SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P32100 Cluster: 60S ribosomal protein L7; n=39; Fungi/M...   105   1e-21
UniRef50_P18124 Cluster: 60S ribosomal protein L7; n=124; Eukary...   102   7e-21
UniRef50_Q6F439 Cluster: Ribosomal protein L7; n=2; Coelomata|Re...   102   9e-21
UniRef50_UPI0000DA2F9D Cluster: PREDICTED: similar to 60S riboso...    88   2e-16
UniRef50_Q7SBD5 Cluster: 60S ribosomal protein L7; n=5; Eukaryot...    87   3e-16
UniRef50_P17937 Cluster: 60S ribosomal protein L7-A; n=3; Ascomy...    78   2e-13
UniRef50_UPI00004988A2 Cluster: 60S ribosomal protein L7; n=5; E...    77   3e-13
UniRef50_Q5CVE6 Cluster: 60S ribosomal protein L7; n=2; Cryptosp...    77   5e-13
UniRef50_Q7QZV2 Cluster: GLP_609_14821_14114; n=1; Giardia lambl...    75   1e-12
UniRef50_Q4Q9H4 Cluster: 60S ribosomal protein L7, putative; n=9...    73   6e-12
UniRef50_Q6DKI1 Cluster: Ribosomal protein L7-like 1; n=40; Eute...    73   8e-12
UniRef50_Q12213 Cluster: 60S ribosomal protein L7-B; n=46; Eukar...    71   3e-11
UniRef50_A7R8B0 Cluster: Chromosome undetermined scaffold_2403, ...    69   8e-11
UniRef50_O97250 Cluster: 60S ribosomal protein L7, putative; n=6...    69   1e-10
UniRef50_Q22G42 Cluster: Ribosomal protein L30p/L7e containing p...    69   1e-10
UniRef50_Q6CS71 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    69   1e-10
UniRef50_A2F592 Cluster: Ribosomal protein L30p/L7e, putative; n...    66   7e-10
UniRef50_Q98S26 Cluster: 60S ribosomal protein L7; n=1; Guillard...    63   5e-09
UniRef50_A0DG29 Cluster: Chromosome undetermined scaffold_5, who...    63   7e-09
UniRef50_Q6BIF5 Cluster: Ribosome biogenesis protein RLP7; n=2; ...    57   3e-07
UniRef50_P32101 Cluster: Ribosome biogenesis protein RLP7; n=1; ...    55   2e-06
UniRef50_Q173X9 Cluster: Putative uncharacterized protein; n=4; ...    53   5e-06
UniRef50_Q8SS93 Cluster: 60S ribosomal protein L7; n=1; Encephal...    52   2e-05
UniRef50_Q0IFE6 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_Q24DI0 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_P40693 Cluster: Ribosome biogenesis protein RLP7; n=5; ...    50   4e-05
UniRef50_Q75ET5 Cluster: Ribosome biogenesis protein RLP7; n=1; ...    50   5e-05
UniRef50_Q0IGW8 Cluster: LP23547p; n=1; Drosophila melanogaster|...    50   7e-05
UniRef50_Q9SAI5 Cluster: 60S ribosomal protein L7-1; n=7; Magnol...    49   9e-05
UniRef50_Q8SYU2 Cluster: RE33833p; n=4; Sophophora|Rep: RE33833p...    45   0.002
UniRef50_Q59V85 Cluster: Potential L7-like nucleolar rRNA matura...    44   0.003
UniRef50_A0EE92 Cluster: Chromosome undetermined scaffold_91, wh...    44   0.003
UniRef50_Q7QJS3 Cluster: ENSANGP00000021545; n=1; Anopheles gamb...    43   0.008
UniRef50_UPI0000F1D986 Cluster: PREDICTED: similar to ribosomal ...    41   0.031
UniRef50_A5BPY1 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_UPI0001554D2F Cluster: PREDICTED: hypothetical protein,...    40   0.072
UniRef50_Q00U40 Cluster: Chromosome 16 contig 1, DNA sequence; n...    40   0.072
UniRef50_Q3A6X8 Cluster: Putative iron-sulfur cluster-like prote...    35   2.0  
UniRef50_A2DSI8 Cluster: Ribosomal protein, putative; n=1; Trich...    35   2.0  
UniRef50_Q4UAQ1 Cluster: 60S ribosomal protein l7-a, putative; n...    34   2.7  
UniRef50_Q7YY85 Cluster: Cytohesin-like protein, possible; n=5; ...    34   3.6  
UniRef50_Q82BZ0 Cluster: Sensor protein; n=1; Streptomyces averm...    33   4.7  

>UniRef50_P32100 Cluster: 60S ribosomal protein L7; n=39;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L7 -
           Drosophila melanogaster (Fruit fly)
          Length = 252

 Score =  105 bits (251), Expect = 1e-21
 Identities = 56/92 (60%), Positives = 66/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQLFRLRQINNGVF++LNKAT+NMLRIAEPYI WGYPNLKSVREL+        V
Sbjct: 107 KVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIY---KRGFV 163

Query: 535 DNVYQSLPT----ALLRRGFHKHNIICVEDLI 618
            +  Q +P      + R+    H I CVEDL+
Sbjct: 164 KHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 195



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = +2

Query: 287 YYVPGEAKLAFVIRIRGINQVSPK 358
           +YVP EAKLAFV+RIRGIN+V+PK
Sbjct: 84  FYVPAEAKLAFVVRIRGINKVAPK 107



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 27/69 (39%), Positives = 35/69 (50%)
 Frame = +3

Query: 48  PVKGKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           PV  K  +KKLPAVPES LK             +  LK+ +    +K+E   RAE+Y  E
Sbjct: 4   PVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNE 63

Query: 228 YRIKERDEI 254
           Y   E+ EI
Sbjct: 64  YIKAEQREI 72



 Score = 34.3 bits (75), Expect = 2.7
 Identities = 14/16 (87%), Positives = 14/16 (87%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEIFTVG  FKYASNF
Sbjct: 196 HEIFTVGPNFKYASNF 211


>UniRef50_P18124 Cluster: 60S ribosomal protein L7; n=124;
           Eukaryota|Rep: 60S ribosomal protein L7 - Homo sapiens
           (Human)
          Length = 248

 Score =  102 bits (245), Expect = 7e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.67
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69


>UniRef50_Q6F439 Cluster: Ribosomal protein L7; n=2; Coelomata|Rep:
           Ribosomal protein L7 - Plutella xylostella (Diamondback
           moth)
          Length = 213

 Score =  102 bits (244), Expect = 9e-21
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 48  PVKGKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           PVKGKEDSKKLPAVPESVLKH           +QVTLKRR++A+KK++ IFKRAE YVKE
Sbjct: 9   PVKGKEDSKKLPAVPESVLKHRKRREALRTRRVQVTLKRRTAALKKRKTIFKRAEAYVKE 68

Query: 228 YRIKERDEI 254
           YRI+ERDEI
Sbjct: 69  YRIRERDEI 77



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 33/42 (78%), Positives = 37/42 (88%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYP 480
           +VRKVLQ+FR+RQINNGVFVRLNKATVNM+RIAEP    G P
Sbjct: 112 KVRKVLQVFRVRQINNGVFVRLNKATVNMMRIAEPLHHVGVP 153



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPK 358
           GNYYVPGEAKLAFVIRIRGINQVSPK
Sbjct: 87  GNYYVPGEAKLAFVIRIRGINQVSPK 112


>UniRef50_UPI0000DA2F9D Cluster: PREDICTED: similar to 60S ribosomal
           protein L7; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 60S ribosomal protein L7 - Rattus norvegicus
          Length = 389

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VRKVLQL RL+QI NG FV+LNKA+VNMLRI EPYIAWGYPNLKSV +L+
Sbjct: 337 KVRKVLQLLRLQQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNKLI 387



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 312 GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 345


>UniRef50_Q7SBD5 Cluster: 60S ribosomal protein L7; n=5;
           Eukaryota|Rep: 60S ribosomal protein L7 - Neurospora
           crassa
          Length = 248

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 42/86 (48%), Positives = 56/86 (65%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           RK+LQL RL QINNGVFVR+ KAT  M++I EP++A+GYPNLKSV+EL+           
Sbjct: 105 RKILQLLRLLQINNGVFVRVTKATAEMIKIVEPWVAYGYPNLKSVKELIYKRGYGKVNKQ 164

Query: 541 VYQSLPTALLRRGFHKHNIICVEDLI 618
                  +++     K+ IIC+EDLI
Sbjct: 165 RVALTDNSIIEENLGKYGIICMEDLI 190



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 17/34 (50%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G++++P EAKL F+IRI+GIN++ PK  K    L
Sbjct: 78  GSFHIPAEAKLIFLIRIKGINKIPPKPRKILQLL 111



 Score = 41.9 bits (94), Expect = 0.013
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKRE-IFKRAEQYVKEYRIKERDEI 254
           VPE++LK             Q  ++++ +A K+KR  IFKRAE YVKEYR  ER++I
Sbjct: 13  VPETLLKKRKSQEKARAER-QAEIEKKKAANKEKRAVIFKRAETYVKEYRDVEREKI 68


>UniRef50_P17937 Cluster: 60S ribosomal protein L7-A; n=3;
           Ascomycota|Rep: 60S ribosomal protein L7-A -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 249

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/88 (45%), Positives = 53/88 (60%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           ++RKVL+L RL +INN VFVR NKA   MLRI EPY+ +G PNL SVREL+         
Sbjct: 104 KIRKVLRLLRLSRINNAVFVRNNKAVAQMLRIVEPYVMYGIPNLHSVRELIYKRGFGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+     K+++I +ED+I
Sbjct: 164 GQRIALSDNALIEEALGKYDVISIEDII 191



 Score = 36.7 bits (81), Expect = 0.51
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  PESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           PE +LK            ++  + ++ +  K ++E FKRAE ++  YR +ER+ I
Sbjct: 15  PEVLLKKRKVNERTRKERVEQAIAKKEAQKKNRKETFKRAETFINNYRQRERERI 69



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G+ +VP E KL FVIRI G+  + PK  K    L
Sbjct: 79  GDIFVPDETKLLFVIRIAGVKNMPPKIRKVLRLL 112


>UniRef50_UPI00004988A2 Cluster: 60S ribosomal protein L7; n=5;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L7 - Entamoeba histolytica HM-1:IMSS
          Length = 230

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 30/88 (34%), Positives = 58/88 (65%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +++K+L+L RLRQINN VF++ N +T+ MLR+ +PY+ +GYP L++V++L+    +    
Sbjct: 86  KIKKILKLLRLRQINNAVFIKANASTIKMLRLVDPYVTYGYPTLETVQKLIYKRGALKIN 145

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
            N        ++++     +++CV+DL+
Sbjct: 146 GNRMPITSNCMIKKALGDKDVVCVDDLV 173



 Score = 34.3 bits (75), Expect = 2.7
 Identities = 17/34 (50%), Positives = 19/34 (55%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G+ Y   + KL   IRIRGIN VSPK  K    L
Sbjct: 61  GDLYAEADPKLIVAIRIRGINGVSPKIKKILKLL 94


>UniRef50_Q5CVE6 Cluster: 60S ribosomal protein L7; n=2;
           Cryptosporidium|Rep: 60S ribosomal protein L7 -
           Cryptosporidium parvum Iowa II
          Length = 251

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 30/51 (58%), Positives = 45/51 (88%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VRK+ QLFRLRQINNGVF+ LNKAT+ ML++ +P++A+GYP++  +R+L+
Sbjct: 101 KVRKIFQLFRLRQINNGVFLPLNKATIEMLKVIDPFVAYGYPSISMIRKLL 151



 Score = 37.5 bits (83), Expect = 0.29
 Identities = 15/26 (57%), Positives = 20/26 (76%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPK 358
           G  Y P E K+ FVIR++GIN++SPK
Sbjct: 76  GGLYRPAEPKVVFVIRLKGINKLSPK 101


>UniRef50_Q7QZV2 Cluster: GLP_609_14821_14114; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_609_14821_14114 - Giardia lamblia
           ATCC 50803
          Length = 235

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 36/88 (40%), Positives = 52/88 (59%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VR +L L RLRQINN VF+R NKAT+N LRI + Y+ +G P ++++R L+         
Sbjct: 93  KVRTILSLLRLRQINNAVFMRCNKATLNALRIVDHYVTYGEPTVETIRNLIYKRGFAKVN 152

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                 +   L+     KHNI+C EDL+
Sbjct: 153 GQRIPIVDNNLIDEQLSKHNILCAEDLV 180


>UniRef50_Q4Q9H4 Cluster: 60S ribosomal protein L7, putative; n=9;
           Trypanosomatidae|Rep: 60S ribosomal protein L7, putative
           - Leishmania major
          Length = 252

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 36/86 (41%), Positives = 53/86 (61%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           RK+LQL RLRQI N VFV++NK   NMLR  EPYIA+GYP+L +VR +V           
Sbjct: 110 RKILQLLRLRQIFNTVFVKMNKPMENMLRAVEPYIAYGYPSLATVRAMVYKRGYLKINGQ 169

Query: 541 VYQSLPTALLRRGFHKHNIICVEDLI 618
             +     +++  ++  +I+C ED++
Sbjct: 170 RVKITDNQMIKDKYNNVDIVCAEDMV 195



 Score = 37.1 bits (82), Expect = 0.38
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GNYY+  + K+A V RIRGI +V+PK  K    L
Sbjct: 83  GNYYLEAKPKVAVVTRIRGIAKVNPKQRKILQLL 116


>UniRef50_Q6DKI1 Cluster: Ribosomal protein L7-like 1; n=40;
           Euteleostomi|Rep: Ribosomal protein L7-like 1 - Homo
           sapiens (Human)
          Length = 246

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           V++ +   RL++I +GVFV++    + MLRI EPY+ WG+PNLKSVREL+         +
Sbjct: 103 VQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKN 162

Query: 538 NVYQSLPTALLRRGFHKHNIICVEDLI 618
                    ++     K  +IC+EDLI
Sbjct: 163 KTIPLTDNTVIEEHLGKFGVICLEDLI 189


>UniRef50_Q12213 Cluster: 60S ribosomal protein L7-B; n=46;
           Eukaryota|Rep: 60S ribosomal protein L7-B -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 244

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           RKVLQL RL +IN+G FV++ KAT+ +L++ EPY+A+GYP+  ++R+LV           
Sbjct: 100 RKVLQLLRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQ 159

Query: 541 VYQSLPTALLRRGFHKHNIICVEDLI 618
                  A++     K+ I+ ++DLI
Sbjct: 160 RVPLSDNAIIEANLGKYGILSIDDLI 185



 Score = 40.3 bits (90), Expect = 0.041
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G+YYV  + KL FV+RI+GIN++ PK  K    L
Sbjct: 73  GSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLL 106


>UniRef50_A7R8B0 Cluster: Chromosome undetermined scaffold_2403,
           whole genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_2403, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 130

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 29/45 (64%), Positives = 38/45 (84%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLK 489
           + RK+LQL RLRQ+ NGVF+++NKAT+NML   EPY+ +GYPNLK
Sbjct: 42  KTRKILQLLRLRQMFNGVFLKVNKATMNMLHRVEPYVTYGYPNLK 86



 Score = 39.9 bits (89), Expect = 0.054
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           G +YV  E KL F+IRIRGIN + PK+ K    L
Sbjct: 17  GGFYVDPEVKLLFIIRIRGINAMHPKTRKILQLL 50


>UniRef50_O97250 Cluster: 60S ribosomal protein L7, putative; n=6;
           Plasmodium|Rep: 60S ribosomal protein L7, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 257

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 29/51 (56%), Positives = 41/51 (80%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VR V +L RL Q++NGVFV++NKAT  ML+I EPY+ +GYP L +VR+L+
Sbjct: 107 KVRSVFRLLRLLQVHNGVFVKVNKATKEMLKIVEPYVTYGYPTLSTVRKLL 157


>UniRef50_Q22G42 Cluster: Ribosomal protein L30p/L7e containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal protein L30p/L7e containing protein -
           Tetrahymena thermophila SB210
          Length = 386

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +V++VL+LFRLRQ++NG F R+NKA++NM++   P+I +GYP   ++ +L+         
Sbjct: 242 DVKRVLRLFRLRQLHNGAFFRVNKASLNMIKRVLPFITFGYPTRNTISKLIYKRGFAKVN 301

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                     ++ +   K  I CVEDLI
Sbjct: 302 GQRIPLTDNTIVEKSLGKFGITCVEDLI 329



 Score = 37.1 bits (82), Expect = 0.38
 Identities = 16/23 (69%), Positives = 18/23 (78%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQV 349
           G +YVP EAK+AF IRIRG  QV
Sbjct: 179 GAFYVPAEAKVAFAIRIRGYKQV 201


>UniRef50_Q6CS71 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=2; Saccharomycetaceae|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome D of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 255

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 29/49 (59%), Positives = 40/49 (81%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           RKVLQL RL QIN+G FV++ KAT  +L++ EPY+A+GYP+  +VR+LV
Sbjct: 111 RKVLQLLRLNQINSGTFVKVTKATSELLKLIEPYVAYGYPSYSTVRQLV 159



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +2

Query: 284 NYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           +YYV  EAKL FV+RI+GIN++ PK  K    L
Sbjct: 85  SYYVSAEAKLVFVVRIKGINKIPPKPRKVLQLL 117



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +3

Query: 471 GIPQLKECP*VSIKRGFAKLSGQRIPITSNSIVEKRL 581
           G P       +  KRG+ K++ QRIP++ NSIVE  L
Sbjct: 148 GYPSYSTVRQLVYKRGYGKINKQRIPLSDNSIVEANL 184


>UniRef50_A2F592 Cluster: Ribosomal protein L30p/L7e, putative; n=2;
           Trichomonas vaginalis G3|Rep: Ribosomal protein
           L30p/L7e, putative - Trichomonas vaginalis G3
          Length = 239

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 28/51 (54%), Positives = 40/51 (78%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VRK+L LFRL Q +N +FVRLNKAT+ ML+   P +A+GYP++  VR+L+
Sbjct: 95  DVRKILHLFRLNQKHNAIFVRLNKATIEMLKRVTPQVAFGYPSVDMVRKLI 145



 Score = 37.1 bits (82), Expect = 0.38
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSP 355
           G +YVP EAK AFVIR +G N++ P
Sbjct: 70  GAFYVPAEAKFAFVIRTKGTNKLHP 94


>UniRef50_Q98S26 Cluster: 60S ribosomal protein L7; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L7 - Guillardia theta
           (Cryptomonas phi)
          Length = 247

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/90 (35%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD- 537
           +K+L+L RL  ++ GVF+++NK+ + +L+  EPY+A+GYP++K+VR L+           
Sbjct: 99  KKILKLLRLNNVHAGVFLKINKSILKILQYIEPYVAYGYPSIKNVRSLIMKKGFLKLGSR 158

Query: 538 NVYQSLPTA---LLRRGFHKHNIICVEDLI 618
             Y  +  A   L+ + F K  I C EDL+
Sbjct: 159 GHYNKISIANDVLIEQRFKKIGISCTEDLV 188


>UniRef50_A0DG29 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=8; Alveolata|Rep: Chromosome
           undetermined scaffold_5, whole genome shotgun sequence -
           Paramecium tetraurelia
          Length = 329

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 24/51 (47%), Positives = 39/51 (76%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VR+ L+L +LRQ++N  FVR+NKAT+ M+R  EPY+ +GYP+   ++ L+
Sbjct: 185 QVRQTLRLLKLRQLHNAAFVRVNKATIEMIRKVEPYVTYGYPSRAVIKNLI 235



 Score = 40.7 bits (91), Expect = 0.031
 Identities = 16/24 (66%), Positives = 23/24 (95%)
 Frame = +3

Query: 510 KRGFAKLSGQRIPITSNSIVEKRL 581
           KRG+AK++GQRIPIT+N+I+E+ L
Sbjct: 237 KRGYAKINGQRIPITNNNIIEQSL 260



 Score = 39.1 bits (87), Expect = 0.095
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPK 358
           G +YVP E+KL  V+RIRGIN ++P+
Sbjct: 160 GGFYVPAESKLILVVRIRGINTLNPQ 185


>UniRef50_Q6BIF5 Cluster: Ribosome biogenesis protein RLP7; n=2;
           Saccharomycetaceae|Rep: Ribosome biogenesis protein RLP7
           - Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 275

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +1

Query: 352 TEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVREL------VSN 513
           ++ RKVL L RL + N GVFV+L  ATV +L++  PYI  G P+L S+R+L      +S 
Sbjct: 111 SKARKVLHLLRLNRPNTGVFVKLTPATVPLLKLISPYIVAGKPSLNSIRKLFQKRACISV 170

Query: 514 VDSPS*VDNVYQSLPTALLRRGFHKH-NIICVEDLI 618
           +D  +    + +     ++   F      IC+EDLI
Sbjct: 171 IDEETKEPRITKLDNNGVVEDKFGDDLGCICIEDLI 206


>UniRef50_P32101 Cluster: Ribosome biogenesis protein RLP7; n=1;
           Pichia jadinii|Rep: Ribosome biogenesis protein RLP7 -
           Pichia jadinii (Yeast) (Candida utilis)
          Length = 212

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +1

Query: 352 TEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS* 531
           ++V+KVLQL RL +IN+GVFV+L +    +L++  PY     P+L++VR+LV    + + 
Sbjct: 48  SKVQKVLQLLRLNKINSGVFVKLTETVYPLLKLLSPYTVIXQPSLQTVRQLVQKRATVT- 106

Query: 532 VDNVYQSLP-------TALLRRGFHKHNIICVEDLI 618
           V +     P         L+        IIC+ED+I
Sbjct: 107 VTHANDEEPRQVKLNDNNLVEEKLGDEGIICIEDII 142


>UniRef50_Q173X9 Cluster: Putative uncharacterized protein; n=4;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 214

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 30/51 (58%), Positives = 37/51 (72%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           ++ K LQLFRLRQIN+  F++LNKAT   +RIAE Y   G P LKSVR L+
Sbjct: 84  KICKELQLFRLRQINDATFIKLNKAT--KMRIAERY---GNPTLKSVRYLI 129


>UniRef50_Q8SS93 Cluster: 60S ribosomal protein L7; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L7 -
           Encephalitozoon cuniculi
          Length = 239

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/51 (49%), Positives = 39/51 (76%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +VRKVL+LFRL++IN  V VR NK+T  ML+I + ++A+G   ++ +R+LV
Sbjct: 96  KVRKVLELFRLKRINTCVLVRNNKSTRKMLQIIKDHVAFGTIGMELLRKLV 146


>UniRef50_Q0IFE6 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 252

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 32/93 (34%), Positives = 47/93 (50%), Gaps = 5/93 (5%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV--SNVDSPS 528
           EV  +L    L      V ++L +    ML++ EP+I WGYPN+ +VRELV    +  P 
Sbjct: 101 EVMHILAKLGLPYKRRAVLLKLTEGVHAMLKMVEPWIIWGYPNIATVRELVYKYGLFKPE 160

Query: 529 *VDNVYQSLPTA---LLRRGFHKHNIICVEDLI 618
             +   + +P A    +   F    IICVEDL+
Sbjct: 161 QGEKGPKKIPIASNKQVEEKFGHLGIICVEDLL 193


>UniRef50_Q24DI0 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 333

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 20/51 (39%), Positives = 34/51 (66%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           E  K+L+LF+L  IN+  F+++N A +  L+  E Y+ +GYP+ K + EL+
Sbjct: 187 EQTKILRLFKLPTINSATFIKMNTANLRRLKRVENYVTYGYPSRKVISELI 237


>UniRef50_P40693 Cluster: Ribosome biogenesis protein RLP7; n=5;
           Saccharomycetales|Rep: Ribosome biogenesis protein RLP7
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 322

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 6/91 (6%)
 Frame = +1

Query: 364 KVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSN----VDSPS* 531
           K+L L RL + N GVFV+L K    +L++  PY+  G P+L S+R L+      +     
Sbjct: 161 KILSLLRLVETNTGVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGEN 220

Query: 532 VDNVYQSL--PTALLRRGFHKHNIICVEDLI 618
               ++ +     ++      H IICVED+I
Sbjct: 221 EAEPHEIVLNDNNIVEEQLGDHGIICVEDII 251


>UniRef50_Q75ET5 Cluster: Ribosome biogenesis protein RLP7; n=1;
           Eremothecium gossypii|Rep: Ribosome biogenesis protein
           RLP7 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 293

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           +  +VL L RL ++N GVFVRL      +L++  PY+  G P+L S+R LV
Sbjct: 129 KAHRVLTLLRLAEVNTGVFVRLTAEVFPLLQVVAPYVVVGRPSLASIRALV 179


>UniRef50_Q0IGW8 Cluster: LP23547p; n=1; Drosophila
           melanogaster|Rep: LP23547p - Drosophila melanogaster
           (Fruit fly)
          Length = 227

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -1

Query: 483 VGVSPSNVRLGDT*HIHSSLIQTYKHTIVYLAQSKQLQNFTDFG 352
           +G++P +V LGD  H+   L+Q  +HT+V L Q++QLQN  D G
Sbjct: 48  IGIAPGDVGLGDAQHVDGGLVQLDEHTVVDLPQTEQLQNLADLG 91


>UniRef50_Q9SAI5 Cluster: 60S ribosomal protein L7-1; n=7;
           Magnoliophyta|Rep: 60S ribosomal protein L7-1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 247

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 22/88 (25%), Positives = 44/88 (50%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           + +++L   +L+ +  GVF +   +    L   +PY+ +GYPN KSV++L+         
Sbjct: 102 KTKRILNNLQLKSVFTGVFAKATDSLFQKLLKVQPYVTYGYPNDKSVKDLIYKKGCTIIE 161

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
            N        ++ +   +H I+ +EDL+
Sbjct: 162 GNPVPLTDNNIIEQALGEHKILGIEDLV 189



 Score = 33.5 bits (73), Expect = 4.7
 Identities = 44/186 (23%), Positives = 71/186 (38%), Gaps = 12/186 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +E++K L  +PE VLK             +      S   KKK    KR E +V E+R K
Sbjct: 3   EEEAKGLDYIPEIVLKKRKNRDELAFIRKKQLELGNSGKKKKKVSDIKRPEDFVHEFRAK 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           E D I              P K  +V      GK + H  ++ +++    +S  +     
Sbjct: 63  EVDMIRMKQRVKRPKSSPPPVKSDLVFIIRIQGKNDMHPKTKRILNNLQLKSVFTGVFAK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
              +    +   +     Y TY       G P  K    +  K+G   + G  +P+T N+
Sbjct: 123 ATDSLFQKLLKVQ----PYVTY-------GYPNDKSVKDLIYKKGCTIIEGNPVPLTDNN 171

Query: 564 IVEKRL 581
           I+E+ L
Sbjct: 172 IIEQAL 177


>UniRef50_Q8SYU2 Cluster: RE33833p; n=4; Sophophora|Rep: RE33833p -
           Drosophila melanogaster (Fruit fly)
          Length = 257

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>UniRef50_Q59V85 Cluster: Potential L7-like nucleolar rRNA
           maturation factor; n=3; Saccharomycetales|Rep: Potential
           L7-like nucleolar rRNA maturation factor - Candida
           albicans (Yeast)
          Length = 295

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +1

Query: 352 TEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVREL 504
           ++V K+L+  +L  +N G FV+ +  T++ L+   PY+  G P+L S+R+L
Sbjct: 110 SKVYKILKDLKLTSVNTGTFVKADSQTMDSLKFIAPYVLVGQPSLTSIRKL 160


>UniRef50_A0EE92 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 387

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/86 (25%), Positives = 42/86 (48%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           +K+L+  RL ++N  VFVR +      L++ E YI +G P  + + +L+           
Sbjct: 243 QKILKELRLNKVNTAVFVRTSVDIWRKLKLVENYITYGLPTRQIINDLIVKRGHIMKDKE 302

Query: 541 VYQSLPTALLRRGFHKHNIICVEDLI 618
           +       ++     + +IICVED++
Sbjct: 303 IIALKSNEIIEEYMSEKDIICVEDIV 328


>UniRef50_Q7QJS3 Cluster: ENSANGP00000021545; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000021545 - Anopheles gambiae
           str. PEST
          Length = 248

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELV 507
           EV K      L+   +    RL    +  L++ EP++ WGYPN+  VREL+
Sbjct: 103 EVMKTFVRLGLQHQRSATLHRLTPEIIAQLKVVEPFVIWGYPNISVVRELL 153


>UniRef50_UPI0000F1D986 Cluster: PREDICTED: similar to ribosomal
           protein L7; n=1; Danio rerio|Rep: PREDICTED: similar to
           ribosomal protein L7 - Danio rerio
          Length = 100

 Score = 40.7 bits (91), Expect = 0.031
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +3

Query: 63  EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYR 233
           E  KK+P+VPES+LK            L+     + ++   ++ IFKRAE Y KEY+
Sbjct: 4   ETKKKIPSVPESLLKRRQRFAAIRAVRLKKAKADKKASKVTRKLIFKRAEAYHKEYK 60


>UniRef50_A5BPY1 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 203

 Score = 40.7 bits (91), Expect = 0.031
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +3

Query: 468 LGIPQLKECP*VSIKRGFAKLSGQRIPITSNSIVEKRL 581
           L  P LK    +  K+GFAK+ GQ++P+T N+I+E+ L
Sbjct: 97  LRYPNLKNVRELIYKKGFAKIEGQKVPLTDNNIIEQAL 134



 Score = 34.3 bits (75), Expect = 2.7
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 475 YPNLKSVRELVSNVDSPS*VDNVYQSLPTALLRRGFHKHNIICVEDLI 618
           YPNLK+VREL+                   ++ +   KH I+C+ED++
Sbjct: 99  YPNLKNVRELIYKKGFAKIEGQKVPLTDNNIIEQALGKHGIMCIEDIV 146


>UniRef50_UPI0001554D2F Cluster: PREDICTED: hypothetical protein,
           partial; n=2; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 193

 Score = 39.5 bits (88), Expect = 0.072
 Identities = 17/19 (89%), Positives = 17/19 (89%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRG 337
           GNYYVP E KLAFVIRIRG
Sbjct: 38  GNYYVPAEPKLAFVIRIRG 56


>UniRef50_Q00U40 Cluster: Chromosome 16 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 16 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 447

 Score = 39.5 bits (88), Expect = 0.072
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +3

Query: 87  VPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           +PES+LK                 + + +   K+ EIFKRAE+YVKEYR + R
Sbjct: 272 IPESILKKRKRDTQWAAQKAAAAAEAKKAQEAKRDEIFKRAEKYVKEYRDQVR 324


>UniRef50_Q3A6X8 Cluster: Putative iron-sulfur cluster-like protein;
           n=1; Pelobacter carbinolicus DSM 2380|Rep: Putative
           iron-sulfur cluster-like protein - Pelobacter
           carbinolicus (strain DSM 2380 / Gra Bd 1)
          Length = 398

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = -3

Query: 526 LANPRLILTHGHSLSWGIPKQCKARRYVAYSQ*PYSDVQ-THHC 398
           LA PR+   H   + WGIP   +A    A S  PY+D Q   HC
Sbjct: 278 LALPRICAAHSADMVWGIPTWLQAPLQRALSSRPYADPQLCRHC 321


>UniRef50_A2DSI8 Cluster: Ribosomal protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Ribosomal protein,
           putative - Trichomonas vaginalis G3
          Length = 238

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           EVR +L  +RL    +GVFV L +     L+     I +G P ++ +R+L+         
Sbjct: 97  EVRTILTEYRLNDQFDGVFVALTQENRQKLKSIAHTIVYGVPTVEFIRQLIHTRAFTVKD 156

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
           +N        L+        + C++D++
Sbjct: 157 NNEIAINSNKLVSEALSDKGLECLDDMV 184


>UniRef50_Q4UAQ1 Cluster: 60S ribosomal protein l7-a, putative; n=2;
           Theileria|Rep: 60S ribosomal protein l7-a, putative -
           Theileria annulata
          Length = 247

 Score = 34.3 bits (75), Expect = 2.7
 Identities = 17/86 (19%), Positives = 42/86 (48%)
 Frame = +1

Query: 361 RKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDN 540
           + +L+   L +IN G F+  + + ++++    P++ +G P LK V++L+    +    + 
Sbjct: 101 KDILKTIGLTRINTGRFMSNSVSNLDLINKVLPFVYYGTPTLKHVKDLLHKRGTIYQHNK 160

Query: 541 VYQSLPTALLRRGFHKHNIICVEDLI 618
                   ++   F  + I  +++LI
Sbjct: 161 AEMISGNLIIEENFSNYGIYSIDELI 186


>UniRef50_Q7YY85 Cluster: Cytohesin-like protein, possible; n=5;
            Cryptosporidium|Rep: Cytohesin-like protein, possible -
            Cryptosporidium parvum
          Length = 1785

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 76   SCLLYQSQCSSIVRGERLFALGDYRLR*RGVLLPSRRRGKSSRGLNSTSR--NTASRNVM 249
            SC+L  SQCSSI  G  L  LGDY    R   L + RR  +S+ +    +  N+ S+N++
Sbjct: 1369 SCIL--SQCSSISNGSLLGVLGDYYKVERYNTLANERRANNSKVVVRDEKILNSISKNIV 1426


>UniRef50_Q82BZ0 Cluster: Sensor protein; n=1; Streptomyces
            avermitilis|Rep: Sensor protein - Streptomyces
            avermitilis
          Length = 1383

 Score = 33.5 bits (73), Expect = 4.7
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +3

Query: 147  QVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEID*PDKHAIVATTTFPGKPNWHLSS 326
            Q  L+R ++ +++K  +   + QY  E+      E+  P    ++        P+ HLS 
Sbjct: 914  QAELQRSNAELEEKAALLATSSQYKSEFLANMSHELRTPLNSLLILARLLSDNPDGHLSD 973

Query: 327  ESV-VSTKFHRS 359
            + V  +T  HRS
Sbjct: 974  QEVQFATTIHRS 985


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 609,558,888
Number of Sequences: 1657284
Number of extensions: 11851805
Number of successful extensions: 28884
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 28100
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28863
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 51239674196
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -