SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P55072 Cluster: Transitional endoplasmic reticulum ATPa...   131   2e-29
UniRef50_UPI0000E4A84B Cluster: PREDICTED: similar to valosin; n...   107   2e-22
UniRef50_A4ICJ9 Cluster: Transitional endoplasmic reticulum ATPa...   107   3e-22
UniRef50_Q4Y788 Cluster: Cell division cycle protein 48 homologu...    89   9e-17
UniRef50_Q7QWL6 Cluster: GLP_762_31096_33708; n=1; Giardia lambl...    65   1e-09
UniRef50_A0EEE7 Cluster: Chromosome undetermined scaffold_91, wh...    60   7e-08
UniRef50_A5KAB5 Cluster: Cell division cycle ATPase, putative; n...    45   0.002
UniRef50_Q4YQQ6 Cluster: Cell division cycle ATPase, putative; n...    41   0.025
UniRef50_A2FTG5 Cluster: ATPase, AAA family protein; n=1; Tricho...    40   0.076
UniRef50_Q4MZM6 Cluster: Cell division cycle protein 48, putativ...    39   0.10 
UniRef50_A7AVE1 Cluster: Cell division cycle protein ATPase, put...    39   0.10 
UniRef50_Q4UBT9 Cluster: Cell divison cycle CDC48 homologue, put...    36   0.93 
UniRef50_Q1JSD1 Cluster: Transitional endoplasmic reticulum ATPa...    34   3.8  
UniRef50_Q0W6B6 Cluster: Putative cell division cycle protein 48...    34   3.8  
UniRef50_Q8G5E4 Cluster: ATP binding protein of ABC transporter;...    33   6.6  

>UniRef50_P55072 Cluster: Transitional endoplasmic reticulum ATPase
           (TER ATPase) (15S Mg(2+)- ATPase p97 subunit); n=169;
           Eukaryota|Rep: Transitional endoplasmic reticulum ATPase
           (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) - Homo
           sapiens (Human)
          Length = 806

 Score =  131 bits (316), Expect = 2e-29
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  120 bits (288), Expect = 4e-26
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 6e-22
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>UniRef50_UPI0000E4A84B Cluster: PREDICTED: similar to valosin; n=3;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           valosin - Strongylocentrotus purpuratus
          Length = 596

 Score =  107 bits (258), Expect = 2e-22
 Identities = 50/68 (73%), Positives = 64/68 (94%)
 Frame = +3

Query: 51  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           MA+N S DD++TAILR K +PNRL+VEEA++DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MAEN-SGDDIATAILRTKAKPNRLVVEEAINDDNSVVSLSQAKMDELQLFRGDTVMLKGK 59

Query: 231 RRKETVCI 254
           +R++TVCI
Sbjct: 60  KRRDTVCI 67



 Score =  107 bits (256), Expect = 3e-22
 Identities = 46/59 (77%), Positives = 53/59 (89%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLGA 687
           GMRAVEFKVVETDP P+CIV+PDTVIH +G+ IKRE+EEE LN +GYDDIGGCRKQL +
Sbjct: 127 GMRAVEFKVVETDPGPYCIVSPDTVIHFEGDAIKREDEEENLNEIGYDDIGGCRKQLAS 185



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 18/28 (64%), Positives = 23/28 (82%)
 Frame = +2

Query: 428 NLFEVYLKPYFMEAYRPIHRDDTFMVRG 511
           NLF+VYL+PYF EAYRP+ + D F +RG
Sbjct: 99  NLFDVYLRPYFQEAYRPVRKGDIFQIRG 126


>UniRef50_A4ICJ9 Cluster: Transitional endoplasmic reticulum ATPase,
           putative; n=2; Leishmania|Rep: Transitional endoplasmic
           reticulum ATPase, putative - Leishmania infantum
          Length = 690

 Score =  107 bits (257), Expect = 3e-22
 Identities = 47/100 (47%), Positives = 63/100 (63%)
 Frame = +2

Query: 215 LAQGQTPQGNRLHLLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 394
           L +G+  +      + DD CP EKI+M             D + I PC  V YG RVH+L
Sbjct: 49  LVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIVPCKDVPYGNRVHLL 108

Query: 395 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRGA 514
           PIDD+VE LTG+LFE +LKPYF+E+YRP+ + D+F+ RGA
Sbjct: 109 PIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGA 148



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/49 (69%), Positives = 42/49 (85%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDI 660
           MR+VEFKVVE DP  +CIV+PDT+IH +G+PI R E+EEAL+ VGYDDI
Sbjct: 149 MRSVEFKVVEVDPGDYCIVSPDTIIHSEGDPIHR-EDEEALDGVGYDDI 196



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 31/54 (57%), Positives = 43/54 (79%)
 Frame = +3

Query: 102 KDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVCICSQ 263
           K + N+LIVEE  +DDNSVV+L+  +ME+L +FRGDTVL+KGK+ + TVCI  +
Sbjct: 11  KVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAME 64


>UniRef50_Q4Y788 Cluster: Cell division cycle protein 48 homologue,
           putative; n=4; Plasmodium|Rep: Cell division cycle
           protein 48 homologue, putative - Plasmodium chabaudi
          Length = 250

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = +2

Query: 215 LAQGQTPQGNRLHLLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 394
           L +G+        +L+D++  + KIR+             D+V +  CP + YGK++ +L
Sbjct: 59  LIKGKKRHSTICIILNDNDLDEGKIRINKVARKNLRVCLGDIVYVKACPEIPYGKKIQVL 118

Query: 395 PIDDSVEGLT-GNLFEVYLKPYFMEAYRPIHRDDTFMVRG 511
           PIDD++EGL    LFE++LKPYF E+YRP+ + D F+VRG
Sbjct: 119 PIDDTIEGLAKDTLFEIFLKPYFNESYRPVKKGDLFLVRG 158



 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 38/57 (66%), Positives = 49/57 (85%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           G  +VEFKVVE DP  FCIV+PDTVI+ +G+PIKR++EE+ L+ +GYDDIGGC+KQL
Sbjct: 159 GFMSVEFKVVEVDPDDFCIVSPDTVIYYEGDPIKRDDEEK-LDEIGYDDIGGCKKQL 214



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 36/66 (54%), Positives = 47/66 (71%)
 Frame = +3

Query: 57  DNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRR 236
           D K+  D +   L +K    RLIVEEA +DDNSVVAL+  +ME+L  FRGDT+L+KGK+R
Sbjct: 6   DTKTLGDDNNGKLPKKKNLCRLIVEEATNDDNSVVALNTKRMEELNFFRGDTILIKGKKR 65

Query: 237 KETVCI 254
             T+CI
Sbjct: 66  HSTICI 71


>UniRef50_Q7QWL6 Cluster: GLP_762_31096_33708; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_762_31096_33708 - Giardia lamblia
           ATCC 50803
          Length = 870

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 31/56 (55%), Positives = 36/56 (64%)
 Frame = +1

Query: 517 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLG 684
           R +EFKVV TDPSP CIV     I  +GEPI R+E E     VGY D+GG  K+LG
Sbjct: 174 REIEFKVVLTDPSPACIVMDGGEIFYEGEPIDRDEHERENTKVGYSDLGGLGKELG 229



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +3

Query: 114 NRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKET 245
           NR IV +    D+S + LS  K+  L LF+GD V LKG+  K T
Sbjct: 12  NRFIVNDNPGGDDSQIILSSEKVNVLDLFQGDYVRLKGRFGKTT 55



 Score = 33.9 bits (74), Expect = 3.8
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 23/86 (26%)
 Frame = +2

Query: 335 DVVSIAPCPSVKYGKRVHILPIDDSVEGL-----------------------TGNLFEVY 445
           D+V + P  ++ Y KR+ ++P +  +EGL                       T +LF++ 
Sbjct: 86  DIVILYPAQNLPYHKRIKVIPFEQDLEGLNIAGYTVKQGEDGKPAPAPFPGPTYDLFDIC 145

Query: 446 LKPYFMEAYRPIHRDDTFMVRGACAP 523
           + PYF +  RP+   +TF V     P
Sbjct: 146 IAPYFKDKCRPVTEGNTFKVMTTSLP 171


>UniRef50_A0EEE7 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 772

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/47 (59%), Positives = 37/47 (78%)
 Frame = +3

Query: 114 NRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVCI 254
           NRL+V E+ +DDNSVV L Q K+ +L+LF+GD VLL+GK  K+TV I
Sbjct: 17  NRLMVCESTADDNSVVQLCQDKLNELKLFKGDMVLLEGKNNKKTVAI 63



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +2

Query: 281 EKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTG-NLFEVYLKPY 457
           E + M             D ++I P  S+    +VHILP  DS+ G    NL + YL PY
Sbjct: 72  ESVHMNSVIRKNLGIQIGDFITIQPTASLPQLTKVHILPFQDSISGTNEKNLTQNYLIPY 131

Query: 458 FMEAYRPIHRDDTFMVRGA 514
           F++AYRP+ + D F+V+ A
Sbjct: 132 FLDAYRPVSKGDCFVVKMA 150



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +1

Query: 517 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEE--EEALNAVGYDDIGGCRKQL 681
           + +EFK++ T+P    +V P T+++ +G  +KRE E  E+  N  GY +IGG  KQL
Sbjct: 151 KEIEFKIIATEPEDMGVVGPITILYTEGGTVKREIENKEQFDNQNGYANIGGMNKQL 207


>UniRef50_A5KAB5 Cluster: Cell division cycle ATPase, putative; n=1;
           Plasmodium vivax|Rep: Cell division cycle ATPase,
           putative - Plasmodium vivax
          Length = 1089

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query: 111 PNRLIVEEAVSD-DNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVCI 254
           P+  +VE      DN  + LS+AKME+L L  G TVLLKGK++KE + I
Sbjct: 270 PSYCLVENVDEQIDNCEIYLSKAKMEELNLSEGFTVLLKGKKKKEMLAI 318



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 568 VAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           V  + +I  D E + RE+ EE  + + Y+D+GG +KQL
Sbjct: 448 VGDNAIITLDEEYLNREDYEEHTDDITYEDLGGMKKQL 485


>UniRef50_Q4YQQ6 Cluster: Cell division cycle ATPase, putative; n=3;
           Plasmodium (Vinckeia)|Rep: Cell division cycle ATPase,
           putative - Plasmodium berghei
          Length = 932

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query: 111 PNRLIVEEAVSD-DNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVCI 254
           PN  +VE    + DN  + +S+ KM++L +  G TVLLKGK++KE V I
Sbjct: 101 PNYCLVENIDENADNFDIYMSKEKMKELNINDGFTVLLKGKKKKEMVAI 149


>UniRef50_A2FTG5 Cluster: ATPase, AAA family protein; n=1;
           Trichomonas vaginalis G3|Rep: ATPase, AAA family protein
           - Trichomonas vaginalis G3
          Length = 1041

 Score = 39.5 bits (88), Expect = 0.076
 Identities = 22/55 (40%), Positives = 27/55 (49%)
 Frame = +1

Query: 517 RAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           R +EFKVV   P    I+    VI    +PI RE      + V YD IGG  KQ+
Sbjct: 140 RVIEFKVVNCSPEEEVIIQDKEVILYRNQPIHRENIN--FSTVSYDSIGGLHKQI 192


>UniRef50_Q4MZM6 Cluster: Cell division cycle protein 48, putative;
           n=1; Theileria parva|Rep: Cell division cycle protein
           48, putative - Theileria parva
          Length = 954

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 565 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           ++  ++VI   G  + RE  +++   VGYDDIGG  KQL
Sbjct: 336 LIVGESVIDSSGNYLTRENHDDSYGEVGYDDIGGMNKQL 374



 Score = 32.7 bits (71), Expect = 8.7
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 144 DDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVC 251
           + N  V + +A+  +L +  GD + +KG+RRK TVC
Sbjct: 154 NSNVNVRIGKAQANKLSVMPGDLLKVKGRRRKVTVC 189


>UniRef50_A7AVE1 Cluster: Cell division cycle protein ATPase,
           putative; n=1; Babesia bovis|Rep: Cell division cycle
           protein ATPase, putative - Babesia bovis
          Length = 922

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +1

Query: 565 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           +++ ++V+ C G  + RE+ + +   +GYD+IGG  KQL
Sbjct: 332 LISGESVLDCSGPSLTREQHDASYGELGYDEIGGMDKQL 370


>UniRef50_Q4UBT9 Cluster: Cell divison cycle CDC48 homologue,
           putative or transitional endoplasmic reticulum ATPase,
           putative; n=1; Theileria annulata|Rep: Cell divison
           cycle CDC48 homologue, putative or transitional
           endoplasmic reticulum ATPase, putative - Theileria
           annulata
          Length = 905

 Score = 35.9 bits (79), Expect = 0.93
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +1

Query: 565 IVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           ++  ++VI   G  + RE+++ +   VGYDDIGG  KQL
Sbjct: 312 LIVGESVIDSGGNYLSREDDD-SFGEVGYDDIGGMNKQL 349


>UniRef50_Q1JSD1 Cluster: Transitional endoplasmic reticulum ATPase;
           n=1; Toxoplasma gondii|Rep: Transitional endoplasmic
           reticulum ATPase - Toxoplasma gondii
          Length = 792

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +3

Query: 180 MEQLQLFRGDTVLLKGKRRKETVCI 254
           M  LQ+ RGD VLL G+R++ETV I
Sbjct: 1   MAALQVQRGDVVLLSGRRKRETVAI 25


>UniRef50_Q0W6B6 Cluster: Putative cell division cycle protein 48;
           n=1; uncultured methanogenic archaeon RC-I|Rep: Putative
           cell division cycle protein 48 - Uncultured methanogenic
           archaeon RC-I
          Length = 942

 Score = 33.9 bits (74), Expect = 3.8
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +1

Query: 529 FKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLG 684
           F V  T P+   I    T +    +P++ E+ E+  + + Y+DIGG R+++G
Sbjct: 142 FVVTNTRPAGTVIADMSTEVTISEKPVEAEKAEKTPH-ISYEDIGGLRREIG 192


>UniRef50_Q8G5E4 Cluster: ATP binding protein of ABC transporter;
           n=14; Actinobacteria (class)|Rep: ATP binding protein of
           ABC transporter - Bifidobacterium longum
          Length = 467

 Score = 33.1 bits (72), Expect = 6.6
 Identities = 21/75 (28%), Positives = 32/75 (42%)
 Frame = +1

Query: 424 WQSIRSILEAVLHGGLPSDPS*RHLHGPRGMRAVEFKVVETDPSPFCIVAPDTVIHCDGE 603
           WQ +R  L+ V  GGL  D S RHL G +  R     V+   P    +  P   +  +G 
Sbjct: 96  WQRVRESLDMVGLGGLELDRSTRHLSGGQRQRLALAGVLAMKPGLLLLDEPTANLDPEGV 155

Query: 604 PIKREEEEEALNAVG 648
               +  ++ + A G
Sbjct: 156 VEVHDAVKKVIEATG 170


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 697,164,711
Number of Sequences: 1657284
Number of extensions: 14214177
Number of successful extensions: 37600
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 36292
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37590
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54132236449
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -