SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-...   152   7e-36
UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4; ...   141   1e-32
UniRef50_Q8IT93 Cluster: Y-box protein Ct-p50; n=4; Endopterygot...   116   3e-25
UniRef50_A0NEN6 Cluster: ENSANGP00000031633; n=12; cellular orga...   116   4e-25
UniRef50_P16989 Cluster: DNA-binding protein A; n=92; cellular o...   107   2e-22
UniRef50_Q90650 Cluster: Rous sarcoma virus transcription enhanc...   106   5e-22
UniRef50_Q9XSU1 Cluster: DNA binding protein; n=3; Amniota|Rep: ...   106   5e-22
UniRef50_O46173 Cluster: Y-box protein; n=5; cellular organisms|...   105   6e-22
UniRef50_P67809 Cluster: Nuclease sensitive element-binding prot...   105   6e-22
UniRef50_UPI00015B4254 Cluster: PREDICTED: similar to Y-box prot...   104   1e-21
UniRef50_Q4H2L8 Cluster: Y-box protein 1/2/3; n=2; Ciona intesti...   104   1e-21
UniRef50_Q90WH1 Cluster: Cold-shock domain protein; n=1; Oryzias...   102   6e-21
UniRef50_Q9Y2T7 Cluster: Y-box-binding protein 2; n=21; Tetrapod...   102   6e-21
UniRef50_O13015 Cluster: Y box protein 2; n=1; Carassius auratus...   101   1e-20
UniRef50_P41824 Cluster: Y-box factor homolog; n=2; cellular org...   100   2e-20
UniRef50_UPI00005843EB Cluster: PREDICTED: similar to Y-Box fact...   100   5e-20
UniRef50_UPI00006A28C0 Cluster: Y-box-binding protein 2 (Germ ce...    90   4e-17
UniRef50_O62213 Cluster: Putative uncharacterized protein cey-1;...    88   1e-16
UniRef50_UPI0000DC0B3F Cluster: UPI0000DC0B3F related cluster; n...    86   5e-16
UniRef50_UPI0000DC181B Cluster: UPI0000DC181B related cluster; n...    76   6e-13
UniRef50_Q23960 Cluster: Y-box protein; n=2; Dugesia|Rep: Y-box ...    70   5e-11
UniRef50_A4V6J7 Cluster: Y-Box factor protein; n=1; Dugesia japo...    63   6e-09
UniRef50_Q17JD9 Cluster: Putative uncharacterized protein; n=1; ...    62   8e-09
UniRef50_P91306 Cluster: Y-box protein 2; n=2; Caenorhabditis el...    61   2e-08
UniRef50_Q9XTJ6 Cluster: Putative uncharacterized protein cey-4;...    60   3e-08
UniRef50_Q52KT6 Cluster: MGC115344 protein; n=2; Xenopus|Rep: MG...    57   4e-07
UniRef50_A1L2L1 Cluster: LOC100036881 protein; n=1; Xenopus laev...    50   4e-05
UniRef50_UPI000155640A Cluster: PREDICTED: hypothetical protein;...    48   1e-04
UniRef50_UPI0000DC0B82 Cluster: UPI0000DC0B82 related cluster; n...    48   2e-04
UniRef50_Q6ZN17 Cluster: Lin-28 homolog B; n=40; Coelomata|Rep: ...    48   2e-04
UniRef50_Q5CVY2 Cluster: Cold shock RNA binding domain of the OB...    45   0.001
UniRef50_Q1RLA8 Cluster: Zinc finger protein; n=1; Ciona intesti...    45   0.001
UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triti...    44   0.002
UniRef50_A4RZ32 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.002
UniRef50_A7RV03 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.002
UniRef50_A3BPB0 Cluster: Putative uncharacterized protein; n=2; ...    43   0.007
UniRef50_Q4S6T5 Cluster: Chromosome 14 SCAF14723, whole genome s...    41   0.026
UniRef50_Q1QAP9 Cluster: Cold-shock DNA-binding domain protein; ...    40   0.046
UniRef50_A4VMZ2 Cluster: Cold shock protein CspA; n=12; Bacteria...    40   0.046
UniRef50_Q013V8 Cluster: Glycogen debranching enzyme; n=1; Ostre...    39   0.11 
UniRef50_O65639 Cluster: Glycine-rich protein; n=8; Magnoliophyt...    39   0.11 
UniRef50_Q9ZBH4 Cluster: Putative DNA-binding protein; n=2; Acti...    38   0.25 
UniRef50_A5NZH6 Cluster: Putative cold-shock DNA-binding domain ...    38   0.25 
UniRef50_UPI0000589074 Cluster: PREDICTED: similar to ENSANGP000...    37   0.33 
UniRef50_Q3Y013 Cluster: Cold-shock protein, DNA-binding; n=6; c...    37   0.33 
UniRef50_Q016S2 Cluster: Putative nucleic acid binding protein; ...    37   0.33 
UniRef50_A5BWB0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.33 
UniRef50_Q4UBG6 Cluster: Cold shock protein, putative; n=2; Thei...    37   0.33 
UniRef50_UPI00015BD510 Cluster: UPI00015BD510 related cluster; n...    37   0.43 
UniRef50_Q2BKV8 Cluster: Cold-shock domain family protein; n=3; ...    37   0.43 
UniRef50_Q4JMV8 Cluster: Predicted cold shock family protein; n=...    36   0.57 
UniRef50_A0YCJ0 Cluster: Cold-shock DNA-binding protein; n=1; ma...    36   0.57 
UniRef50_Q38896 Cluster: Glycine-rich protein 2b; n=26; cellular...    36   0.57 
UniRef50_Q1ZKE8 Cluster: Cold shock protein; n=3; Gammaproteobac...    36   0.75 
UniRef50_A5ZS66 Cluster: Putative uncharacterized protein; n=1; ...    36   0.75 
UniRef50_Q1N1Z0 Cluster: Cold shock protein; n=14; Bacteria|Rep:...    36   0.99 
UniRef50_Q1GQL9 Cluster: Cold-shock DNA-binding domain protein; ...    36   0.99 
UniRef50_P0A981 Cluster: Cold shock-like protein cspG; n=154; Ba...    36   0.99 
UniRef50_Q2RQP4 Cluster: Cold-shock DNA-binding domain protein; ...    35   1.3  
UniRef50_Q9ZFK8 Cluster: CspB; n=4; cellular organisms|Rep: CspB...    35   1.3  
UniRef50_Q7D268 Cluster: AGR_C_161p; n=7; Proteobacteria|Rep: AG...    35   1.3  
UniRef50_A5ZXC4 Cluster: Putative uncharacterized protein; n=2; ...    35   1.3  
UniRef50_A3YF52 Cluster: Cold-shock protein, DNA-binding; n=2; M...    35   1.3  
UniRef50_P39818 Cluster: Cold shock-like protein cspJ; n=7; Bact...    35   1.3  
UniRef50_Q6N3M1 Cluster: Cold shock DNA binding protein; n=78; B...    35   1.7  
UniRef50_Q1FKR2 Cluster: Cold-shock protein, DNA-binding; n=2; C...    35   1.7  
UniRef50_A1CFX7 Cluster: Cold shock NA binding domain protein; n...    35   1.7  
UniRef50_P0A975 Cluster: Cold shock-like protein cspE; n=28; Bac...    35   1.7  
UniRef50_P0A9Y2 Cluster: Cold shock protein cspA; n=39; Gammapro...    35   1.7  
UniRef50_Q60AQ4 Cluster: Cold shock protein; n=27; Bacteria|Rep:...    34   2.3  
UniRef50_P54584 Cluster: Cold shock protein; n=6; Bacteria|Rep: ...    34   2.3  
UniRef50_P81622 Cluster: Cold shock protein CspSt; n=6; Streptoc...    34   2.3  
UniRef50_P39158 Cluster: Cold shock protein cspC; n=41; Bacteria...    34   2.3  
UniRef50_P62169 Cluster: Cold shock-like protein cspC; n=26; cel...    34   2.3  
UniRef50_Q08VT0 Cluster: Conserved domain protein; n=2; Bacteria...    34   3.0  
UniRef50_A4BC11 Cluster: Cold shock protein; n=1; Reinekea sp. M...    34   3.0  
UniRef50_A7ENM1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.0  
UniRef50_Q83RI9 Cluster: Cold shock-like protein cspC; n=38; Gam...    34   3.0  
UniRef50_Q9Z3S6 Cluster: Cold shock protein cspA; n=59; Alphapro...    34   3.0  
UniRef50_P72188 Cluster: Cold shock protein capA; n=23; Proteoba...    34   3.0  
UniRef50_Q9KXN2 Cluster: Cold shock protein B; n=7; Bacteria|Rep...    33   4.0  
UniRef50_Q6FAY9 Cluster: Cold shock-like protein; n=44; Bacteria...    33   4.0  
UniRef50_A3Y9L0 Cluster: Cold-shock DNA-binding domain protein; ...    33   4.0  
UniRef50_Q9AN51 Cluster: ID534; n=52; Bacteria|Rep: ID534 - Brad...    33   5.3  
UniRef50_Q2S0T4 Cluster: Conserved domain protein; n=2; Bacteroi...    33   5.3  
UniRef50_Q2J4H7 Cluster: Cold-shock DNA-binding domain protein; ...    33   5.3  
UniRef50_Q8GI47 Cluster: Cold shock protein homolog; n=5; Deinoc...    33   5.3  
UniRef50_Q9PA96 Cluster: Temperature acclimation protein B; n=24...    33   7.0  
UniRef50_Q89KY2 Cluster: Bll4766 protein; n=5; Bradyrhizobiaceae...    33   7.0  
UniRef50_Q9ZFK9 Cluster: CspA; n=25; Bacteria|Rep: CspA - Myxoco...    33   7.0  
UniRef50_A7DA86 Cluster: Putative cold-shock DNA-binding domain ...    33   7.0  
UniRef50_P0A363 Cluster: Cold shock-like protein cspB; n=367; ro...    33   7.0  
UniRef50_UPI0000DA19CE Cluster: PREDICTED: similar to nuclease s...    32   9.3  
UniRef50_Q4KIT8 Cluster: Membrane protein, putative; n=1; Pseudo...    32   9.3  
UniRef50_Q8D046 Cluster: Cold shock protein; n=14; Enterobacteri...    32   9.3  
UniRef50_Q0M3I1 Cluster: Cold-shock protein, DNA-binding; n=1; C...    32   9.3  
UniRef50_A4U251 Cluster: Cold shock DNA-binding domain protein; ...    32   9.3  
UniRef50_Q5ENQ3 Cluster: Chloroplast lipoate protein ligase; n=1...    32   9.3  
UniRef50_A3EXS4 Cluster: RNA-binding protein LIN-28-like protein...    32   9.3  

>UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-box
           protein - Bombyx mori (Silk moth)
          Length = 272

 Score =  152 bits (368), Expect = 7e-36
 Identities = 70/71 (98%), Positives = 71/71 (100%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA
Sbjct: 60  KEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 119

Query: 432 DKRRGYHRQYF 464
           DKRRGYHRQYF
Sbjct: 120 DKRRGYHRQYF 130



 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIAEKVSGTVKWFNVKSGYGFINRNDTK+
Sbjct: 33  VIAEKVSGTVKWFNVKSGYGFINRNDTKE 61


>UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4;
           cellular organisms|Rep: Putative uncharacterized protein
           - Lonomia obliqua (Moth)
          Length = 254

 Score =  141 bits (342), Expect = 1e-32
 Identities = 65/71 (91%), Positives = 68/71 (95%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI RNNPRKAVRSVGDGE VEFAVVAGEKG EAAGVTGPGGEPVKGSPYAA
Sbjct: 51  KEDVFVHQTAIIRNNPRKAVRSVGDGEVVEFAVVAGEKGCEAAGVTGPGGEPVKGSPYAA 110

Query: 432 DKRRGYHRQYF 464
           DKRRGY+RQY+
Sbjct: 111 DKRRGYYRQYY 121



 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIAEKVSGTVKWFNVKSGYGFINRNDTK+
Sbjct: 24  VIAEKVSGTVKWFNVKSGYGFINRNDTKE 52


>UniRef50_Q8IT93 Cluster: Y-box protein Ct-p50; n=4;
           Endopterygota|Rep: Y-box protein Ct-p50 - Chironomus
           tentans (Midge)
          Length = 317

 Score =  116 bits (280), Expect = 3e-25
 Identities = 53/66 (80%), Positives = 60/66 (90%)
 Frame = +3

Query: 249 HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           +++D+FVHQ+AI +NNP+KAVRSVGDGE VEF VVAGEKG EAA VTGP GEPVKGSPYA
Sbjct: 51  NKQDIFVHQSAIIKNNPKKAVRSVGDGEVVEFDVVAGEKGSEAANVTGPEGEPVKGSPYA 110

Query: 429 ADKRRG 446
           ADKRRG
Sbjct: 111 ADKRRG 116



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           +IA KV+GTVKWFNVKSGYGFINRND K+
Sbjct: 25  IIATKVTGTVKWFNVKSGYGFINRNDNKQ 53


>UniRef50_A0NEN6 Cluster: ENSANGP00000031633; n=12; cellular
           organisms|Rep: ENSANGP00000031633 - Anopheles gambiae
           str. PEST
          Length = 166

 Score =  116 bits (279), Expect = 4e-25
 Identities = 55/66 (83%), Positives = 59/66 (89%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           QEDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPVKGS YAA
Sbjct: 32  QEDVFVHQSAIARNNPKKAVRSVGDGEQVEFDVVIGEKGNEAANVTGPQGEPVKGSQYAA 91

Query: 432 DKRRGY 449
           +KRRG+
Sbjct: 92  EKRRGF 97



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/29 (79%), Positives = 26/29 (89%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV+G VKWFNVKSGYGFINR DT++
Sbjct: 5   VIATKVTGVVKWFNVKSGYGFINRGDTQE 33


>UniRef50_P16989 Cluster: DNA-binding protein A; n=92; cellular
           organisms|Rep: DNA-binding protein A - Homo sapiens
           (Human)
          Length = 372

 Score =  107 bits (257), Expect = 2e-22
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>UniRef50_Q90650 Cluster: Rous sarcoma virus transcription enhancer
           factor II; n=1; Gallus gallus|Rep: Rous sarcoma virus
           transcription enhancer factor II - Gallus gallus
           (Chicken)
          Length = 298

 Score =  106 bits (254), Expect = 5e-22
 Identities = 52/71 (73%), Positives = 57/71 (80%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK + SVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 110 KEDVFVHQTAIKKNNPRKYLASVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 169

Query: 432 DKRRGYHRQYF 464
           D+RR Y R YF
Sbjct: 170 DRRR-YRRGYF 179



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 83  VLATKVLGTVKWFNVRNGYGFINRNDTKE 111


>UniRef50_Q9XSU1 Cluster: DNA binding protein; n=3; Amniota|Rep: DNA
           binding protein - Canis familiaris (Dog)
          Length = 96

 Score =  106 bits (254), Expect = 5e-22
 Identities = 51/71 (71%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE V+F VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 15  KEDVFVHQTAIKKNNPRKYLRSVGDGETVQFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 74

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 75  DRRR-YRRGYY 84



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 211 NVKSGYGFINRNDTKK 258
           NV++GYGFINRNDTK+
Sbjct: 1   NVRNGYGFINRNDTKE 16


>UniRef50_O46173 Cluster: Y-box protein; n=5; cellular
           organisms|Rep: Y-box protein - Drosophila melanogaster
           (Fruit fly)
          Length = 359

 Score =  105 bits (253), Expect = 6e-22
 Identities = 51/66 (77%), Positives = 57/66 (86%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQ+AIA NNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV+GS +AA
Sbjct: 85  REDVFVHQSAIA-NNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143

Query: 432 DKRRGY 449
           DKRR +
Sbjct: 144 DKRRNF 149



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 25/29 (86%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV+GTVKWFNVKSGYGFINRNDT++
Sbjct: 58  VIATKVTGTVKWFNVKSGYGFINRNDTRE 86


>UniRef50_P67809 Cluster: Nuclease sensitive element-binding protein
           1; n=65; Coelomata|Rep: Nuclease sensitive
           element-binding protein 1 - Homo sapiens (Human)
          Length = 324

 Score =  105 bits (253), Expect = 6e-22
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>UniRef50_UPI00015B4254 Cluster: PREDICTED: similar to Y-box protein
           Ct-p40; n=1; Nasonia vitripennis|Rep: PREDICTED: similar
           to Y-box protein Ct-p40 - Nasonia vitripennis
          Length = 335

 Score =  104 bits (250), Expect = 1e-21
 Identities = 52/69 (75%), Positives = 55/69 (79%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADK 437
           D+FV Q  I+ N P KAVRSVGDGE VEF VV GEKG EAA VTGP GE VKGSPYAADK
Sbjct: 93  DIFVCQRCISNNLPSKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPDGEAVKGSPYAADK 152

Query: 438 RRGYHRQYF 464
           RRGY RQY+
Sbjct: 153 RRGY-RQYY 160



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 21/25 (84%), Positives = 24/25 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRN 246
           +IA KV+GTVKWFNVKSGYGFINR+
Sbjct: 64  IIANKVTGTVKWFNVKSGYGFINRS 88


>UniRef50_Q4H2L8 Cluster: Y-box protein 1/2/3; n=2; Ciona
           intestinalis|Rep: Y-box protein 1/2/3 - Ciona
           intestinalis (Transparent sea squirt)
          Length = 320

 Score =  104 bits (250), Expect = 1e-21
 Identities = 52/78 (66%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query: 231 FHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF-EAAGVTGPGGEP 407
           F  ++ ++EDVF+HQTAI +NNP+K +RSVGDGE VEF VV GEKG  EAA VTGP GEP
Sbjct: 41  FVNRDDNKEDVFIHQTAIIKNNPKKYLRSVGDGENVEFDVVEGEKGLPEAANVTGPNGEP 100

Query: 408 VKGSPYAADKRRGYHRQY 461
           VKGS YAAD+RR Y  +Y
Sbjct: 101 VKGSKYAADRRR-YKPRY 117



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/29 (62%), Positives = 24/29 (82%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A   SG VKWFNV++GYGF+NR+D K+
Sbjct: 21  VLASHCSGVVKWFNVRNGYGFVNRDDNKE 49


>UniRef50_Q90WH1 Cluster: Cold-shock domain protein; n=1; Oryzias
           latipes|Rep: Cold-shock domain protein - Oryzias latipes
           (Medaka fish) (Japanese ricefish)
          Length = 366

 Score =  102 bits (245), Expect = 6e-21
 Identities = 49/71 (69%), Positives = 57/71 (80%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF V+   KG EAA VTGPGG PVKGS YA 
Sbjct: 25  KEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYAP 84

Query: 432 DKRRGYHRQYF 464
           +KRR + R++F
Sbjct: 85  NKRR-FRRRFF 94



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/24 (83%), Positives = 23/24 (95%)
 Frame = +1

Query: 187 VSGTVKWFNVKSGYGFINRNDTKK 258
           V GTVKWFNV++GYGFINRNDTK+
Sbjct: 3   VQGTVKWFNVRNGYGFINRNDTKE 26


>UniRef50_Q9Y2T7 Cluster: Y-box-binding protein 2; n=21;
           Tetrapoda|Rep: Y-box-binding protein 2 - Homo sapiens
           (Human)
          Length = 364

 Score =  102 bits (245), Expect = 6e-21
 Identities = 48/64 (75%), Positives = 53/64 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA 
Sbjct: 116 KEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175

Query: 432 DKRR 443
           ++R+
Sbjct: 176 NRRK 179



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 22/29 (75%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A +V GTVKWFNV++GYGFINRNDTK+
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINRNDTKE 117


>UniRef50_O13015 Cluster: Y box protein 2; n=1; Carassius
           auratus|Rep: Y box protein 2 - Carassius auratus
           (Goldfish)
          Length = 297

 Score =  101 bits (243), Expect = 1e-20
 Identities = 50/70 (71%), Positives = 54/70 (77%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV   KG EAA VTGPGG PVKGS YA 
Sbjct: 43  KEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVVEAAKGSEAANVTGPGGIPVKGSRYAP 102

Query: 432 DKRRGYHRQY 461
           +KRR   R Y
Sbjct: 103 NKRRFRRRFY 112



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/29 (79%), Positives = 26/29 (89%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA  V GTVKWFNV++GYGFINRNDTK+
Sbjct: 16  VIATGVEGTVKWFNVRNGYGFINRNDTKE 44


>UniRef50_P41824 Cluster: Y-box factor homolog; n=2; cellular
           organisms|Rep: Y-box factor homolog - Aplysia
           californica (California sea hare)
          Length = 253

 Score =  100 bits (240), Expect = 2e-20
 Identities = 48/64 (75%), Positives = 53/64 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G  V+GS YAA
Sbjct: 55  KEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSKYAA 114

Query: 432 DKRR 443
           D+RR
Sbjct: 115 DRRR 118



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/29 (82%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           +IA +VSGTVKWFNVKSGYGFINR+DTK+
Sbjct: 28  IIASQVSGTVKWFNVKSGYGFINRDDTKE 56


>UniRef50_UPI00005843EB Cluster: PREDICTED: similar to Y-Box factor;
           n=4; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Y-Box factor - Strongylocentrotus purpuratus
          Length = 326

 Score = 99.5 bits (237), Expect = 5e-20
 Identities = 49/64 (76%), Positives = 51/64 (79%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQ+AI RNNPRK  RSVGDGE VEF VV G KG EAA VTGP G PV GS YAA
Sbjct: 46  KEDVFVHQSAIVRNNPRKYQRSVGDGEVVEFDVVEGTKGNEAARVTGPEGAPVVGSKYAA 105

Query: 432 DKRR 443
           DKRR
Sbjct: 106 DKRR 109



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 24/29 (82%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KVSGTVKWFNVK+GYGFINR+DTK+
Sbjct: 19  VLATKVSGTVKWFNVKNGYGFINRDDTKE 47


>UniRef50_UPI00006A28C0 Cluster: Y-box-binding protein 2 (Germ
           cell-specific Y-box-binding protein) (Contrin) (MSY2
           homolog).; n=1; Xenopus tropicalis|Rep: Y-box-binding
           protein 2 (Germ cell-specific Y-box-binding protein)
           (Contrin) (MSY2 homolog). - Xenopus tropicalis
          Length = 199

 Score = 89.8 bits (213), Expect = 4e-17
 Identities = 44/62 (70%), Positives = 48/62 (77%)
 Frame = +3

Query: 276 TAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 455
           TAI RNNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PVKGS +A ++RR   R
Sbjct: 70  TAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRR 129

Query: 456 QY 461
            Y
Sbjct: 130 FY 131


>UniRef50_O62213 Cluster: Putative uncharacterized protein cey-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cey-1 - Caenorhabditis elegans
          Length = 208

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 40/61 (65%), Positives = 46/61 (75%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAAD 434
           ED+FVHQTAI  NNP K +RS+GD E V F +V G KG EAA VTGP G PV+GS YAAD
Sbjct: 44  EDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAAD 103

Query: 435 K 437
           +
Sbjct: 104 R 104



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V A KV GTVKWFNVK+GYGFINR DT +
Sbjct: 16  VKATKVKGTVKWFNVKNGYGFINRTDTNE 44


>UniRef50_UPI0000DC0B3F Cluster: UPI0000DC0B3F related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0B3F UniRef100 entry -
           Rattus norvegicus
          Length = 292

 Score = 86.2 bits (204), Expect = 5e-16
 Identities = 41/68 (60%), Positives = 49/68 (72%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTA+ +N+PRK +RSVGD E VEF  V GEK  EAA VTG GG PV+ S Y A
Sbjct: 53  KEDVFVHQTAMKKNDPRKYLRSVGDAETVEFDFVEGEKDVEAASVTGLGGVPVQDSKYTA 112

Query: 432 DKRRGYHR 455
           D+    H+
Sbjct: 113 DRNHCKHQ 120



 Score = 35.5 bits (78), Expect = 0.99
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GT+K   V +G G INRNDTK+
Sbjct: 26  VIATKVLGTMKCSIVWNGCGLINRNDTKE 54


>UniRef50_UPI0000DC181B Cluster: UPI0000DC181B related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC181B UniRef100 entry -
           Rattus norvegicus
          Length = 210

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 37/58 (63%), Positives = 43/58 (74%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           DVFVHQTAI +NNPRK + + GD E VEF V+ GEK  EAA + GPGG  V+GS YAA
Sbjct: 53  DVFVHQTAIKKNNPRKYLHTTGDRETVEFDVIEGEKDAEAANIIGPGG--VQGSQYAA 108


>UniRef50_Q23960 Cluster: Y-box protein; n=2; Dugesia|Rep: Y-box
           protein - Dugesia japonica (Planarian)
          Length = 266

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 34/69 (49%), Positives = 46/69 (66%)
 Frame = +3

Query: 249 HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           +QED+F+HQ+AI ++NP    +SVG+GE + F +V G KG EAA V+   G+ VKGS YA
Sbjct: 50  NQEDIFIHQSAIVKSNPDHPRKSVGEGEEILFDIVKGAKGNEAANVSAIDGKCVKGSEYA 109

Query: 429 ADKRRGYHR 455
               RG  R
Sbjct: 110 LRYPRGRGR 118



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 15/24 (62%), Positives = 20/24 (83%)
 Frame = +1

Query: 187 VSGTVKWFNVKSGYGFINRNDTKK 258
           ++G VKWFNVK GYGF+ RND ++
Sbjct: 29  ITGKVKWFNVKRGYGFVCRNDNQE 52


>UniRef50_A4V6J7 Cluster: Y-Box factor protein; n=1; Dugesia
           japonica|Rep: Y-Box factor protein - Dugesia japonica
           (Planarian)
          Length = 178

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 33/58 (56%), Positives = 40/58 (68%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           EDVFVHQ+AI+R  P K  +S+G+ E V F VV G KG EA  VTGP G+ V GS +A
Sbjct: 26  EDVFVHQSAISRCQPGKQ-KSLGEDEDVLFDVVKGSKGNEAMNVTGPNGDAVLGSKFA 82



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G VKW+NVK GYGFI+R+D
Sbjct: 5   GKVKWYNVKKGYGFIHRDD 23


>UniRef50_Q17JD9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 192

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 32/67 (47%), Positives = 44/67 (65%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAAD 434
           ED+FVH++ I + N     +S+GDGE VEF ++A +       VTGPG +PVKGSP+ A 
Sbjct: 57  EDIFVHKSCIFKPNRNHFTKSIGDGEIVEFGLIASK-------VTGPGFKPVKGSPFVA- 108

Query: 435 KRRGYHR 455
            +RG HR
Sbjct: 109 -KRGGHR 114



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 15/25 (60%), Positives = 22/25 (88%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRNDT 252
           +++++GTVKWFN K G+GFI R+DT
Sbjct: 31  SKRITGTVKWFNAKDGFGFITRHDT 55


>UniRef50_P91306 Cluster: Y-box protein 2; n=2; Caenorhabditis
           elegans|Rep: Y-box protein 2 - Caenorhabditis elegans
          Length = 267

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/59 (52%), Positives = 42/59 (71%), Gaps = 1/59 (1%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPY 425
           ++D+FVHQTAIA++   K  +R++GD E V F +V G+ G EAA VTGP G+ V GS Y
Sbjct: 88  EKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSRY 146



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRNDTKKMCLCIRLPSPVTTHVRLCARSATER 333
           I   + G VKW++V   YGFI+RND +K          +  H    A+SATE+
Sbjct: 62  ITTGLQGKVKWYSVLRRYGFISRNDGEK---------DIFVHQTAIAKSATEK 105


>UniRef50_Q9XTJ6 Cluster: Putative uncharacterized protein cey-4;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein cey-4 - Caenorhabditis elegans
          Length = 294

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKA-VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           ED FVHQTAI +++  K  +R++ D E V F +V G KG EAA VTGP GE V+GS +A
Sbjct: 115 EDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173


>UniRef50_Q52KT6 Cluster: MGC115344 protein; n=2; Xenopus|Rep:
           MGC115344 protein - Xenopus laevis (African clawed frog)
          Length = 221

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 31  VLATKVQGTVKWFNVRNGYGFINRNDTKE 59



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 22/34 (64%), Positives = 26/34 (76%)
 Frame = +3

Query: 363 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYF 464
           +G EAA VTGP G PV+GS YAAD+RR Y R Y+
Sbjct: 65  QGAEAANVTGPKGAPVQGSRYAADRRR-YRRGYY 97


>UniRef50_A1L2L1 Cluster: LOC100036881 protein; n=1; Xenopus
           laevis|Rep: LOC100036881 protein - Xenopus laevis
           (African clawed frog)
          Length = 131

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (2%)
 Frame = +3

Query: 192 GHCEMVQRQEWIWFHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG- 368
           G C+    ++   F   +    D+FVHQ+ I  +      RS+ +GE VEF+V+  E+  
Sbjct: 6   GTCKWFNAEKGYGFLTPDDGSPDIFVHQSTIHADG----FRSLAEGEPVEFSVITDERSG 61

Query: 369 -FEAAGVTGPGGEPVKGSP 422
             +AA VTGP G  V+G+P
Sbjct: 62  KLKAADVTGPNGAAVRGAP 80



 Score = 35.5 bits (78), Expect = 0.99
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRND 249
           K++GT KWFN + GYGF+  +D
Sbjct: 3   KLTGTCKWFNAEKGYGFLTPDD 24


>UniRef50_UPI000155640A Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 502

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 2/64 (3%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKKMCLC--IRLPSPVTTHVRLCARSATERRWSL 345
           V+A +V GTVKWFNV++GYGFINR  +   C C       P T   R  +R+       L
Sbjct: 56  VLATQVLGTVKWFNVRNGYGFINRYRSAPGCGCGSRGRGGPSTRGARSASRAPDNPAKLL 115

Query: 346 PWLP 357
           P+ P
Sbjct: 116 PFSP 119


>UniRef50_UPI0000DC0B82 Cluster: UPI0000DC0B82 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0B82 UniRef100 entry -
           Rattus norvegicus
          Length = 147

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV G V WFNV++GY FINRNDTK+
Sbjct: 91  VIAMKVLGIVTWFNVRNGYVFINRNDTKE 119



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/30 (66%), Positives = 23/30 (76%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVE 341
           +ED FVHQT I +NNP K + SVGDGE VE
Sbjct: 118 KEDTFVHQTVIKKNNP-KYLHSVGDGETVE 146


>UniRef50_Q6ZN17 Cluster: Lin-28 homolog B; n=40; Coelomata|Rep:
           Lin-28 homolog B - Homo sapiens (Human)
          Length = 250

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 61  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>UniRef50_Q5CVY2 Cluster: Cold shock RNA binding domain of the OB
           fold; n=2; Cryptosporidium|Rep: Cold shock RNA binding
           domain of the OB fold - Cryptosporidium parvum Iowa II
          Length = 135

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
 Frame = +3

Query: 192 GHCEMVQRQEWIWFHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 371
           G C+     +   F   +   ED+FVHQ    +N   +  RS+   E VE+ +   +KG 
Sbjct: 13  GVCKWFDSTKGFGFITPDDGSEDIFVHQ----QNIKVEGFRSLAQDERVEYEIETDDKGR 68

Query: 372 -EAAGVTGPGGEPVKGSPYAADKRRGYHR 455
            +A  V+GP G PVKG     D+RRG  R
Sbjct: 69  RKAVNVSGPNGAPVKG-----DRRRGRGR 92


>UniRef50_Q1RLA8 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 193

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = +3

Query: 183 ESIGHCEMVQRQEWIWFHQQE*HQE---DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV 353
           E+ G+C+    ++   F   +   +   DVFVHQ++I      +  RS+ +G+ V+F   
Sbjct: 26  EAFGNCKWFNSKQGYGFITPDTSSQEKTDVFVHQSSI----DMEGFRSLQEGDRVKFWYK 81

Query: 354 AGEKGFEAAGVTGPGGEPVKGS 419
             +KG EA  V GPGGE + G+
Sbjct: 82  PSKKGLEAVKVVGPGGEKLVGA 103


>UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triticum
           aestivum|Rep: Cold shock domain protein 3 - Triticum
           aestivum (Wheat)
          Length = 231

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVKG 416
           ED+FVHQ+AI  +      RS+ + +AVEF ++ G+ G  +A+ VT PGG  + G
Sbjct: 28  EDLFVHQSAIKSD----GYRSLNENDAVEFEIITGDDGRTKASDVTAPGGGALSG 78



 Score = 39.9 bits (89), Expect = 0.046
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRND 249
           + E+V GTVKWFNV  G+GFI+ +D
Sbjct: 1   MGERVKGTVKWFNVTKGFGFISPDD 25


>UniRef50_A4RZ32 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 106

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/63 (41%), Positives = 35/63 (55%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAAD 434
           E++FVHQT I+        RSV +GE VE+ V   +   +A  VTGP G  VKG+P    
Sbjct: 28  EEIFVHQTGISC----AGFRSVWEGEEVEYDVDDTDFAPKAVNVTGPDGVAVKGAPRRRH 83

Query: 435 KRR 443
           + R
Sbjct: 84  RNR 86


>UniRef50_A7RV03 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 671

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           EDVFVHQ+AI  +      RS+ +GE V+  +   +KG  A  VT PGG  VKG+
Sbjct: 506 EDVFVHQSAIKASG----YRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGA 556



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/20 (60%), Positives = 17/20 (85%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +G+VKWFN+  G+GFI R+D
Sbjct: 484 TGSVKWFNLIKGFGFITRDD 503


>UniRef50_A3BPB0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 238

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPV 410
           ED+FVHQ+++  +      RS+ DG+ VEF+V +G  G  +A  VT PGG  V
Sbjct: 29  EDLFVHQSSLKSDG----YRSLNDGDVVEFSVGSGNDGRTKAVNVTAPGGRAV 77



 Score = 35.9 bits (79), Expect = 0.75
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           +E+V GTVKWF+   G+GFI  +D
Sbjct: 3   SERVKGTVKWFDATKGFGFITPDD 26


>UniRef50_Q4S6T5 Cluster: Chromosome 14 SCAF14723, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 14
           SCAF14723, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 206

 Score = 40.7 bits (91), Expect = 0.026
 Identities = 19/36 (52%), Positives = 22/36 (61%)
 Frame = +3

Query: 312 RSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 111 RSLKEGEQVEFTFKKSTKGLESLRVTGPGGGPCAGS 146


>UniRef50_Q1QAP9 Cluster: Cold-shock DNA-binding domain protein;
           n=5; cellular organisms|Rep: Cold-shock DNA-binding
           domain protein - Psychrobacter cryohalolentis (strain
           K5)
          Length = 71

 Score = 39.9 bits (89), Expect = 0.046
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           ED+FVH  AI  +      RS+ DGE VEF+VV G+KG +A  V
Sbjct: 27  EDIFVHFRAIQGDG----YRSLKDGEKVEFSVVEGDKGLQAEEV 66


>UniRef50_A4VMZ2 Cluster: Cold shock protein CspA; n=12;
           Bacteria|Rep: Cold shock protein CspA - Pseudomonas
           stutzeri (strain A1501)
          Length = 136

 Score = 39.9 bits (89), Expect = 0.046
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRND 249
           V+AE+ +GTVKWFN   GYGFI R +
Sbjct: 67  VMAERETGTVKWFNDAKGYGFIQRGN 92



 Score = 39.1 bits (87), Expect = 0.081
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTG 392
           DVFVH  AI  +  R    S+ +G+ VEF+V+ G+KG +A  V G
Sbjct: 95  DVFVHYRAIRGDGHR----SLAEGQQVEFSVIQGQKGLQAEDVAG 135


>UniRef50_Q013V8 Cluster: Glycogen debranching enzyme; n=1;
           Ostreococcus tauri|Rep: Glycogen debranching enzyme -
           Ostreococcus tauri
          Length = 141

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKA--VRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSP 422
           EDVFVHQ+ +  +  R    VR    G+ +EF +   E+   A  VTGP G P+K +P
Sbjct: 63  EDVFVHQSELQMDGFRSVWEVRLQQAGDEIEFELDDDERR-RAKNVTGPAGAPLKKTP 119


>UniRef50_O65639 Cluster: Glycine-rich protein; n=8;
           Magnoliophyta|Rep: Glycine-rich protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 299

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVK 413
           ++FVHQ++I      +  RS+  G+AVEFA+  G  G  +A  VT PGG  +K
Sbjct: 35  ELFVHQSSIVS----EGYRSLTVGDAVEFAITQGSDGKTKAVNVTAPGGGSLK 83



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +1

Query: 178 AEKVSGTVKWFNVKSGYGFINRND 249
           A + +G V WFN   GYGFI  +D
Sbjct: 8   AARSTGKVNWFNASKGYGFITPDD 31


>UniRef50_Q9ZBH4 Cluster: Putative DNA-binding protein; n=2;
           Actinomycetales|Rep: Putative DNA-binding protein -
           Streptomyces coelicolor
          Length = 162

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGE 404
           EDVF+H   +    P ++VRS   G  VEF V +GE+G +A+G+  P GE
Sbjct: 45  EDVFLHVNDLLI--PEESVRS---GLVVEFEVESGERGLKASGIRLPEGE 89


>UniRef50_A5NZH6 Cluster: Putative cold-shock DNA-binding domain
           protein precursor; n=1; Methylobacterium sp. 4-46|Rep:
           Putative cold-shock DNA-binding domain protein precursor
           - Methylobacterium sp. 4-46
          Length = 242

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVT 389
           +DVFVH++A+A    R  + S+ +G+ V   VV G+KG EA  +T
Sbjct: 199 KDVFVHRSALA----RAGLDSLAEGQQVTMGVVEGQKGREAQSIT 239


>UniRef50_UPI0000589074 Cluster: PREDICTED: similar to
           ENSANGP00000011455; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ENSANGP00000011455
           - Strongylocentrotus purpuratus
          Length = 234

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 27/76 (35%), Positives = 32/76 (42%)
 Frame = +3

Query: 192 GHCEMVQRQEWIWFHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 371
           G C+     +   F   +    DVFVHQ  I         RS+   E VE+     EKG 
Sbjct: 65  GKCKWFSLAKCYGFLTPDDGSGDVFVHQRVIKM----VGYRSLDTNEEVEYKFQFSEKGR 120

Query: 372 EAAGVTGPGGEPVKGS 419
           EA  VTG  G   KGS
Sbjct: 121 EATTVTGVDGGDCKGS 136


>UniRef50_Q3Y013 Cluster: Cold-shock protein, DNA-binding; n=6;
           cellular organisms|Rep: Cold-shock protein, DNA-binding
           - Enterococcus faecium DO
          Length = 35

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +GTVKWFN + G+GFI+R D
Sbjct: 3   NGTVKWFNAEKGFGFISRED 22


>UniRef50_Q016S2 Cluster: Putative nucleic acid binding protein;
           n=1; Ostreococcus tauri|Rep: Putative nucleic acid
           binding protein - Ostreococcus tauri
          Length = 125

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 9/78 (11%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAV--RSVGDGEAVEFAVV---AGEKGFEAAGVTGPGGEPVKG 416
           + DVFVHQ+A+     R+    R    G++VEF V      ++  +A  VTG GG P+K 
Sbjct: 33  EPDVFVHQSALKMEGFRRTDGRRFATQGDSVEFDVEHESPTDERLKAVCVTGIGGAPLKA 92

Query: 417 SPYA----ADKRRGYHRQ 458
            P      + K+RG  R+
Sbjct: 93  PPRTNYRRSSKKRGPRRE 110


>UniRef50_A5BWB0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 189

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEPVKG 416
           ED+FVHQT+I  +      R++ +GE VEFAV  GE G  +A  VT   G    G
Sbjct: 30  EDLFVHQTSIRSDG----FRTLSEGETVEFAVDHGEDGRTKAVEVTAVRGSYSSG 80


>UniRef50_Q4UBG6 Cluster: Cold shock protein, putative; n=2;
           Theileria|Rep: Cold shock protein, putative - Theileria
           annulata
          Length = 95

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 26/76 (34%), Positives = 37/76 (48%)
 Frame = +3

Query: 192 GHCEMVQRQEWIWFHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 371
           G C+    ++   F   E + EDVFVHQ+ I  +      RS+ + E VE  V+      
Sbjct: 6   GVCKWFNNKKGYGFITLE-NGEDVFVHQSEIYADG----FRSLHENEKVELEVIMDNNRK 60

Query: 372 EAAGVTGPGGEPVKGS 419
           +A  VTGP G  V G+
Sbjct: 61  KAIHVTGPNGTHVTGT 76


>UniRef50_UPI00015BD510 Cluster: UPI00015BD510 related cluster; n=1;
           unknown|Rep: UPI00015BD510 UniRef100 entry - unknown
          Length = 86

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 12/23 (52%), Positives = 19/23 (82%)
 Frame = +1

Query: 187 VSGTVKWFNVKSGYGFINRNDTK 255
           ++GTVKWF+ + GYGF+ R+D +
Sbjct: 18  ITGTVKWFSKEKGYGFLTRDDNQ 40


>UniRef50_Q2BKV8 Cluster: Cold-shock domain family protein; n=3;
           Bacteria|Rep: Cold-shock domain family protein -
           Neptuniibacter caesariensis
          Length = 149

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           ++  GTVKWFNV  G+GFI R +
Sbjct: 81  DREQGTVKWFNVSKGFGFITRGE 103


>UniRef50_Q4JMV8 Cluster: Predicted cold shock family protein; n=1;
           uncultured bacterium BAC17H8|Rep: Predicted cold shock
           family protein - uncultured bacterium BAC17H8
          Length = 83

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           GTVKWFN + GYGFIN ++
Sbjct: 18  GTVKWFNTQKGYGFINPDE 36


>UniRef50_A0YCJ0 Cluster: Cold-shock DNA-binding protein; n=1;
           marine gamma proteobacterium HTCC2143|Rep: Cold-shock
           DNA-binding protein - marine gamma proteobacterium
           HTCC2143
          Length = 144

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINR 243
           GTVKWFNV  GYGF+ R
Sbjct: 79  GTVKWFNVSKGYGFVTR 95



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/44 (43%), Positives = 30/44 (68%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           E++FVH  +I+ N  RK +R   +G+ +EF+VV G+KG +A  V
Sbjct: 99  EEIFVHFRSISGNG-RKVLR---EGQKIEFSVVDGDKGPQAEDV 138


>UniRef50_Q38896 Cluster: Glycine-rich protein 2b; n=26; cellular
           organisms|Rep: Glycine-rich protein 2b - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 201

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF-EAAGVTGPGGEPVKGS 419
           +D+FVHQ++I      +  RS+   E+VEF V     G  +A  V+GP G PV+G+
Sbjct: 38  DDLFVHQSSIRS----EGFRSLAAEESVEFDVEVDNSGRPKAIEVSGPDGAPVQGN 89



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           ++  GTVKWF+ + G+GFI  +D
Sbjct: 13  DRRKGTVKWFDTQKGFGFITPSD 35


>UniRef50_Q1ZKE8 Cluster: Cold shock protein; n=3;
           Gammaproteobacteria|Rep: Cold shock protein - Vibrio
           angustum S14
          Length = 68

 Score = 35.9 bits (79), Expect = 0.75
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRNDTK 255
           K++GTVKWFN   G+GFI+  D K
Sbjct: 3   KLTGTVKWFNDDKGFGFISGTDGK 26



 Score = 32.7 bits (71), Expect = 7.0
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           +DVFVH +AI     R+ +R   +G++VEF V  G+KG +A+ V
Sbjct: 26  KDVFVHFSAIQAQG-RRTLR---EGQSVEFIVTDGQKGPQASEV 65


>UniRef50_A5ZS66 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 75

 Score = 35.9 bits (79), Expect = 0.75
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRND 249
           ++E + GTVKWF+ + GYGFI   D
Sbjct: 1   MSETLQGTVKWFSAQKGYGFITGED 25


>UniRef50_Q1N1Z0 Cluster: Cold shock protein; n=14; Bacteria|Rep:
           Cold shock protein - Oceanobacter sp. RED65
          Length = 171

 Score = 35.5 bits (78), Expect = 0.99
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G VKWFNVK G+GFI R++
Sbjct: 108 GLVKWFNVKKGFGFITRDN 126


>UniRef50_Q1GQL9 Cluster: Cold-shock DNA-binding domain protein;
           n=30; Proteobacteria|Rep: Cold-shock DNA-binding domain
           protein - Sphingopyxis alaskensis (Sphingomonas
           alaskensis)
          Length = 249

 Score = 35.5 bits (78), Expect = 0.99
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           E+ SGTVK+FN   G+GFI R+D
Sbjct: 179 ERTSGTVKFFNTTKGFGFIARDD 201


>UniRef50_P0A981 Cluster: Cold shock-like protein cspG; n=154;
           Bacteria|Rep: Cold shock-like protein cspG - Shigella
           flexneri
          Length = 70

 Score = 35.5 bits (78), Expect = 0.99
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           ++ K++G VKWFN   G+GFI  +D  K
Sbjct: 1   MSNKMTGLVKWFNADKGFGFITPDDGSK 28



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           +DVFVH TAI  N      R++ + + VEF++  G++G  AA V
Sbjct: 28  KDVFVHFTAIQSNE----FRTLNENQKVEFSIEQGQRGPAAANV 67


>UniRef50_Q2RQP4 Cluster: Cold-shock DNA-binding domain protein;
           n=1; Rhodospirillum rubrum ATCC 11170|Rep: Cold-shock
           DNA-binding domain protein - Rhodospirillum rubrum
           (strain ATCC 11170 / NCIB 8255)
          Length = 70

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +GTVKWFNV+ G+GFI  +D
Sbjct: 3   TGTVKWFNVQKGFGFIAPDD 22


>UniRef50_Q9ZFK8 Cluster: CspB; n=4; cellular organisms|Rep: CspB -
           Myxococcus xanthus
          Length = 66

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/44 (43%), Positives = 25/44 (56%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           EDVF H TAI  +      R++ +G+ VEF V  G KG +A  V
Sbjct: 24  EDVFCHHTAINMD----GFRTLQEGQQVEFEVTRGPKGLQAQNV 63


>UniRef50_Q7D268 Cluster: AGR_C_161p; n=7; Proteobacteria|Rep:
           AGR_C_161p - Agrobacterium tumefaciens (strain C58 /
           ATCC 33970)
          Length = 163

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +GTVKWFN   GYGFI  +D
Sbjct: 97  TGTVKWFNATKGYGFIQPDD 116


>UniRef50_A5ZXC4 Cluster: Putative uncharacterized protein; n=2;
           cellular organisms|Rep: Putative uncharacterized protein
           - Ruminococcus obeum ATCC 29174
          Length = 66

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 13/19 (68%), Positives = 14/19 (73%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           GTVKWFN + GYGFI   D
Sbjct: 4   GTVKWFNAEKGYGFITGED 22


>UniRef50_A3YF52 Cluster: Cold-shock protein, DNA-binding; n=2;
           Marinomonas|Rep: Cold-shock protein, DNA-binding -
           Marinomonas sp. MED121
          Length = 79

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRND 249
           + +K+ GTVKWFN   G GFI R++
Sbjct: 1   MTDKLKGTVKWFNDSKGVGFIQRDN 25


>UniRef50_P39818 Cluster: Cold shock-like protein cspJ; n=7;
           Bacteria|Rep: Cold shock-like protein cspJ - Salmonella
           typhimurium
          Length = 70

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRNDTKK 258
           K++G VKWFN + G+GFI   D  K
Sbjct: 4   KITGLVKWFNPEKGFGFITPKDGSK 28


>UniRef50_Q6N3M1 Cluster: Cold shock DNA binding protein; n=78;
           Bacteria|Rep: Cold shock DNA binding protein -
           Rhodopseudomonas palustris
          Length = 84

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/19 (68%), Positives = 14/19 (73%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           GTVKWFN   GYGFI  +D
Sbjct: 18  GTVKWFNATKGYGFIQPDD 36


>UniRef50_Q1FKR2 Cluster: Cold-shock protein, DNA-binding; n=2;
           Clostridium|Rep: Cold-shock protein, DNA-binding -
           Clostridium phytofermentans ISDg
          Length = 70

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRNDTKKMCL 267
           +GTVKW++ + GYGF++ ND + + L
Sbjct: 5   TGTVKWYDSERGYGFVSTNDGRDVFL 30


>UniRef50_A1CFX7 Cluster: Cold shock NA binding domain protein; n=2;
           cellular organisms|Rep: Cold shock NA binding domain
           protein - Aspergillus clavatus
          Length = 125

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFI 237
           E+ +GTVKWFN + GYGFI
Sbjct: 58  ERQNGTVKWFNDEKGYGFI 76


>UniRef50_P0A975 Cluster: Cold shock-like protein cspE; n=28;
           Bacteria|Rep: Cold shock-like protein cspE - Shigella
           flexneri
          Length = 69

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRNDTKK 258
           K+ G VKWFN   G+GFI   D  K
Sbjct: 3   KIKGNVKWFNESKGFGFITPEDGSK 27


>UniRef50_P0A9Y2 Cluster: Cold shock protein cspA; n=39;
           Gammaproteobacteria|Rep: Cold shock protein cspA -
           Salmonella typhimurium
          Length = 70

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRNDTKK 258
           K++G VKWFN   G+GFI  +D  K
Sbjct: 4   KMTGIVKWFNADKGFGFITPDDGSK 28


>UniRef50_Q60AQ4 Cluster: Cold shock protein; n=27; Bacteria|Rep:
           Cold shock protein - Methylococcus capsulatus
          Length = 69

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRND 249
           ++++  GTVKWFN   G+GFI R +
Sbjct: 1   MSQQQQGTVKWFNESKGFGFIQREN 25


>UniRef50_P54584 Cluster: Cold shock protein; n=6; Bacteria|Rep:
           Cold shock protein - Arthrobacter globiformis
          Length = 67

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRNDT 252
           GTVKWFN + G+GFI  +D+
Sbjct: 4   GTVKWFNAEKGFGFITPDDS 23


>UniRef50_P81622 Cluster: Cold shock protein CspSt; n=6;
           Streptococcus thermophilus|Rep: Cold shock protein CspSt
           - Streptococcus thermophilus
          Length = 21

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +GTVKWFN + G+GFI   D
Sbjct: 2   NGTVKWFNAEKGFGFITSED 21


>UniRef50_P39158 Cluster: Cold shock protein cspC; n=41;
           Bacteria|Rep: Cold shock protein cspC - Bacillus
           subtilis
          Length = 66

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           GTVKWFN + G+GFI R +
Sbjct: 4   GTVKWFNAEKGFGFIEREN 22


>UniRef50_P62169 Cluster: Cold shock-like protein cspC; n=26;
           cellular organisms|Rep: Cold shock-like protein cspC -
           Bacillus anthracis
          Length = 65

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +1

Query: 187 VSGTVKWFNVKSGYGFINRND 249
           + G VKWFN + G+GFI R D
Sbjct: 1   MQGRVKWFNAEKGFGFIERED 21


>UniRef50_Q08VT0 Cluster: Conserved domain protein; n=2;
           Bacteria|Rep: Conserved domain protein - Stigmatella
           aurantiaca DW4/3-1
          Length = 100

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +3

Query: 231 FHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           F  Q+   EDVF H TAI  +      R++ +G+ V+F V  G KG +A  V
Sbjct: 50  FITQDGGGEDVFCHHTAINMD----GFRTLQEGQKVQFDVARGPKGLQAQNV 97


>UniRef50_A4BC11 Cluster: Cold shock protein; n=1; Reinekea sp.
           MED297|Rep: Cold shock protein - Reinekea sp. MED297
          Length = 153

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 181 EKVSGTVKWFNVKSGYGFINRND 249
           ++  G VKWFNV  G+GF+ R++
Sbjct: 84  DREEGLVKWFNVSKGFGFVTRDN 106


>UniRef50_A7ENM1 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 253

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = -1

Query: 536 AGVHDVLILPAWSSFTASSATLTREILAVVATALVCSIR*AFYWLTTGTSNTSCFKAFLP 357
           AG+ D+LI+PA   +     T     LA++  +L+     A+ W  +G     CF     
Sbjct: 48  AGIDDILIIPAIVCYLGQGVTGLSSFLALILCSLLQCAPLAYLWNKSGHPGGHCFDTGAF 107

Query: 356 GNHGKLHRL 330
             +G L  L
Sbjct: 108 WRYGSLPNL 116


>UniRef50_Q83RI9 Cluster: Cold shock-like protein cspC; n=38;
           Gammaproteobacteria|Rep: Cold shock-like protein cspC -
           Shigella flexneri
          Length = 69

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVT 389
           +DVFVH +AI  N     ++++ +G+ VEF +  G+KG  A  VT
Sbjct: 27  KDVFVHFSAIQGNG----LKTLAEGQNVEFEIQDGQKGPAAVNVT 67



 Score = 33.5 bits (73), Expect = 4.0
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRNDTKK 258
           K+ G VKWFN   G+GFI   D  K
Sbjct: 3   KIKGQVKWFNESKGFGFITPADGSK 27


>UniRef50_Q9Z3S6 Cluster: Cold shock protein cspA; n=59;
           Alphaproteobacteria|Rep: Cold shock protein cspA -
           Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 69

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           SGTVKWFN   G+GFI  +D
Sbjct: 3   SGTVKWFNSTKGFGFIQPDD 22


>UniRef50_P72188 Cluster: Cold shock protein capA; n=23;
           Proteobacteria|Rep: Cold shock protein capA -
           Pseudomonas fragi
          Length = 64

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 12/21 (57%), Positives = 18/21 (85%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFI 237
           ++++ SGTVKWFN + G+GFI
Sbjct: 1   MSQRQSGTVKWFNDEKGFGFI 21


>UniRef50_Q9KXN2 Cluster: Cold shock protein B; n=7; Bacteria|Rep:
           Cold shock protein B - Streptomyces coelicolor
          Length = 127

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +G VKWFN + G+GF++R+D
Sbjct: 3   TGKVKWFNSEKGFGFLSRDD 22


>UniRef50_Q6FAY9 Cluster: Cold shock-like protein; n=44;
           Bacteria|Rep: Cold shock-like protein - Acinetobacter
           sp. (strain ADP1)
          Length = 69

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRN 246
           ++  V+GTVKWFN   G+GFI ++
Sbjct: 1   MSNSVNGTVKWFNEVKGFGFIQQD 24


>UniRef50_A3Y9L0 Cluster: Cold-shock DNA-binding domain protein;
           n=2; Marinomonas|Rep: Cold-shock DNA-binding domain
           protein - Marinomonas sp. MED121
          Length = 97

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +1

Query: 187 VSGTVKWFNVKSGYGFINR 243
           VSG VKWFN + G+GFI R
Sbjct: 33  VSGIVKWFNDEKGFGFIER 51


>UniRef50_Q9AN51 Cluster: ID534; n=52; Bacteria|Rep: ID534 -
           Bradyrhizobium japonicum
          Length = 120

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRNDTKK 258
           GTVKWFN   GYGF+  +D  K
Sbjct: 56  GTVKWFNPTKGYGFVAPDDGGK 77


>UniRef50_Q2S0T4 Cluster: Conserved domain protein; n=2;
           Bacteroidetes/Chlorobi group|Rep: Conserved domain
           protein - Salinibacter ruber (strain DSM 13855)
          Length = 110

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           + TVKWF+ K GYGFI+  D
Sbjct: 3   TSTVKWFDAKKGYGFIHHPD 22


>UniRef50_Q2J4H7 Cluster: Cold-shock DNA-binding domain protein;
           n=13; Bacteria|Rep: Cold-shock DNA-binding domain
           protein - Frankia sp. (strain CcI3)
          Length = 67

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 16/43 (37%), Positives = 28/43 (65%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           DVFVH ++I  +      +S+ +G++V+F +V G+KG +A  V
Sbjct: 26  DVFVHYSSIVADG----YKSLDEGQSVQFEIVQGQKGPQADNV 64



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFIN 240
           GTVKWFN + G+GFI+
Sbjct: 4   GTVKWFNAEKGFGFIS 19


>UniRef50_Q8GI47 Cluster: Cold shock protein homolog; n=5;
           Deinococci|Rep: Cold shock protein homolog - Thermus
           thermophilus
          Length = 73

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINR 243
           G VKWFN + GYGFI R
Sbjct: 4   GRVKWFNAEKGYGFIER 20


>UniRef50_Q9PA96 Cluster: Temperature acclimation protein B; n=24;
           Bacteria|Rep: Temperature acclimation protein B -
           Xylella fastidiosa
          Length = 85

 Score = 32.7 bits (71), Expect = 7.0
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           GTVKWFN   G+GFI  N+
Sbjct: 23  GTVKWFNDNKGFGFITSNN 41


>UniRef50_Q89KY2 Cluster: Bll4766 protein; n=5;
           Bradyrhizobiaceae|Rep: Bll4766 protein - Bradyrhizobium
           japonicum
          Length = 743

 Score = 32.7 bits (71), Expect = 7.0
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 300 RKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           R   R++GDG+       +G      AG +G GGE V G+
Sbjct: 52  RTRARAIGDGDTARLRAPSGAPAGNGAGSSGSGGEAVAGN 91


>UniRef50_Q9ZFK9 Cluster: CspA; n=25; Bacteria|Rep: CspA -
           Myxococcus xanthus
          Length = 68

 Score = 32.7 bits (71), Expect = 7.0
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRND 249
           +GTVKWFN   G+GFI ++D
Sbjct: 3   TGTVKWFNDAKGFGFIAQDD 22


>UniRef50_A7DA86 Cluster: Putative cold-shock DNA-binding domain
           protein; n=3; Methylobacterium extorquens PA1|Rep:
           Putative cold-shock DNA-binding domain protein -
           Methylobacterium extorquens PA1
          Length = 69

 Score = 32.7 bits (71), Expect = 7.0
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFINRNDTKK 258
           +GTVKWFN   GYGFI  ++  K
Sbjct: 3   TGTVKWFNETKGYGFIQPDNGGK 25


>UniRef50_P0A363 Cluster: Cold shock-like protein cspB; n=367;
           root|Rep: Cold shock-like protein cspB - Yersinia
           enterocolitica
          Length = 70

 Score = 32.7 bits (71), Expect = 7.0
 Identities = 17/44 (38%), Positives = 28/44 (63%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           +DVFVH +AI  N+     +++ +G+ VEF++  G+KG  A  V
Sbjct: 28  KDVFVHFSAIQGND----YKTLDEGQNVEFSIEQGQKGPSAVNV 67



 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           ++ K++G VKWF+   G+GFI+  D  K
Sbjct: 1   MSNKMTGLVKWFDAGKGFGFISPADGSK 28


>UniRef50_UPI0000DA19CE Cluster: PREDICTED: similar to nuclease
           sensitive element binding protein 1; n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to nuclease sensitive
           element binding protein 1 - Rattus norvegicus
          Length = 90

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +3

Query: 360 EKGFEAAGVTGPGGEPVKGSPYAA 431
           +KG +A   TGPGG PV+G  YAA
Sbjct: 6   KKGPDAENDTGPGGAPVQGRKYAA 29


>UniRef50_Q4KIT8 Cluster: Membrane protein, putative; n=1;
           Pseudomonas fluorescens Pf-5|Rep: Membrane protein,
           putative - Pseudomonas fluorescens (strain Pf-5 / ATCC
           BAA-477)
          Length = 211

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = +3

Query: 300 RKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
           R AV   G G  VE    AG       GV+G  G+P +    AAD+RRG
Sbjct: 113 RPAVHVAGAGRPVEHGSGAGPLWL--GGVSGSAGQPRQDCRIAADRRRG 159


>UniRef50_Q8D046 Cluster: Cold shock protein; n=14;
           Enterobacteriaceae|Rep: Cold shock protein - Yersinia
           pestis
          Length = 77

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G VKWFN   GYGFI+ +D
Sbjct: 14  GRVKWFNQSEGYGFISPHD 32


>UniRef50_Q0M3I1 Cluster: Cold-shock protein, DNA-binding; n=1;
           Caulobacter sp. K31|Rep: Cold-shock protein, DNA-binding
           - Caulobacter sp. K31
          Length = 201

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +1

Query: 184 KVSGTVKWFNVKSGYGFINRND 249
           ++SG VKWF+   GYGFI  +D
Sbjct: 17  RISGRVKWFDTGKGYGFIVPDD 38


>UniRef50_A4U251 Cluster: Cold shock DNA-binding domain protein;
           n=3; Magnetospirillum|Rep: Cold shock DNA-binding domain
           protein - Magnetospirillum gryphiswaldense
          Length = 209

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRND 249
           V    V+ TVKWFN   G+GF+  +D
Sbjct: 47  VTQTNVTATVKWFNASKGFGFVAPSD 72


>UniRef50_Q5ENQ3 Cluster: Chloroplast lipoate protein ligase; n=1;
           Heterocapsa triquetra|Rep: Chloroplast lipoate protein
           ligase - Heterocapsa triquetra (Dinoflagellate)
          Length = 255

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 23/58 (39%), Positives = 28/58 (48%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYA 428
           +D FV   A    +P  +V SV D       V A E  F+A  V GPGGE   G+P A
Sbjct: 200 KDKFVTSLAAESADPTLSVASVMDT-----VVRAFEAEFQATAVDGPGGEDSGGAPAA 252


>UniRef50_A3EXS4 Cluster: RNA-binding protein LIN-28-like protein;
           n=1; Maconellicoccus hirsutus|Rep: RNA-binding protein
           LIN-28-like protein - Maconellicoccus hirsutus (hibiscus
           mealybug)
          Length = 124

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 18/36 (50%), Positives = 19/36 (52%)
 Frame = +3

Query: 336 VEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRR 443
           VEF      KG+EA  VTGP G    GS  A  KRR
Sbjct: 2   VEFECEETPKGYEATIVTGPNGNFCIGSQRAMGKRR 37


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 505,408,636
Number of Sequences: 1657284
Number of extensions: 7996447
Number of successful extensions: 28937
Number of sequences better than 10.0: 99
Number of HSP's better than 10.0 without gapping: 27729
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28913
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43562448615
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -