: 297 GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESA 476
           G+   R V +D++   + A+  GP   +F  + FV   + A NNWA GH   G   +++ 
Sbjct: 51  GRLKARCVAVDMEQGVLHAMLRGPLKDIFDANFFVSDVSGAGNNWAVGHMEYGDRYIDAI 110

Query: 477 LDVIRREAE 503
            + +R + E
Sbjct: 111 AESVRNQVE 119



 Score = 39.5 bits (88), Expect = 0.076
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDP 225
           REI+ +QVG CGNQ+G ++++V+  EH   P
Sbjct: 3   REIVTVQVGQCGNQLGQRWFDVMLQEHKAYP 33


>UniRef50_A4H729 Cluster: Alpha tubulin; n=5; Trypanosomatidae|Rep:
           Alpha tubulin - Leishmania braziliensis
          Length = 267

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSG 365
           +  N +++E  AGK+VPR++ +DL+P  +D VR+G
Sbjct: 81  DAFNTFFSETGAGKHVPRSLFLDLEPTVVDEVRTG 115



 Score = 40.3 bits (90), Expect = 0.044
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGD 246
           MRE I + +G  G Q+G   WE+   EHGI P G    D
Sbjct: 35  MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSD 73


>UniRef50_A2ELX8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, GTPase domain containing protein -
           Trichomonas vaginalis G3
          Length = 434

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 18/28 (64%), Positives = 20/28 (71%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH 213
           M EII LQ+G CGNQIG +FWE    EH
Sbjct: 1   MSEIIFLQIGQCGNQIGWEFWEKALKEH 28



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID +      + +     +FR  +       A NNWA G++  G   ++S L+ IR
Sbjct: 62  RAVLIDSETNVTKQLETSAIRDIFRGCSISVDVGGAGNNWAVGYHQNGHLQIDSVLEKIR 121

Query: 492 REAE 503
           + AE
Sbjct: 122 KLAE 125


>UniRef50_A0EC94 Cluster: Chromosome undetermined scaffold_89, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_89,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 624

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MREI+   VG  G QIG   WE++  EHGI P G
Sbjct: 1   MREILQFHVGQAGIQIGNTAWELLCLEHGIQPDG 34


>UniRef50_UPI0000DC0F37 Cluster: UPI0000DC0F37 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0F37 UniRef100 entry -
           Rattus norvegicus
          Length = 410

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/60 (36%), Positives = 35/60 (58%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           N +++E  A K++P+ + I L+P  +D V +G    LF P+     Q  AANN A G+Y+
Sbjct: 55  NTFFSETGASKHLPQAMFIGLEPTVIDEVCTGICCQLFHPE-LEGRQEDAANNCAYGNYS 113


>UniRef50_UPI0000E7FE1E Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 94

 Score = 41.9 bits (94), Expect = 0.014
 Identities = 27/71 (38%), Positives = 34/71 (47%)
 Frame = +1

Query: 262 KGSTCTTTRHRLGNMFLARFLST*SRPRWTR*GRDPSDAYSDRTISSTDKTVRPTTGRRD 441
           +GSTCTT +  + +        T S  RWTR    P D  SD T  S  +    TTG R 
Sbjct: 20  RGSTCTTMKLPVTSTSPVPSWLTWSPARWTRCAPAPLDRSSDPTTLSLVRAGPATTGPRG 79

Query: 442 TTLKE*RFWSL 474
           TT K   +W+L
Sbjct: 80  TTRKALSWWTL 90


>UniRef50_Q8I2I0 Cluster: Delta tubulin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Delta tubulin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 735

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +3

Query: 381 FRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           F   NF+ G N + NNWA G Y  G  I E  +++I +E E
Sbjct: 274 FNKSNFICGLNGSGNNWAYGFYVHGKNICEDFINIINKEFE 314



 Score = 32.7 bits (71), Expect = 8.8
 Identities = 9/24 (37%), Positives = 20/24 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVI 201
           M  ++++Q+G CGNQ+G +F++++
Sbjct: 1   MMGVLSIQIGQCGNQVGYEFFDIL 24


>UniRef50_Q9D6T1 Cluster: Tubulin epsilon chain; n=9; Eukaryota|Rep:
           Tubulin epsilon chain - Mus musculus (Mouse)
          Length = 475

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    E  L+ +R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLYREQILEKLR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>UniRef50_P53378 Cluster: Tubulin gamma chain; n=5;
           Saccharomycetales|Rep: Tubulin gamma chain -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 473

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 24/70 (34%), Positives = 28/70 (40%), Gaps = 1/70 (1%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYH-GDSDLNSKGSTCTTTRHRLGNMFL 312
           EII LQ G CGN +G   W  ++ EH I   G     DS       T    R    N F 
Sbjct: 4   EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFT 63

Query: 313 ARFLST*SRP 342
            R +   S P
Sbjct: 64  PRAIMMDSEP 73


>UniRef50_A0JJL8 Cluster: Beta-tubulin; n=13; Sordariomycetes|Rep:
           Beta-tubulin - Phaeoacremonium venezuelense
          Length = 90

 Score = 40.7 bits (91), Expect = 0.033
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +2

Query: 260 RKDQRVLQRGIGWEICSSHGSYRLEAGHDGRGEVGTLRMPIQTGQFRLRTKLCGQQLGEG 439
           R  +R+LQRG+  ++ +     RL A H G     +LR  +   Q RLR   C QQLG+G
Sbjct: 29  RAHERLLQRGLWQQVRAPCRPGRLGARHHGCRPCRSLRPAVPPRQLRLRPVWCWQQLGQG 88

Query: 440 T 442
           +
Sbjct: 89  S 89


>UniRef50_UPI0000EB04B1 Cluster: UPI0000EB04B1 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB04B1 UniRef100
           entry - Canis familiaris
          Length = 387

 Score = 39.9 bits (89), Expect = 0.058
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           +  N  ++E  AGK+VPR + +   P  +D V +G    LF P+    G+  A NN+A
Sbjct: 48  DSFNASFSEMGAGKHVPRAMFV---PTVIDEVHTGTDCQLFHPEQLNTGKEDATNNYA 102


>UniRef50_Q8T887 Cluster: Delta-tubulin; n=1; Ciona
           intestinalis|Rep: Delta-tubulin - Ciona intestinalis
           (Transparent sea squirt)
          Length = 453

 Score = 39.5 bits (88), Expect = 0.076
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = +3

Query: 267 INVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFG---CLFRPDNFVYGQNCAANNWAK 437
           +  +++E  +G Y  R+V++D++P  ++   SG  G      +   F   ++ + NNWA 
Sbjct: 48  LKTFFHETGSG-YEARSVMVDMEPKAVNCALSGTSGKGWSYAKRQQFCQ-KSGSGNNWAY 105

Query: 438 GHYTEGVEILESALDVIRREAE 503
           G         +  LD IRRE E
Sbjct: 106 GFKVHAPRCKDGILDCIRREVE 127


>UniRef50_A1BPT4 Cluster: Tubulin-like protein; n=1; Lygus
           lineolaris|Rep: Tubulin-like protein - Lygus lineolaris
           (Tarnished plant bug)
          Length = 242

 Score = 39.5 bits (88), Expect = 0.076
 Identities = 18/53 (33%), Positives = 34/53 (64%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           M+++ +  +  LF+ D  + G   AANN+A+G +T G +++    D++RR+AE
Sbjct: 1   MESISTTKYCKLFQSDFILKGTEDAANNFARGFHTLGKQMMIPLSDMVRRQAE 53


>UniRef50_Q9UJT0 Cluster: Tubulin epsilon chain; n=30;
           Eukaryota|Rep: Tubulin epsilon chain - Homo sapiens
           (Human)
          Length = 475

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>UniRef50_Q8IK81 Cluster: Tubulin, putative; n=9; Plasmodium|Rep:
           Tubulin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 519

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDE 210
           +REII L VG CGNQ+G +FW V   E
Sbjct: 2   VREIIFLHVGQCGNQLGHEFWSVAIKE 28



 Score = 32.7 bits (71), Expect = 8.8
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALD-VI 488
           R +LID +    + +           +N    Q+ A NNW++G+   G ++ E+ +D +I
Sbjct: 74  RAILIDTETGVANEIMKSTISPYIDENNIFTQQSGAGNNWSQGYMYYG-KMYENIIDNII 132

Query: 489 RREAE 503
           RR  E
Sbjct: 133 RRNVE 137


>UniRef50_UPI0000DC0C7D Cluster: UPI0000DC0C7D related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0C7D UniRef100 entry -
           Rattus norvegicus
          Length = 366

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           M E I++ +G  G QI    WE+   EHGI P G
Sbjct: 5   MHEYISIYIGQAGIQISNACWELYCSEHGIQPDG 38


>UniRef50_Q4S633 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 404

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 8/107 (7%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG--------CYHGDSDLNSKGSTCTTTR 288
           RE++++ VG  G QIG   WE+   EH I P G           GD   N+   T ++ R
Sbjct: 3   REVVSIHVGQAGVQIGNACWELFCLEHHIGPDGESLDGAAPPNSGDDQFNTFFHTGSSGR 62

Query: 289 HRLGNMFLARFLST*SRPRWTR*GRDPSDAYSDRTISSTDKTVRPTT 429
           H    +++    S        +   D +  +S  + SS +K  +PTT
Sbjct: 63  HVPRAVYVDLEPSVVVLVMKIKSELDNTKIFSTPSSSSLEKRTQPTT 109


>UniRef50_Q6AU00 Cluster: Alpha tubulin; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Alpha tubulin - Oryza sativa subsp.
           japonica (Rice)
          Length = 195

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 7/72 (9%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG-------CYHGDSDLNSKGSTCTTTR 288
           MRE I++ +G  G Q+G   WE+   EHGI   G          GD   N+  S     +
Sbjct: 1   MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK 60

Query: 289 HRLGNMFLARFL 324
           H    +FLAR L
Sbjct: 61  HVPRAVFLARRL 72


>UniRef50_Q9UJT1 Cluster: Tubulin delta chain; n=35;
           Euteleostomi|Rep: Tubulin delta chain - Homo sapiens
           (Human)
          Length = 453

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++ + S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQMLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128


>UniRef50_Q7R6N2 Cluster: GLP_170_87302_88000; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_170_87302_88000 - Giardia lamblia
           ATCC 50803
          Length = 232

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATM-------DAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           ++ +AS G    + ++ID++P  +       + V  G F   +   + ++GQ+ + NNWA
Sbjct: 39  WFGQASDGSIYAKALMIDMEPKAILKSCLGKNDVIDGRFH--YNARSAIFGQSGSGNNWA 96

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G   L   L+ +R+ AE
Sbjct: 97  HGYMEHGPRELPKILEGVRKYAE 119


>UniRef50_Q3SEG4 Cluster: Alpha-tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha-tubulin,putative - Paramecium
           tetraurelia
          Length = 461

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREII+   G  G Q+    WE+   EHGI+  G    +S++
Sbjct: 1   MREIISFHFGQSGAQLASPLWELYCLEHGINLDGSVSNNSEI 42


>UniRef50_A2F2M2 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Tubulin/FtsZ family, GTPase domain containing protein -
           Trichomonas vaginalis G3
          Length = 432

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +3

Query: 279 YNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCL-FRPDNF-VYGQNCAA-NNWAKGHYT 449
           + E S  +Y+ RTVLID +   +  + S  F    ++ D   ++ + C + NNWA G+  
Sbjct: 41  FYETSDHQYIARTVLIDTERKAITDILSDKFATRNWKYDKCSIWAEGCGSGNNWAYGYDK 100

Query: 450 EGVEILESALDVIRREAE 503
            G       +D ++ +AE
Sbjct: 101 NGFAAKNEVMDRLQHQAE 118


>UniRef50_A5KEA7 Cluster: Delta tubulin, putative; n=1; Plasmodium
           vivax|Rep: Delta tubulin, putative - Plasmodium vivax
          Length = 668

 Score = 36.7 bits (81), Expect = 0.54
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +3

Query: 393 NFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           NF+YG N + NNW+ G       I E  L++I++E E
Sbjct: 215 NFIYGLNGSGNNWSYGFNVHAKNICEDFLNLIQKEME 251


>UniRef50_UPI00015B628B Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 456

 Score = 36.3 bits (80), Expect = 0.71
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +3

Query: 297 GKYVPRTVLIDLKPATMDAVRSGPFG-CLFRPDNFV-YGQNCAANNWAKGHYTEGVEILE 470
           GK + R VL+D +   ++ + S       +R  N +      +ANNWA G   +G ++  
Sbjct: 75  GKRLARAVLVDTEHKVVNKICSNSSDRWTYRSQNLICQSSGGSANNWAYGSLVKGPQLKN 134

Query: 471 SALDVIRREAE 503
             L++ R+E E
Sbjct: 135 DVLEISRKEIE 145


>UniRef50_Q6A208 Cluster: Delta tubulin; n=1; Oikopleura dioica|Rep:
           Delta tubulin - Oikopleura dioica (Tunicate)
          Length = 417

 Score = 36.3 bits (80), Expect = 0.71
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCL--FRPDNFVYGQNCAANNWAKGHYT 449
           ++ E   GKY  R VLID++P  ++ V     G    +     +  ++ + NNWA G+  
Sbjct: 31  FFVEKQNGKYYARNVLIDMEPKVIENVLKKSEGKTWNYSKTAAITAKSGSGNNWAFGYSV 90

Query: 450 EGVEILESALDVIRREAE 503
            G    ES    IR+ AE
Sbjct: 91  LGDRNQESIQRQIRKLAE 108


>UniRef50_Q8J1W3 Cluster: Beta-tubulin; n=1; Colletotrichum sp.|Rep:
           Beta-tubulin - Colletotrichum sp
          Length = 80

 Score = 29.1 bits (62), Expect(2) = 0.85
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 199 ISDEHGIDPSGCYHGDSDL 255
           IS EHG+D +G Y+G S+L
Sbjct: 3   ISGEHGLDSNGVYNGTSEL 21



 Score = 26.2 bits (55), Expect(2) = 0.85
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = +1

Query: 376 AYSDRTISSTDKTVRPTTGRRDTTLKE*RFWSLL*MSFEGKLRA 507
           ++S  T SS    V  TTG R TTL+E    +   MS   +LRA
Sbjct: 34  SFSAPTTSSLASPVPATTGPRVTTLRELSSSTRFSMSSVARLRA 77


>UniRef50_UPI0000EB22D9 Cluster: Tubulin delta chain (Delta
           tubulin).; n=1; Canis lupus familiaris|Rep: Tubulin
           delta chain (Delta tubulin). - Canis familiaris
          Length = 484

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 5/81 (6%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMD-----AVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +++E   G  + R VL+D++P  ++     A +SG +   +   +    +  + NNWA G
Sbjct: 50  FFSEEENGVSIARAVLVDMEPKVINQTLSKAAQSGQWK--YAQHSCFCQKEGSGNNWAYG 107

Query: 441 HYTEGVEILESALDVIRREAE 503
           +   G    ES +++I++E E
Sbjct: 108 YSVHGPRHEESIMNLIQKEVE 128


>UniRef50_A7ARU2 Cluster: Tubulin, putative; n=1; Babesia bovis|Rep:
           Tubulin, putative - Babesia bovis
          Length = 498

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R +LID   +T+  V      C    +N V G   A NNW+  ++  G +  ++  D+I 
Sbjct: 73  RCILIDTDLSTITEVLQKQHHCHIDNENIVCGTEAAGNNWSVAYFHHGPQYHQTVEDLID 132

Query: 492 REAE 503
              E
Sbjct: 133 HNLE 136


>UniRef50_Q8K5B7 Cluster: Neuron-specific class III beta-tubulin;
           n=6; Fungi/Metazoa group|Rep: Neuron-specific class III
           beta-tubulin - Rattus norvegicus (Rat)
          Length = 19

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGK 186
           MREI+++Q G CGNQIG K
Sbjct: 1   MREIVHIQAGQCGNQIGAK 19


>UniRef50_UPI0000584751 Cluster: PREDICTED: similar to tubulin,
           delta 1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to tubulin, delta 1 -
           Strongylocentrotus purpuratus
          Length = 439

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 5/87 (5%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVP--RTVLIDLKPATM-DAVRSGPFGCLFR-PDNFVY-GQNCAA 422
           LER      E  + K  P  R V++D++   + + V +      +R PD   +  +  A 
Sbjct: 43  LERFFHQSLEEGSSKTTPSARAVMVDMESKVIQNTVATAKKSGTWRYPDKQQFCRKRGAG 102

Query: 423 NNWAKGHYTEGVEILESALDVIRREAE 503
           NNWA G Y  G  + E  L++++RE E
Sbjct: 103 NNWADGFYGHGSVVEEQVLEMVQREVE 129


>UniRef50_Q4DS09 Cluster: Zeta tubulin, putative; n=4;
           Trypanosoma|Rep: Zeta tubulin, putative - Trypanosoma
           cruzi
          Length = 480

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           R VL+D +P  + AV       L R +N ++GQ+   N+WA G+Y
Sbjct: 44  RCVLVDSEPKVVTAVYERQKDVL-RAENVIHGQSGRGNHWALGYY 87


>UniRef50_Q3SEH3 Cluster: Beta_tubulin,putative; n=4; Paramecium
           tetraurelia|Rep: Beta_tubulin,putative - Paramecium
           tetraurelia
          Length = 439

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWE 195
           MREI+ LQ+G  GN++G KFWE
Sbjct: 1   MREILVLQLGGFGNKMGVKFWE 22


>UniRef50_Q3SEG6 Cluster: Beta_tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Beta_tubulin,putative - Paramecium
           tetraurelia
          Length = 435

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 14/31 (45%), Positives = 24/31 (77%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGID 222
           MREII++ +G+CG +IG KF+E +  ++ I+
Sbjct: 1   MREIIHIGLGNCGVRIGCKFYEQLIQDYQIE 31


>UniRef50_Q8AVA7 Cluster: Cryptic tubulin; n=3; Tetrapoda|Rep:
           Cryptic tubulin - Xenopus laevis (African clawed frog)
          Length = 423

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 11/21 (52%), Positives = 18/21 (85%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVI 201
           ++ LQVG CGNQIG ++W+++
Sbjct: 3   LVWLQVGQCGNQIGQEWWQIV 23


>UniRef50_Q4XML3 Cluster: Delta tubulin, putative; n=5; Plasmodium
           (Vinckeia)|Rep: Delta tubulin, putative - Plasmodium
           chabaudi
          Length = 709

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +3

Query: 381 FRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           +  +N +YG N + NNW+ G       I E  +++I +E E
Sbjct: 241 YNKNNVIYGLNGSGNNWSYGFNVHAKNICEDFINLINKELE 281


>UniRef50_Q4QCZ3 Cluster: Zeta tubulin, putative; n=2;
           Leishmania|Rep: Zeta tubulin, putative - Leishmania
           major
          Length = 605

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHY 446
           R +L+D +P  +  V+        R +N +YGQ+   NNW  G+Y
Sbjct: 56  RCILVDTEPKVVLGVQQR-HPDFIRAENVIYGQSGRGNNWGLGYY 99


>UniRef50_UPI0000D5556D Cluster: PREDICTED: similar to
           epsilon-tubulin 1; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to epsilon-tubulin 1 - Tribolium
           castaneum
          Length = 432

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGI 219
           M E I +QVG CGNQIG      I  E+G+
Sbjct: 1   MSEFIVIQVGQCGNQIGSFLLPEILQEYGV 30


>UniRef50_Q5VRE3 Cluster: Putative uncharacterized protein
           OSJNBa0033B09.31; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0033B09.31 - Oryza sativa subsp. japonica (Rice)
          Length = 85

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 14/22 (63%), Positives = 19/22 (86%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSP 646
           +++IREEYPDR++LTFS   SP
Sbjct: 6   ISKIREEYPDRMMLTFSEKFSP 27


>UniRef50_Q2A9A4 Cluster: Putative uncharacterized protein; n=2;
           Brassica oleracea|Rep: Putative uncharacterized protein
           - Brassica oleracea (Wild cabbage)
          Length = 237

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = -3

Query: 410 LSVDEIVRSE*ASEGSRPHRVHRGRLQVDKNRARNIFPSRCLVVVHVDPFELRSESP 240
           LS DEI     +  G+RP R  R R +  +     IFP  CLV ++ D F + S SP
Sbjct: 163 LSRDEIEEDVFSMSGNRPSRRPRKRTKTLQKHLDVIFPGLCLVGMNADCFRV-STSP 218


>UniRef50_Q3SEG5 Cluster: Alpha tubulin,putative; n=1; Paramecium
           tetraurelia|Rep: Alpha tubulin,putative - Paramecium
           tetraurelia
          Length = 405

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           E ++  + E S   Y PR++ ++    T+D          F P+ F Y +    N +  G
Sbjct: 30  EDLSSIFQENSHQSYKPRSIFVN----TIDDQVPKYDEPQFSPNQFFYTKEDTGNIYTVG 85

Query: 441 HYTEGVEILESALDVIRREAE 503
           HY    +++    D IRR+ E
Sbjct: 86  HYCVAKDLIPKIQDEIRRQVE 106


>UniRef50_A1CSU2 Cluster: Guanyl-nucleotide exchange factor,
           putative; n=7; Trichocomaceae|Rep: Guanyl-nucleotide
           exchange factor, putative - Aspergillus clavatus
          Length = 1424

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 23/83 (27%), Positives = 32/83 (38%), Gaps = 1/83 (1%)
 Frame = +2

Query: 134 GKLSISRSVLVETKSAESSGR*YLTSTASIQADATTATPTSTRKDQRVLQRGIGWEICSS 313
           G  +   ++     S E  GR   TS  S   D  T +  S+  D R  +     +    
Sbjct: 207 GSYTTDATLSTSKMSGEEPGRLSTTSIRSGGRDPGTESQRSSVADARCSESSRSDQSSGD 266

Query: 314 HGSYRLEAGHDGRG-EVGTLRMP 379
           HG Y   + H+G G E    RMP
Sbjct: 267 HGGYHTHSPHEGAGSETKRFRMP 289


>UniRef50_Q2XVP6 Cluster: Beta 5-tubulin; n=2; Eutheria|Rep: Beta
           5-tubulin - Sus scrofa (Pig)
          Length = 17

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIG 180
           MREI+++Q G CGNQIG
Sbjct: 1   MREIVHIQAGQCGNQIG 17


>UniRef50_A0BY58 Cluster: Chromosome undetermined scaffold_136,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_136,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 875

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = +3

Query: 72  LAF*SKFTSICDEKSIN*QDEGNYQSPGRFL-WKPNRRKVLGGDI*RARHRSKRMLPRRL 248
           + F  KF +I   K +  QD+ +      FL +KPN+  +L   I   + R  +   RRL
Sbjct: 540 IVFQEKF-NIIGRKCMCCQDQNHLIQNCPFLHYKPNKDIILSKFIFPVKMRRNKYERRRL 598

Query: 249 RPQLERINVYYNEASAGKYVPRTVLIDLK 335
           R Q   IN ++N   A +Y     LI+++
Sbjct: 599 RYQNVLINQFFNHMRAQEYQENNDLINIE 627


>UniRef50_UPI00006CCC73 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +3

Query: 276 YYNEASAG-KYVPRTVLIDLKPATMDAVRSGPFGCL--FRPDNFVYGQNCAANNWAKGHY 446
           Y  E  +G K   +++LID++P  + +  +     +  F P N    Q  + NNWA G+ 
Sbjct: 44  YQKEEKSGVKNYAKSLLIDMEPKVVQSCLNSHQNDVWEFDPTNCFTQQEGSGNNWAYGYN 103

Query: 447 TEGVEILESALDVIRREAE 503
             G++  +  L   ++  E
Sbjct: 104 VHGLKCRDKILQTFQKLLE 122


>UniRef50_A1UNB8 Cluster: Putative uncharacterized protein; n=6;
           Mycobacterium|Rep: Putative uncharacterized protein -
           Mycobacterium sp. (strain KMS)
          Length = 163

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 1/108 (0%)
 Frame = +2

Query: 113 IDKLTR*GKLSISRSVLVETKSAESSGR*YLTSTASIQADATTATPTSTRKDQRVLQRGI 292
           +D   R G++S+ R  LV+  SAE  GR     TA +              D+ ++Q+G+
Sbjct: 15  LDLAPRRGEVSLPR--LVQAVSAER-GRPIDIKTAELPPGVCGQWRQYADHDEFLIQQGL 71

Query: 293 -GWEICSSHGSYRLEAGHDGRGEVGTLRMPIQTGQFRLRTKLCGQQLG 433
             W+   +H    L  GH+G G V   R   +     L   +  Q+ G
Sbjct: 72  PAWDRTLAHELGHLVLGHEGIGVVQAARQSTEVASSELIGYMLNQRTG 119


>UniRef50_Q7X8G8 Cluster: OSJNBb0016D16.22 protein; n=4; Oryza
            sativa|Rep: OSJNBb0016D16.22 protein - Oryza sativa
            (Rice)
          Length = 1498

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
 Frame = +2

Query: 218  SIQADATTATP--TSTRKDQRVLQRGIGWEICSSHGSYRLEAGHDG 349
            S  A A+TATP  TST    RV +  +G+    SH   R++A HDG
Sbjct: 900  SPHAPASTATPPGTSTPTPARVERSPVGFVTPLSHDGERIDAYHDG 945


>UniRef50_Q24HJ8 Cluster: Tubulin/FtsZ family, GTPase domain
           containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Tubulin/FtsZ family, GTPase domain containing
           protein - Tetrahymena thermophila SB210
          Length = 447

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           M  I+++ +G CG  I  K W  +  E+GID  G
Sbjct: 1   MSSIVSIAIGQCGISIQEKQWITLLQEYGIDECG 34


>UniRef50_O44453 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 344

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = -3

Query: 452 FSVVSLR-PVVGR---TVLSVDEIVRSE*ASEGSRPHRVHRGRLQVDKNRARNIFPSRCL 285
           FSV+ +R P   +   T++S DEIV  E   E S    VH+ ++ +D  R RN    RCL
Sbjct: 215 FSVLIMRNPCTSKNAFTLISADEIVHHESTDEKSPLKIVHKSKIMLDIRR-RNDAIRRCL 273

Query: 284 VVVHV 270
           ++  V
Sbjct: 274 LLATV 278


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 683,152,279
Number of Sequences: 1657284
Number of extensions: 13743453
Number of successful extensions: 38671
Number of sequences better than 10.0: 122
Number of HSP's better than 10.0 without gapping: 36981
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38643
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54545459628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -