SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4S6V3 Cluster: T-complex protein 1, alpha subunit; n=3...   144   1e-33
UniRef50_P17987 Cluster: T-complex protein 1 subunit alpha; n=21...   144   1e-33
UniRef50_Q4UCP7 Cluster: T-complex protein 1, alpha subunit; n=3...   117   2e-25
UniRef50_UPI0000498BB7 Cluster: T-complex protein 1 alpha subuni...   110   3e-23
UniRef50_Q7QUT9 Cluster: T-complex protein 1, alpha subunit; n=1...   104   2e-21
UniRef50_A2ESJ6 Cluster: T-complex protein 1, alpha subunit; n=8...    96   6e-19
UniRef50_A2XJL6 Cluster: Putative uncharacterized protein; n=1; ...    89   7e-17
UniRef50_Q8THU8 Cluster: Hsp60; n=4; Archaea|Rep: Hsp60 - Methan...    89   7e-17
UniRef50_P78371 Cluster: T-complex protein 1 subunit beta; n=145...    89   7e-17
UniRef50_O24734 Cluster: Thermosome subunit alpha; n=24; Thermop...    88   2e-16
UniRef50_Q8SSC9 Cluster: T COMPLEX PROTEIN 1 ALPHA SUBUNIT; n=1;...    87   2e-16
UniRef50_Q9V2T7 Cluster: Thermosome subunit gamma; n=10; Sulfolo...    87   4e-16
UniRef50_Q9HNI0 Cluster: Thermosome subunit beta; n=13; Euryarch...    86   7e-16
UniRef50_Q4T337 Cluster: Chromosome undetermined SCAF10125, whol...    84   2e-15
UniRef50_Q9V2Q7 Cluster: Thermosome subunit; n=20; Euryarchaeota...    84   2e-15
UniRef50_P50016 Cluster: Thermosome subunit; n=20; Archaea|Rep: ...    84   2e-15
UniRef50_Q9V2S9 Cluster: Thermosome subunit alpha; n=34; Archaea...    84   2e-15
UniRef50_UPI0000E4850D Cluster: PREDICTED: hypothetical protein;...    84   3e-15
UniRef50_Q0W8R0 Cluster: Chaperonin Hsp60; n=1; uncultured metha...    84   3e-15
UniRef50_O30560 Cluster: Thermosome subunit 2; n=8; Euryarchaeot...    83   5e-15
UniRef50_P49368 Cluster: T-complex protein 1 subunit gamma; n=14...    81   2e-14
UniRef50_Q4PBE2 Cluster: T-complex protein 1, delta subunit; n=1...    79   6e-14
UniRef50_Q2FPE0 Cluster: Chaperonin Cpn60/TCP-1; n=4; Methanomic...    79   6e-14
UniRef50_A2F520 Cluster: Chaperonin subunit gamma CCTgamma, puta...    79   8e-14
UniRef50_Q9HHA2 Cluster: Thermosome subunit 3; n=5; root|Rep: Th...    79   8e-14
UniRef50_Q12UN6 Cluster: Thermosome subunit, group II chaperonin...    78   2e-13
UniRef50_A7I531 Cluster: Chaperonin Cpn60/TCP-1; n=1; Candidatus...    78   2e-13
UniRef50_Q7ZTS3 Cluster: Cct7 protein; n=17; Deuterostomia|Rep: ...    77   3e-13
UniRef50_A7PW56 Cluster: Chromosome chr8 scaffold_34, whole geno...    77   3e-13
UniRef50_O81503 Cluster: F9D12.18 protein; n=16; Eukaryota|Rep: ...    76   5e-13
UniRef50_Q4E151 Cluster: Chaperonin, putative; n=5; Trypanosomat...    76   5e-13
UniRef50_Q99832 Cluster: T-complex protein 1 subunit eta; n=135;...    76   5e-13
UniRef50_Q8Q0R4 Cluster: Thermosome subunit; n=4; Methanosarcina...    75   2e-12
UniRef50_P50991 Cluster: T-complex protein 1 subunit delta; n=13...    75   2e-12
UniRef50_Q22MB3 Cluster: TCP-1/cpn60 chaperonin family protein; ...    74   2e-12
UniRef50_A0DD79 Cluster: T-complex protein 1, delta subunit; n=1...    74   2e-12
UniRef50_Q4MYW8 Cluster: T-complex protein 1, beta subunit, puta...    74   3e-12
UniRef50_A6S086 Cluster: Putative uncharacterized protein; n=1; ...    74   3e-12
UniRef50_Q4N0D4 Cluster: T-complex protein 1, eta subunit, putat...    73   4e-12
UniRef50_Q4UAK0 Cluster: T-complex protein 1 (TCP1) chaperonin, ...    73   5e-12
UniRef50_P48643 Cluster: T-complex protein 1 subunit epsilon; n=...    73   5e-12
UniRef50_Q98S82 Cluster: T-complex protein 1, alpha subunit; n=1...    73   7e-12
UniRef50_A0DJZ0 Cluster: Chromosome undetermined scaffold_53, wh...    73   7e-12
UniRef50_Q7QZG3 Cluster: GLP_159_66836_65142; n=2; Giardia intes...    72   1e-11
UniRef50_A2FL92 Cluster: TCP-1/cpn60 chaperonin family protein; ...    71   2e-11
UniRef50_P50990 Cluster: T-complex protein 1 subunit theta; n=76...    71   2e-11
UniRef50_Q2NHT5 Cluster: ThsA; n=1; Methanosphaera stadtmanae DS...    69   6e-11
UniRef50_Q8SR76 Cluster: T COMPLEX PROTEIN 1 GAMMA SUBUNIT; n=1;...    69   8e-11
UniRef50_Q8THX2 Cluster: Hsp60; n=2; Methanosarcina acetivorans|...    68   2e-10
UniRef50_Q7QR58 Cluster: GLP_301_27994_26207; n=3; Eukaryota|Rep...    65   1e-09
UniRef50_Q9N358 Cluster: T-complex protein 1 subunit theta; n=1;...    65   1e-09
UniRef50_Q54PX2 Cluster: Putative uncharacterized protein; n=1; ...    64   2e-09
UniRef50_P40227 Cluster: T-complex protein 1 subunit zeta; n=71;...    64   2e-09
UniRef50_Q98RX6 Cluster: T-complex protein 1, delta subunit; n=1...    63   4e-09
UniRef50_Q98S23 Cluster: T-complex protein 1 beta SU; n=1; Guill...    63   5e-09
UniRef50_Q7R1S9 Cluster: GLP_190_44957_46648; n=2; Giardia intes...    63   5e-09
UniRef50_UPI00005A1481 Cluster: PREDICTED: similar to T-complex ...    62   7e-09
UniRef50_UPI000049A5F1 Cluster: T-complex protein 1 theta subuni...    62   7e-09
UniRef50_P39079 Cluster: T-complex protein 1 subunit zeta; n=50;...    62   7e-09
UniRef50_Q5CTZ7 Cluster: Putative T complex chaperonin; n=2; Cry...    61   2e-08
UniRef50_Q55BE5 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q8SQP2 Cluster: T COMPLEX PROTEIN 1 BETA SUBUNIT; n=1; ...    60   4e-08
UniRef50_A7D1F1 Cluster: Chaperonin Cpn60/TCP-1; n=1; Halorubrum...    60   5e-08
UniRef50_P47828 Cluster: T-complex protein 1 subunit theta; n=2;...    60   5e-08
UniRef50_Q8SSH3 Cluster: T COMPLEX PROTEIN 1 DELTA SUBUNIT; n=1;...    58   2e-07
UniRef50_Q5V6S3 Cluster: Thermosome alpha subunit; n=1; Haloarcu...    58   2e-07
UniRef50_P46550 Cluster: T-complex protein 1 subunit zeta; n=22;...    58   2e-07
UniRef50_P47079 Cluster: T-complex protein 1 subunit theta; n=32...    58   2e-07
UniRef50_A2Z9B2 Cluster: T-complex protein 1, delta subunit; n=1...    57   3e-07
UniRef50_Q9GYV7 Cluster: Chaperonin-containing TCP-1, zeta subun...    57   4e-07
UniRef50_A2DR42 Cluster: Chaperonin subunit zeta CCTzeta; n=2; T...    57   4e-07
UniRef50_Q7R133 Cluster: GLP_12_22978_24657; n=9; Eukaryota|Rep:...    56   6e-07
UniRef50_Q98S00 Cluster: T-complex protein1, epsilon-SU; n=1; Gu...    55   1e-06
UniRef50_Q4N6Q7 Cluster: Chaperonin 60 kDa, putative; n=3; Pirop...    55   1e-06
UniRef50_Q7NEX9 Cluster: 60 kDa chaperonin; n=1; Gloeobacter vio...    54   2e-06
UniRef50_Q8SR53 Cluster: T COMPLEX PROTEIN 1 ETA SUBUNIT; n=1; E...    54   2e-06
UniRef50_Q7RHQ2 Cluster: T-complex protein 1; n=5; Plasmodium|Re...    53   6e-06
UniRef50_A1HR08 Cluster: 60 kDa chaperonin; n=3; Clostridiales|R...    52   8e-06
UniRef50_A4QPH3 Cluster: CESK1 protein; n=12; Theria|Rep: CESK1 ...    52   1e-05
UniRef50_Q29236 Cluster: T-complex protein 1 subunit zeta; n=15;...    52   1e-05
UniRef50_Q3AF10 Cluster: 60 kDa chaperonin; n=1; Carboxydothermu...    52   1e-05
UniRef50_Q3ILY6 Cluster: Thermosome subunit 4; n=1; Natronomonas...    51   2e-05
UniRef50_Q9XG35 Cluster: T-complex protein gamma SU; n=1; Guilla...    51   2e-05
UniRef50_Q54TX7 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q554F9 Cluster: Putative uncharacterized protein; n=2; ...    49   9e-05
UniRef50_A7TAW5 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    49   9e-05
UniRef50_UPI000155C75D Cluster: PREDICTED: similar to T-complex ...    48   2e-04
UniRef50_Q98S92 Cluster: T-complex protein1 eta SU; n=1; Guillar...    44   0.004
UniRef50_Q86H80 Cluster: Similar to Mus musculus (Mouse). T-comp...    43   0.006
UniRef50_Q5CLK3 Cluster: Hsp60; n=10; Cryptosporidium|Rep: Hsp60...    42   0.014
UniRef50_Q2GQ09 Cluster: Putative uncharacterized protein; n=2; ...    42   0.014
UniRef50_Q9AW35 Cluster: T-complex protein 1, zeta SU; n=2; Euka...    41   0.025
UniRef50_A2E548 Cluster: TCP-1/cpn60 chaperonin family protein; ...    41   0.025
UniRef50_Q8RIT4 Cluster: 60 kDa chaperonin; n=5; Desulfitobacter...    40   0.058
UniRef50_Q94596 Cluster: Chaperonin HSP60, mitochondrial precurs...    40   0.058
UniRef50_P10809 Cluster: 60 kDa heat shock protein, mitochondria...    39   0.077
UniRef50_UPI0001509EE1 Cluster: TCP-1/cpn60 chaperonin family pr...    39   0.10 
UniRef50_UPI0000D66C43 Cluster: PREDICTED: similar to Heat shock...    38   0.13 
UniRef50_Q4N0D8 Cluster: Chaperonin 60 kDa, putative; n=3; Pirop...    38   0.13 
UniRef50_A7I798 Cluster: Chaperonin GroEL; n=2; cellular organis...    38   0.13 
UniRef50_Q6YR94 Cluster: 60 kDa chaperonin; n=31; cellular organ...    38   0.13 
UniRef50_P34940 Cluster: Chaperonin CPN60, mitochondrial precurs...    38   0.23 
UniRef50_Q7RFB5 Cluster: Chaperonin cpn60, mitochondrial; n=1; P...    37   0.31 
UniRef50_Q1GVZ9 Cluster: 60 kDa chaperonin 1; n=122; cellular or...    37   0.31 
UniRef50_Q4S9T9 Cluster: Chromosome 2 SCAF14695, whole genome sh...    37   0.41 
UniRef50_P47632 Cluster: 60 kDa chaperonin; n=15; Bacteria|Rep: ...    37   0.41 
UniRef50_Q7XKP6 Cluster: OSJNBb0013O03.10 protein; n=3; Oryza sa...    36   0.54 
UniRef50_A7RRC2 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.54 
UniRef50_P21238 Cluster: RuBisCO large subunit-binding protein s...    36   0.72 
UniRef50_Q9FXL5 Cluster: Chaperonin-60 alpha subunit; n=3; Magno...    35   1.3  
UniRef50_Q870E6 Cluster: Heat shock protein 60; n=1; Piromyces s...    35   1.3  
UniRef50_P0A521 Cluster: 60 kDa chaperonin 2; n=1802; cellular o...    35   1.3  
UniRef50_Q25BV5 Cluster: 60 kDa chaperonin; n=1; Methylomicrobiu...    35   1.7  
UniRef50_Q9AW47 Cluster: Chaperonin-containing-TCP1 theta subuni...    35   1.7  
UniRef50_P08823 Cluster: RuBisCO large subunit-binding protein s...    35   1.7  
UniRef50_Q47TE8 Cluster: 60 kDa chaperonin 1; n=4; cellular orga...    35   1.7  
UniRef50_Q55EH3 Cluster: Putative uncharacterized protein; n=1; ...    34   2.2  
UniRef50_UPI00005A5A84 Cluster: PREDICTED: similar to heat shock...    34   2.9  
UniRef50_Q8RIT3 Cluster: 60 kDa chaperonin; n=4; Desulfitobacter...    34   2.9  
UniRef50_Q95UT0 Cluster: CPN60; n=1; Spironucleus barkhanus|Rep:...    34   2.9  
UniRef50_Q4YYM6 Cluster: Chaperone, putative; n=4; Plasmodium (V...    34   2.9  
UniRef50_P29842 Cluster: 60 kDa chaperonin; n=18; Betaproteobact...    34   2.9  
UniRef50_Q9VPS5 Cluster: 60 kDa heat shock protein homolog 1, mi...    34   2.9  
UniRef50_Q7NT31 Cluster: 60 kDa chaperonin 1; n=44; cellular org...    34   2.9  
UniRef50_UPI0000E46238 Cluster: PREDICTED: similar to chaperonin...    33   3.8  
UniRef50_Q1GFR8 Cluster: Carbon monoxide dehydrogenase large cha...    33   3.8  
UniRef50_A7P765 Cluster: Chromosome chr9 scaffold_7, whole genom...    33   3.8  
UniRef50_Q8VB89 Cluster: Wsv094; n=1; Shrimp white spot syndrome...    33   6.7  
UniRef50_Q010P5 Cluster: Chaperonin-60, mitochondrial; n=2; cell...    33   6.7  
UniRef50_P21240 Cluster: RuBisCO large subunit-binding protein s...    33   6.7  
UniRef50_P59698 Cluster: 60 kDa chaperonin 2; n=3; Chlamydophila...    33   6.7  
UniRef50_Q4REW1 Cluster: Chromosome 13 SCAF15122, whole genome s...    32   8.8  
UniRef50_Q8F380 Cluster: Putative uncharacterized protein; n=4; ...    32   8.8  
UniRef50_A5EYB7 Cluster: Macrolide-specific ABC-type efflux prot...    32   8.8  
UniRef50_A5ESP5 Cluster: Ribonuclease P protein component; n=11;...    32   8.8  
UniRef50_Q4Q711 Cluster: Chaperonin HSP60/CNP60, putative; n=6; ...    32   8.8  
UniRef50_A0C3G4 Cluster: Chromosome undetermined scaffold_147, w...    32   8.8  
UniRef50_O34191 Cluster: 60 kDa chaperonin; n=148; Rickettsiales...    32   8.8  

>UniRef50_Q4S6V3 Cluster: T-complex protein 1, alpha subunit; n=3;
           Euteleostomi|Rep: T-complex protein 1, alpha subunit -
           Tetraodon nigroviridis (Green puffer)
          Length = 532

 Score =  144 bits (350), Expect = 1e-33
 Identities = 70/92 (76%), Positives = 79/92 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLK+ADELVK KIHPTS+ISGY
Sbjct: 65  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSVISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NLT+  + LGR  LI   K
Sbjct: 125 RLACKEAVRYINENLTIATDDLGRECLINAAK 156



 Score = 99.5 bits (237), Expect = 5e-20
 Identities = 48/67 (71%), Positives = 54/67 (80%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MS +  PL+V G R+ GD VRTQNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+
Sbjct: 1   MSLLDGPLNVLGQRTTGDSVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITND 60

Query: 234 GATILKM 254
           GATILK+
Sbjct: 61  GATILKL 67



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/27 (74%), Positives = 24/27 (88%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDAA 588
           + AKT+MSSK+IG DADFF+ MVVDAA
Sbjct: 153 NAAKTSMSSKIIGVDADFFANMVVDAA 179


>UniRef50_P17987 Cluster: T-complex protein 1 subunit alpha; n=218;
           root|Rep: T-complex protein 1 subunit alpha - Homo
           sapiens (Human)
          Length = 556

 Score =  144 bits (350), Expect = 1e-33
 Identities = 71/92 (77%), Positives = 78/92 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLKNADELVK KIHPTS+ISGY
Sbjct: 62  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY 121

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NL V  + LGR  LI   K
Sbjct: 122 RLACKEAVRYINENLIVNTDELGRDCLINAAK 153



 Score = 94.7 bits (225), Expect = 1e-18
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +3

Query: 72  PLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           PLSV G RS G+ +R+QNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+GATILK
Sbjct: 4   PLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILK 63

Query: 252 M 254
           +
Sbjct: 64  L 64



 Score = 39.5 bits (88), Expect = 0.058
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG + DFF+ MVVDA
Sbjct: 150 NAAKTSMSSKIIGINGDFFANMVVDA 175


>UniRef50_Q4UCP7 Cluster: T-complex protein 1, alpha subunit; n=3;
           Piroplasmida|Rep: T-complex protein 1, alpha subunit -
           Theileria annulata
          Length = 548

 Score =  117 bits (281), Expect = 2e-25
 Identities = 52/92 (56%), Positives = 79/92 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EV+HPAAK+LV+L++LQD+EVGDGTTSVV+IAAELLK A+ L  + IHPTSII+GY
Sbjct: 60  LKQLEVQHPAAKLLVDLSELQDQEVGDGTTSVVLIAAELLKRANALANSGIHPTSIITGY 119

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           ++A +E+VK+I+D+++++++S+G   L+   K
Sbjct: 120 KMALRESVKFIRDHMSLSLDSMGTEVLMNIAK 151



 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           + + G R+ G  VR  NV       NI+KSSLGP GLDKMLVDD+GDVT+TN+GAT+LK
Sbjct: 3   VGILGHRTTGKEVRAGNVNAVQAIANILKSSLGPKGLDKMLVDDLGDVTITNDGATMLK 61



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 14/24 (58%), Positives = 22/24 (91%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           AKTT+SSKL+G D+++F+++VV A
Sbjct: 150 AKTTLSSKLVGFDSEYFAQLVVKA 173


>UniRef50_UPI0000498BB7 Cluster: T-complex protein 1 alpha subunit;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: T-complex
           protein 1 alpha subunit - Entamoeba histolytica
           HM-1:IMSS
          Length = 544

 Score =  110 bits (264), Expect = 3e-23
 Identities = 55/87 (63%), Positives = 70/87 (80%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVLVELA LQD+EVGDGTT+VVI+AAELLK  +EL+K KIHP+++I G+
Sbjct: 65  LKLLEVEHPAAKVLVELADLQDKEVGDGTTTVVILAAELLKYGNELIKQKIHPSTVIQGF 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSL 505
           RLA +EAVK+I+  + V    L R  L
Sbjct: 125 RLAMQEAVKFIR-KIVVHTNELDRKVL 150



 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/67 (61%), Positives = 48/67 (71%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           M+     L + G R  G  VRTQNVM      N+VK+S GPVGLDKMLVDDIGDVT+TN+
Sbjct: 1   MAYARTDLPLNGERESGADVRTQNVMAAVAIANVVKTSFGPVGLDKMLVDDIGDVTITND 60

Query: 234 GATILKM 254
           GATILK+
Sbjct: 61  GATILKL 67


>UniRef50_Q7QUT9 Cluster: T-complex protein 1, alpha subunit; n=1;
           Giardia lamblia ATCC 50803|Rep: T-complex protein 1,
           alpha subunit - Giardia lamblia ATCC 50803
          Length = 416

 Score =  104 bits (249), Expect = 2e-21
 Identities = 48/88 (54%), Positives = 64/88 (72%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V HPAAK+LVEL+ LQD EVGDGTTSVVI A+E LK ADEL+   +HPT +I GY
Sbjct: 63  LQKLNVAHPAAKILVELSSLQDREVGDGTTSVVIFASEFLKEADELIGRNMHPTIVIEGY 122

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           +LA K+A+ YI+  L V   +L R + +
Sbjct: 123 QLALKKALNYIEKRLKVNASALTRENFL 150



 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 26/55 (47%), Positives = 40/55 (72%)
 Frame = +3

Query: 87  GTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           G  + G+ VR +N+        I++++LGP G+DKML+D +G+VTVTN+GATIL+
Sbjct: 10  GELNSGNSVRKENISATTALAGIIRTTLGPTGMDKMLIDSMGEVTVTNDGATILQ 64


>UniRef50_A2ESJ6 Cluster: T-complex protein 1, alpha subunit; n=8;
           Eukaryota|Rep: T-complex protein 1, alpha subunit -
           Trichomonas vaginalis G3
          Length = 543

 Score = 95.9 bits (228), Expect = 6e-19
 Identities = 41/92 (44%), Positives = 69/92 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           + +++V+HPA KVL++L++LQD EVGDGTT+VV++AAELL+   +L+  K+H  +II+GY
Sbjct: 66  LNHLDVQHPAGKVLIQLSELQDREVGDGTTTVVLLAAELLRLGQDLIDKKVHANTIITGY 125

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           R A K+A+ +++ +  V+ ++L R  L+   K
Sbjct: 126 RAAAKKAIAFLKKSCAVSNDNLDREILLKVAK 157



 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 38/58 (65%), Positives = 45/58 (77%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           L + G R  GD VRTQNV       N+V+SSLGP+GLDKMLVDDIG+VT+TN+GATIL
Sbjct: 9   LKIDGQRQQGDNVRTQNVRAAMAVANVVRSSLGPIGLDKMLVDDIGEVTITNDGATIL 66



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/24 (62%), Positives = 20/24 (83%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           AKT+M+SK++ A +DFF  MVVDA
Sbjct: 156 AKTSMNSKILNAYSDFFGNMVVDA 179


>UniRef50_A2XJL6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 449

 Score = 89.0 bits (211), Expect = 7e-17
 Identities = 37/63 (58%), Positives = 57/63 (90%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ +++PAAKVLV+++++QD+EVGDGTTSVV++A ELL+ A++LV  KIHP +II+GY
Sbjct: 64  LKSLHIDNPAAKVLVDISKVQDDEVGDGTTSVVVLAGELLREAEKLVNMKIHPMTIIAGY 123

Query: 425 RLA 433
           R+A
Sbjct: 124 RMA 126



 Score = 39.1 bits (87), Expect = 0.077
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIG---DVTVTNEGATILK 251
           G+  R    +      ++VK++LGP G+DK+L    G    VTVTN+GATILK
Sbjct: 14  GERARMAAFIGAMAIADLVKTTLGPKGMDKIL-QSTGRGRSVTVTNDGATILK 65


>UniRef50_Q8THU8 Cluster: Hsp60; n=4; Archaea|Rep: Hsp60 -
           Methanosarcina acetivorans
          Length = 543

 Score = 89.0 bits (211), Expect = 7e-17
 Identities = 39/78 (50%), Positives = 59/78 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++EHP AK++VE+A+ QD EVGDGTT+  ++A E L  A+EL+++ +HPT I SGY
Sbjct: 66  LKEMDIEHPGAKMIVEVAKTQDAEVGDGTTTAAVLAGEFLTKAEELLESGVHPTLIASGY 125

Query: 425 RLACKEAVKYIQDNLTVT 478
           RLA  +A K I D +T++
Sbjct: 126 RLAATQAAK-ILDTVTIS 142



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R+ G   +  N+M        V+++LGP G+DKMLVD +GDV +TN+GATILK
Sbjct: 15  RTHGSDAQHNNIMAAKAVAEAVRTTLGPKGMDKMLVDSMGDVVITNDGATILK 67


>UniRef50_P78371 Cluster: T-complex protein 1 subunit beta; n=145;
           Eukaryota|Rep: T-complex protein 1 subunit beta - Homo
           sapiens (Human)
          Length = 535

 Score = 89.0 bits (211), Expect = 7e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.033
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>UniRef50_O24734 Cluster: Thermosome subunit alpha; n=24;
           Thermoprotei|Rep: Thermosome subunit alpha - Sulfolobus
           tokodaii
          Length = 559

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 43/90 (47%), Positives = 61/90 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E++HPAAK+LVE A+ QD EVGDGTTS V++A  LL  AD+L+   IHPT II GY
Sbjct: 66  VKEMEIQHPAAKLLVEAAKAQDAEVGDGTTSAVVLAGLLLDKADDLLDQNIHPTIIIEGY 125

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQ 514
           + A  ++++ I D L   ++     SL T+
Sbjct: 126 KKALNKSLEII-DQLATKIDVSNLNSLATR 154



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           RS G      N++       ++KSSLGP GLDKML+D  GDVT+TN+GATI+K
Sbjct: 15  RSSGRDALKNNILAAVTLAEMLKSSLGPRGLDKMLIDSFGDVTITNDGATIVK 67


>UniRef50_Q8SSC9 Cluster: T COMPLEX PROTEIN 1 ALPHA SUBUNIT; n=1;
           Encephalitozoon cuniculi|Rep: T COMPLEX PROTEIN 1 ALPHA
           SUBUNIT - Encephalitozoon cuniculi
          Length = 540

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 37/87 (42%), Positives = 65/87 (74%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++N+ ++ PAAK+LV+LA  QD EVGDGTTSVV+IA  L++   +L+ + +HP+ ++SGY
Sbjct: 67  LQNMLIDDPAAKILVDLATQQDHEVGDGTTSVVLIAVSLIEKGAKLIASGVHPSVVVSGY 126

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSL 505
           ++A  E V++I+ +++ +  +LG  +L
Sbjct: 127 KMAFNECVQFIKKSMSKSTLNLGSKAL 153



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/34 (61%), Positives = 29/34 (85%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N +K+S GP+GLDKM VD  G+V++TN+GATIL+
Sbjct: 35  NAIKTSFGPLGLDKMCVDSAGEVSITNDGATILQ 68


>UniRef50_Q9V2T7 Cluster: Thermosome subunit gamma; n=10;
           Sulfolobus|Rep: Thermosome subunit gamma - Sulfolobus
           solfataricus
          Length = 535

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 38/73 (52%), Positives = 56/73 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+EV+HP AK+L+E A+  D EVGDGTTSVV++A  LL+ A++L+  KIHPT II GY
Sbjct: 61  VKNMEVQHPTAKLLIETAKTVDTEVGDGTTSVVVLAGLLLEKAEDLLNQKIHPTVIIEGY 120

Query: 425 RLACKEAVKYIQD 463
           R A   +++ +++
Sbjct: 121 RKALNSSLELLKN 133



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           RS G+ V   N+        ++KSSLGP GLDKMLV+   DVT+TN+GATI+K
Sbjct: 11  RSTGNEVILNNIAVAKILLEMLKSSLGPKGLDKMLVEG-QDVTITNDGATIVK 62


>UniRef50_Q9HNI0 Cluster: Thermosome subunit beta; n=13;
           Euryarchaeota|Rep: Thermosome subunit beta -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 556

 Score = 85.8 bits (203), Expect = 7e-16
 Identities = 37/80 (46%), Positives = 63/80 (78%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++++P A+++VE+A+ Q++E GDGTT+ V IA ELLKNA++L++  IHPT+II GY
Sbjct: 72  LQEMDIDNPTAEMIVEVAETQEDEAGDGTTTAVAIAGELLKNAEDLLERDIHPTAIIKGY 131

Query: 425 RLACKEAVKYIQDNLTVTVE 484
            LA ++A + + DN+ V V+
Sbjct: 132 NLAAEQAREEV-DNVAVDVD 150



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N+       + V+S+LGP G+DKMLV  +GDVTVTN+G TIL+
Sbjct: 31  NISAARAVADAVRSTLGPKGMDKMLVSSMGDVTVTNDGVTILQ 73


>UniRef50_Q4T337 Cluster: Chromosome undetermined SCAF10125, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF10125, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 585

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 36/88 (40%), Positives = 66/88 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A ELL  A++ ++ ++HPT IIS Y
Sbjct: 64  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGELLSVAEQFLEQQMHPTVIISAY 123

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           R A  + ++ +++ ++  V++  R  ++
Sbjct: 124 RRALDDMLESLKE-ISTPVDTSDRSMML 150



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 13/34 (38%), Positives = 25/34 (73%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +++++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 32  DVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILR 65


>UniRef50_Q9V2Q7 Cluster: Thermosome subunit; n=20;
           Euryarchaeota|Rep: Thermosome subunit - Pyrococcus
           abyssi
          Length = 550

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 38/80 (47%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HPAAK++VE+A+ QD+E GDGTT+ V+IA ELLK A+EL+   IHP+ +I GY
Sbjct: 69  LDEMDIQHPAAKMMVEVAKTQDKEAGDGTTTAVVIAGELLKKAEELLDQNIHPSIVIKGY 128

Query: 425 RLACKEAVKYIQDNLTVTVE 484
            LA ++A + I D++   V+
Sbjct: 129 MLAAEKA-QEILDSIAKEVK 147



 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 23/52 (44%), Positives = 34/52 (65%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           R  G   +  N++        V+++LGP G+DKMLVD +GD+ +TN+GATIL
Sbjct: 18  RYVGRDAQRMNILAARIIAETVRTTLGPKGMDKMLVDSLGDIVITNDGATIL 69


>UniRef50_P50016 Cluster: Thermosome subunit; n=20; Archaea|Rep:
           Thermosome subunit - Methanopyrus kandleri
          Length = 545

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 34/73 (46%), Positives = 59/73 (80%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++EHPAAK++VE+A+ Q++EVGDGTT+ V++A ELL  A++L++  IHPT I  GY
Sbjct: 71  LEEMDIEHPAAKMVVEVAKTQEDEVGDGTTTAVVLAGELLHKAEDLLQQDIHPTVIARGY 130

Query: 425 RLACKEAVKYIQD 463
           R+A ++A + +++
Sbjct: 131 RMAVEKAEEILEE 143



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  G   +  N+M        V+++LGP+G+DKMLVD++GDV VTN+G TIL+
Sbjct: 20  RFVGRDAQRMNIMAARVVAETVRTTLGPMGMDKMLVDEMGDVVVTNDGVTILE 72


>UniRef50_Q9V2S9 Cluster: Thermosome subunit alpha; n=34;
           Archaea|Rep: Thermosome subunit alpha - Sulfolobus
           solfataricus
          Length = 559

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 37/71 (52%), Positives = 54/71 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++E++HPAAK+LVE A+ QD EVGDGTTS V++A  LL+ A+ L+   IHPT II GY
Sbjct: 65  VKDMEIQHPAAKLLVEAAKAQDAEVGDGTTSAVVLAGALLEKAESLLDQNIHPTIIIEGY 124

Query: 425 RLACKEAVKYI 457
           + A  +A++ +
Sbjct: 125 KKAYNKALELL 135



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 3/66 (4%)
 Frame = +3

Query: 63  IAAPLSVA--GT-RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           +AAP+ +   GT R+ G      N++       +++SSLGP GLDKML+D  GDVT+TN+
Sbjct: 1   MAAPVLLLKEGTSRTTGRDALRNNILAAKTLAEMLRSSLGPKGLDKMLIDSFGDVTITND 60

Query: 234 GATILK 251
           GATI+K
Sbjct: 61  GATIVK 66


>UniRef50_UPI0000E4850D Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 437

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 36/69 (52%), Positives = 57/69 (82%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ +++PAAK+LV+++++QD+EVGDGTTSV + A ELLK A++LV  K+HP +II+G+
Sbjct: 69  LKSIGIDNPAAKILVDISKVQDDEVGDGTTSVTVFACELLKEAEKLVGQKLHPHTIIAGW 128

Query: 425 RLACKEAVK 451
           R A   AV+
Sbjct: 129 RKAIDVAVE 137



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDI--GDVTVTNEGATILK 251
           +++KS+LGP G+DK+L  +     + VTN+GATILK
Sbjct: 35  DLIKSTLGPKGMDKILQSNSPNAPLIVTNDGATILK 70


>UniRef50_Q0W8R0 Cluster: Chaperonin Hsp60; n=1; uncultured
           methanogenic archaeon RC-I|Rep: Chaperonin Hsp60 -
           Uncultured methanogenic archaeon RC-I
          Length = 536

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 34/73 (46%), Positives = 57/73 (78%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++EHPAAK++VE+A+ QD EVGDGTT+ V++A ELL+ A  L +  +H +SII GY
Sbjct: 68  LRKMDIEHPAAKMIVEVAKTQDAEVGDGTTTAVVLAGELLRQAGVLTEKSVHQSSIIKGY 127

Query: 425 RLACKEAVKYIQD 463
            +A ++A++ ++D
Sbjct: 128 LMAAEKALEIVKD 140



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 25/50 (50%), Positives = 34/50 (68%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           G   +T N+M        V S+LGP G+DKMLVD  GD++V+N+GATIL+
Sbjct: 20  GFEAQTYNIMAAMAVAGAVISTLGPRGMDKMLVDSTGDISVSNDGATILR 69


>UniRef50_O30560 Cluster: Thermosome subunit 2; n=8;
           Euryarchaeota|Rep: Thermosome subunit 2 - Halobacterium
           volcanii (Haloferax volcanii)
          Length = 557

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 35/73 (47%), Positives = 58/73 (79%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++++P A+++VE+A+ Q++E GDGTT+ V IA ELLKNA++L++  IHPT+II G+
Sbjct: 71  LKEMDIDNPTAEMIVEVAETQEDEAGDGTTTAVAIAGELLKNAEDLLEQDIHPTAIIRGF 130

Query: 425 RLACKEAVKYIQD 463
            LA ++A + I D
Sbjct: 131 NLASEKAREEIDD 143



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/43 (55%), Positives = 31/43 (72%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N+         V+S+LGP G+DKMLVD +GDVT+TN+G TILK
Sbjct: 30  NIRAARAVAEAVRSTLGPKGMDKMLVDSMGDVTITNDGVTILK 72


>UniRef50_P49368 Cluster: T-complex protein 1 subunit gamma; n=142;
           Eukaryota|Rep: T-complex protein 1 subunit gamma - Homo
           sapiens (Human)
          Length = 545

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 126

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 127 RKALDDMISTLK 138



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>UniRef50_Q4PBE2 Cluster: T-complex protein 1, delta subunit; n=1;
           Ustilago maydis|Rep: T-complex protein 1, delta subunit
           - Ustilago maydis (Smut fungus)
          Length = 574

 Score = 79.4 bits (187), Expect = 6e-14
 Identities = 39/88 (44%), Positives = 61/88 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ V HPAA++LVEL+Q QD E GDGTTSVV++A  LL  A++++   IHPT I   +
Sbjct: 75  LKHMAVMHPAARMLVELSQAQDVEAGDGTTSVVVVAGSLLGAAEKMLNKGIHPTIIAESF 134

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A  +AV+++ + ++  VE   R SL+
Sbjct: 135 QKAAAKAVEFLTE-ISTPVELNDRESLL 161



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           D VR  N++      + V++SLGP G+DKM+    G+V +TN+GATILK
Sbjct: 28  DEVRRSNLLAAKAVSDAVRTSLGPKGMDKMIQTSNGEVVITNDGATILK 76


>UniRef50_Q2FPE0 Cluster: Chaperonin Cpn60/TCP-1; n=4;
           Methanomicrobiales|Rep: Chaperonin Cpn60/TCP-1 -
           Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 532

 Score = 79.4 bits (187), Expect = 6e-14
 Identities = 33/78 (42%), Positives = 54/78 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + V+HP AK+++E+++ QDEEVGDGTT+ VI+   L++ A+ L+  KIHPT I  GY
Sbjct: 67  LDEISVQHPGAKMVIEVSRTQDEEVGDGTTTAVILVGSLMEQAESLLNKKIHPTVICRGY 126

Query: 425 RLACKEAVKYIQDNLTVT 478
           R+   +A++ +Q   + T
Sbjct: 127 RMGMLKALEILQSMASKT 144



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           R+ G   +  N+         V+S+LGP G+DKML+D  GDVT+TN+G TIL
Sbjct: 16  RTQGYEAQRSNIAAAKALAEAVRSTLGPRGMDKMLIDGTGDVTITNDGITIL 67


>UniRef50_A2F520 Cluster: Chaperonin subunit gamma CCTgamma,
           putative; n=2; Trichomonas vaginalis|Rep: Chaperonin
           subunit gamma CCTgamma, putative - Trichomonas vaginalis
           G3
          Length = 557

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 34/72 (47%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V HPA+K L+ELA+ QDEEVGDGTT+VV++A E+L   + L+K  IHP  I++G 
Sbjct: 65  LREIDVAHPASKSLIELARGQDEEVGDGTTTVVVLAGEILAVLEPLLKMNIHPHVIVAGL 124

Query: 425 RLACKEAVKYIQ 460
           R A ++A+ +++
Sbjct: 125 RKALEDALAHLE 136



 Score = 36.3 bits (80), Expect = 0.54
 Identities = 13/34 (38%), Positives = 26/34 (76%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +I+++ LGP  + KM++D +G + +TN+G +IL+
Sbjct: 33  DIIRTCLGPQAMLKMILDSMGTLVITNDGNSILR 66


>UniRef50_Q9HHA2 Cluster: Thermosome subunit 3; n=5; root|Rep:
           Thermosome subunit 3 - Halobacterium volcanii (Haloferax
           volcanii)
          Length = 524

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 36/81 (44%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++EHPAA++LVE++Q Q+EEVGDGTT+  ++  ELL +A++L+   +HPT I+ GY
Sbjct: 69  LEKMDIEHPAAQMLVEVSQTQEEEVGDGTTTAAVLTGELLAHAEDLLDDDLHPTVIVEGY 128

Query: 425 RLACKEAVKYIQDN-LTVTVE 484
             A + A   I D  L VT++
Sbjct: 129 TEAARIAQDAIDDMVLDVTLD 149



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 24/59 (40%), Positives = 36/59 (61%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           L+    R+ G   +  N+         V+++LGP G+DKMLVD  G+V +TN+GATIL+
Sbjct: 12  LAEGTNRTHGRSAQDSNIRAGKAVAEAVRTTLGPRGMDKMLVDSSGEVVITNDGATILE 70


>UniRef50_Q12UN6 Cluster: Thermosome subunit, group II chaperonin;
           n=1; Methanococcoides burtonii DSM 6242|Rep: Thermosome
           subunit, group II chaperonin - Methanococcoides burtonii
           (strain DSM 6242)
          Length = 500

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/88 (39%), Positives = 58/88 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++++HPAAK++VE+++ QD EVGDGTT+  +++ ELL  A+EL+   +H T I  GY
Sbjct: 19  LKEMDIQHPAAKMIVEVSKTQDAEVGDGTTTAAVLSGELLSKAEELIMKGVHSTIISEGY 78

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           R A  E  + I + +T+ +      +LI
Sbjct: 79  RHAA-EKCREILETITIAISPDDEAALI 105



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 14/20 (70%), Positives = 18/20 (90%)
 Frame = +3

Query: 192 MLVDDIGDVTVTNEGATILK 251
           MLVD +GD+ +TN+GATILK
Sbjct: 1   MLVDSMGDIVITNDGATILK 20


>UniRef50_A7I531 Cluster: Chaperonin Cpn60/TCP-1; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Chaperonin Cpn60/TCP-1 -
           Methanoregula boonei (strain 6A8)
          Length = 536

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/87 (40%), Positives = 59/87 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + V+HP AK++VE+A  QD+EVGDGTT+ V+IA  L+  A++L+   +HPT I  GY
Sbjct: 70  LSEISVQHPGAKMVVEVAMTQDDEVGDGTTTAVVIAGALMDQAEKLLAMGLHPTVISEGY 129

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSL 505
           R+  ++A+  I ++L+  V+   + +L
Sbjct: 130 RMGMEKALN-ITESLSFKVDPADKKTL 155



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           TR+ G+  +  N+M      N V+++LGP G+DKMLV   GD+ +TN+GATIL
Sbjct: 18  TRNRGEEAQHSNIMAAKAIANAVRTTLGPRGMDKMLVSSTGDIVITNDGATIL 70


>UniRef50_Q7ZTS3 Cluster: Cct7 protein; n=17; Deuterostomia|Rep:
           Cct7 protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 422

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 38/80 (47%), Positives = 57/80 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD  VGDGTTSV ++AAE LK     V+  +HP +II  +
Sbjct: 71  LKLLDVVHPAAKTLVDIARSQDAGVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAF 130

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R+A + AVK I++ + VT++
Sbjct: 131 RIATQLAVKKIKE-IAVTIK 149



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 26/67 (38%), Positives = 38/67 (56%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MST    L      S G P    N+         V+++LGP G+DK++VD+ G  T++N+
Sbjct: 7   MSTPVILLKEGTDTSQGVPQLVSNINACQVVAEAVRTTLGPRGMDKLVVDNRGKATISND 66

Query: 234 GATILKM 254
           GATILK+
Sbjct: 67  GATILKL 73



 Score = 33.5 bits (73), Expect = 3.8
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A T ++SKLI    DFFS+MVVDA
Sbjct: 164 AATALNSKLIAGQKDFFSKMVVDA 187


>UniRef50_A7PW56 Cluster: Chromosome chr8 scaffold_34, whole genome
           shotgun sequence; n=8; Eukaryota|Rep: Chromosome chr8
           scaffold_34, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 545

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 32/73 (43%), Positives = 51/73 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +EV+HPAAK+LV  ++ Q EE+GDG    +  A ELL+NA+EL++  +HP+ IISGY
Sbjct: 72  VNELEVQHPAAKILVLASKAQQEEIGDGANLTISFAGELLQNAEELIRMGLHPSEIISGY 131

Query: 425 RLACKEAVKYIQD 463
             A  + V+ +++
Sbjct: 132 SKAINKTVEILEE 144



 Score = 36.3 bits (80), Expect = 0.54
 Identities = 14/32 (43%), Positives = 25/32 (78%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           I ++SLGP G++KM+++ +  + VTN+ ATI+
Sbjct: 41  ITRTSLGPNGMNKMVINHLDKIFVTNDAATIV 72


>UniRef50_O81503 Cluster: F9D12.18 protein; n=16; Eukaryota|Rep:
           F9D12.18 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 562

 Score = 76.2 bits (179), Expect = 5e-13
 Identities = 34/89 (38%), Positives = 60/89 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V HPAAK ++EL++ QDEEVGDGTTSV+++A E+L  A+  ++   HPT I   Y
Sbjct: 54  LRELDVAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAEAFLEKNYHPTVICRAY 113

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLIT 511
             A ++++  + D + ++++   R S+ T
Sbjct: 114 IKALEDSIA-VLDKIAMSIDINDRKSIST 141



 Score = 35.5 bits (78), Expect = 0.95
 Identities = 15/34 (44%), Positives = 25/34 (73%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +I++++LGP  + KML+D  G + VTN+G  IL+
Sbjct: 22  DIIRTTLGPRSMLKMLLDAGGGIVVTNDGNAILR 55


>UniRef50_Q4E151 Cluster: Chaperonin, putative; n=5;
           Trypanosomatidae|Rep: Chaperonin, putative - Trypanosoma
           cruzi
          Length = 537

 Score = 76.2 bits (179), Expect = 5e-13
 Identities = 32/72 (44%), Positives = 51/72 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAK+LV+ ++   +EVGDGT  VV +A ELL  A+ LV+  +HP+ I+ GY
Sbjct: 67  LREIEVEHPAAKLLVQASEAMQQEVGDGTNLVVALAGELLSQAESLVRMGLHPSEIVEGY 126

Query: 425 RLACKEAVKYIQ 460
           + A   +++ +Q
Sbjct: 127 KKAGNRSLETLQ 138



 Score = 39.9 bits (89), Expect = 0.044
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +3

Query: 87  GTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           G     DPV  +N+        I +SS+GP GL KM+V+ +  + VT++ ATIL+
Sbjct: 15  GATFLDDPV-IKNIEACREIAKITRSSMGPYGLCKMVVNHLNKLFVTHDAATILR 68


>UniRef50_Q99832 Cluster: T-complex protein 1 subunit eta; n=135;
           Eukaryota|Rep: T-complex protein 1 subunit eta - Homo
           sapiens (Human)
          Length = 543

 Score = 76.2 bits (179), Expect = 5e-13
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68


>UniRef50_Q8Q0R4 Cluster: Thermosome subunit; n=4;
           Methanosarcinaceae|Rep: Thermosome subunit -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 567

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 29/72 (40%), Positives = 50/72 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           + ++++EHP AK++VE+AQ  +   GDGTTS V+    LL+ A+ L++  +HP  ++ GY
Sbjct: 90  LHDMDIEHPTAKMIVEVAQSLENSAGDGTTSAVVFTGALLEKAESLIEKGVHPAVVVKGY 149

Query: 425 RLACKEAVKYIQ 460
           RLA ++AV+  +
Sbjct: 150 RLAAEKAVEVFE 161



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/49 (53%), Positives = 35/49 (71%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           G    + N+       NIVKS+LGP G+DKMLV+ +GD+T+TN+GATIL
Sbjct: 42  GRDALSMNIAAAKAVANIVKSTLGPRGMDKMLVNPLGDITITNDGATIL 90


>UniRef50_P50991 Cluster: T-complex protein 1 subunit delta; n=138;
           Eukaryota|Rep: T-complex protein 1 subunit delta - Homo
           sapiens (Human)
          Length = 539

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>UniRef50_Q22MB3 Cluster: TCP-1/cpn60 chaperonin family protein;
           n=5; Oligohymenophorea|Rep: TCP-1/cpn60 chaperonin
           family protein - Tetrahymena thermophila SB210
          Length = 541

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 34/80 (42%), Positives = 51/80 (63%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  A++Q+ E GD T  V+ +A ELL  A+ L+K  +HP+ II+GY
Sbjct: 71  MQELEVQHPAAKMIVMAAKMQENECGDATNLVIALAGELLSQAESLIKMGLHPSQIIAGY 130

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A K  V  +      TVE
Sbjct: 131 EKALKATVSLLPTLSIYTVE 150



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 15/44 (34%), Positives = 29/44 (65%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+       N+ K+SLGP G+ KM+++ +  + VT++ ATI++
Sbjct: 29  KNINACKEISNMTKTSLGPNGMKKMVINHLDKIFVTSDAATIMQ 72


>UniRef50_A0DD79 Cluster: T-complex protein 1, delta subunit; n=13;
           Eukaryota|Rep: T-complex protein 1, delta subunit -
           Paramecium tetraurelia
          Length = 706

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++ HP AK+LVE++  QD E GDGTTSVV+ A  LLK+ + L++  IHPT+I  G+
Sbjct: 72  LKQMDLVHPTAKMLVEISNAQDVEAGDGTTSVVVFAGALLKSCEVLLEKGIHPTTISEGF 131

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A + A+  + D L   V+   +  LI
Sbjct: 132 QFALEYALTAL-DELKKPVDLENKQQLI 158



 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + V++SLGP G+DKM+ D  G V +TN+GATILK
Sbjct: 27  IRLTNIQAAKAVSDAVRTSLGPRGMDKMIQDAKGQVLITNDGATILK 73


>UniRef50_Q4MYW8 Cluster: T-complex protein 1, beta subunit,
           putative; n=2; Theileria|Rep: T-complex protein 1, beta
           subunit, putative - Theileria parva
          Length = 664

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/67 (49%), Positives = 52/67 (77%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K+V + +PAA+VLV+++  QD + GDGTT VV++A+ELL+ A++L++ KIHP +I  G+
Sbjct: 192 LKSVWLNNPAARVLVDVSMQQDAQCGDGTTGVVVLASELLRAAEKLIEQKIHPQTICLGF 251

Query: 425 RLACKEA 445
           R A K A
Sbjct: 252 RKALKVA 258



 Score = 35.9 bits (79), Expect = 0.72
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 7/59 (11%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLV------DDIGDVTVTNEGATILK-MW 257
           G+  R Q  +      +++KS+LGP G+DK+L          G   VTN+GATILK +W
Sbjct: 138 GETARMQYFIGSIAVGDLLKSTLGPKGMDKLLQPMNLEGPGGGMNVVTNDGATILKSVW 196


>UniRef50_A6S086 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 444

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 36/77 (46%), Positives = 52/77 (67%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           +E+++  AK+LVEL++ QD+E+GDGTT VV++A  LL+ A EL+   IHP  I  GY  A
Sbjct: 80  MEIQNHVAKLLVELSKSQDDEIGDGTTGVVVLAGALLEQAAELIDKGIHPIRIADGYDQA 139

Query: 434 CKEAVKYIQDNLTVTVE 484
           C  AV  + D +  T+E
Sbjct: 140 CDIAVAEL-DRIADTIE 155



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/52 (50%), Positives = 35/52 (67%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           R  G+     +++      NIVK+SLGP GLDK+L+   GD+TVTN+GATIL
Sbjct: 26  RQHGNEAVKSHILAARTVANIVKTSLGPRGLDKILISPDGDITVTNDGATIL 77


>UniRef50_Q4N0D4 Cluster: T-complex protein 1, eta subunit,
           putative; n=2; Theileria|Rep: T-complex protein 1, eta
           subunit, putative - Theileria parva
          Length = 579

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 35/71 (49%), Positives = 48/71 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +++ HPAA VLV++A+ QD+EVGDGTTSV ++A ELL  A   +   I P  II  Y
Sbjct: 68  LKLLDITHPAASVLVDIAKSQDDEVGDGTTSVTVLAGELLNEAKAFILDGISPQVIIKYY 127

Query: 425 RLACKEAVKYI 457
           R AC+ A+  I
Sbjct: 128 REACQVALNLI 138



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/44 (43%), Positives = 31/44 (70%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           N+       + VK++LGP G+DK++  +  DVT+TN+GAT+LK+
Sbjct: 28  NINACQAIVDCVKTTLGPRGMDKLIHTE-RDVTITNDGATVLKL 70


>UniRef50_Q4UAK0 Cluster: T-complex protein 1 (TCP1) chaperonin,
           putative; n=2; Theileria|Rep: T-complex protein 1 (TCP1)
           chaperonin, putative - Theileria annulata
          Length = 621

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 34/79 (43%), Positives = 53/79 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V +P AK L+EL++  DEEVGDGTTS VI+  ELL N   L+K +IHPT II G 
Sbjct: 66  LREIDVNNPGAKSLIELSRSLDEEVGDGTTSCVILCGELLSNCATLIKKEIHPTEIIQGL 125

Query: 425 RLACKEAVKYIQDNLTVTV 481
             A  + +  + D++++ +
Sbjct: 126 MEALDDTLVAL-DHISIPI 143



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 15/34 (44%), Positives = 27/34 (79%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +IV+++LGP  + KML+D +G + +TN+G +IL+
Sbjct: 34  DIVRTTLGPRSMLKMLLDPMGGIVITNDGNSILR 67


>UniRef50_P48643 Cluster: T-complex protein 1 subunit epsilon;
           n=123; Eukaryota|Rep: T-complex protein 1 subunit
           epsilon - Homo sapiens (Human)
          Length = 541

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 3/80 (3%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ A++L+   IHP  I  GY  A
Sbjct: 81  MDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA 140

Query: 434 CKEAVKY---IQDNLTVTVE 484
            + A+++   I D++ V ++
Sbjct: 141 ARVAIEHLDKISDSVLVDIK 160



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +R  G      ++M      N +++SLGP GLDKM+VD  GDVTVTN+GATIL M
Sbjct: 26  SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSM 80


>UniRef50_Q98S82 Cluster: T-complex protein 1, alpha subunit; n=1;
           Guillardia theta|Rep: T-complex protein 1, alpha subunit
           - Guillardia theta (Cryptomonas phi)
          Length = 531

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 36/87 (41%), Positives = 55/87 (63%)
 Frame = +2

Query: 248 KNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYR 427
           K++   +P   +  +L+  QD+E+GDGTT VVI  +ELLKNA +L+K KIHP+ II  YR
Sbjct: 61  KSIIFSNPLVNIFSQLSLQQDKEIGDGTTGVVIFCSELLKNAMKLIKKKIHPSLIIFSYR 120

Query: 428 LACKEAVKYIQDNLTVTVESLGRPSLI 508
           LA   ++  I++ L+ T   +    +I
Sbjct: 121 LALCYSLSQIKNFLSKTYVRINLSEII 147



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 18/32 (56%), Positives = 26/32 (81%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +KSS GP   DKM+++D G++T+TN+GATI K
Sbjct: 30  IKSSYGPFSHDKMILNDSGEITITNDGATIFK 61


>UniRef50_A0DJZ0 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 519

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 29/73 (39%), Positives = 51/73 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E++HPAAK+++  A++Q+ E GD T  V+ +A ELL+ A+ L+K  +HP+ I+ GY
Sbjct: 70  LKEMEIQHPAAKMILMAAKMQETEQGDATNFVITLAGELLQQAESLIKLGLHPSQIVVGY 129

Query: 425 RLACKEAVKYIQD 463
             A K+A+  + +
Sbjct: 130 ETALKKALDLLDE 142



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+       N+ K+SLGP G+ KM+V+ I  + VT++ ATILK
Sbjct: 28  KNIQACKEISNMTKTSLGPNGMKKMVVNHIDKIFVTSDAATILK 71


>UniRef50_Q7QZG3 Cluster: GLP_159_66836_65142; n=2; Giardia
           intestinalis|Rep: GLP_159_66836_65142 - Giardia lamblia
           ATCC 50803
          Length = 564

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V HPAAK ++E+++ Q+E+VGDGTTSVVI+A E++  A+ L+K  IHP  I  GY
Sbjct: 65  LRELDVAHPAAKAMLEVSRAQEEQVGDGTTSVVILAGEVIAMAEPLLKCGIHPILITQGY 124

Query: 425 RLA 433
           + A
Sbjct: 125 QKA 127



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 14/46 (30%), Positives = 29/46 (63%)
 Frame = +3

Query: 114 RTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  N+       +++++++GP  + KM++D +G V +TN+G  IL+
Sbjct: 21  RMNNIKASKTVADVIRTTMGPRSMLKMILDSMGSVVMTNDGNAILR 66


>UniRef50_A2FL92 Cluster: TCP-1/cpn60 chaperonin family protein;
           n=3; Trichomonas vaginalis G3|Rep: TCP-1/cpn60
           chaperonin family protein - Trichomonas vaginalis G3
          Length = 537

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/71 (43%), Positives = 49/71 (69%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +   E++HPAAK+LV  +Q+Q E+VGDGT  V++   ELL+ A ELV+  I+   I++GY
Sbjct: 70  LNEAEIQHPAAKMLVTASQMQAEQVGDGTNFVLVFGGELLRRATELVRAGINTKDIVAGY 129

Query: 425 RLACKEAVKYI 457
           + A  EA++ +
Sbjct: 130 QKALAEALRIL 140



 Score = 35.5 bits (78), Expect = 0.95
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)
 Frame = +3

Query: 87  GTR--SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           GTR  S  D V  QN+        + ++S+GP G+ K++ +  G + VT + ATIL
Sbjct: 15  GTRYFSGVDEVLLQNIDAVVDLSELTRTSIGPNGMKKIIKNHFGKLYVTGDAATIL 70


>UniRef50_P50990 Cluster: T-complex protein 1 subunit theta; n=76;
           Eukaryota|Rep: T-complex protein 1 subunit theta - Homo
           sapiens (Human)
          Length = 548

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.5 bits (73), Expect = 3.8
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILR 74


>UniRef50_Q2NHT5 Cluster: ThsA; n=1; Methanosphaera stadtmanae DSM
           3091|Rep: ThsA - Methanosphaera stadtmanae (strain DSM
           3091)
          Length = 535

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 27/73 (36%), Positives = 53/73 (72%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K  E +HPAAK++V+LA++Q+EE GDGTT+ V++  E+LK A++L++  I  ++I+ G+
Sbjct: 69  LKETEPDHPAAKMIVDLAKMQEEEYGDGTTTAVVLVGEILKEAEKLIEQGIPTSTIVKGF 128

Query: 425 RLACKEAVKYIQD 463
             +  + ++ + +
Sbjct: 129 EESKNKTLEVLDE 141



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/59 (44%), Positives = 39/59 (66%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           L+   TR+ G      N+M      N++K++LGP G+DKML++ IGDV +TN+G T+LK
Sbjct: 12  LADGSTRTSGSQATKNNIMAAKLLSNVLKTTLGPRGMDKMLINSIGDVKITNDGYTVLK 70


>UniRef50_Q8SR76 Cluster: T COMPLEX PROTEIN 1 GAMMA SUBUNIT; n=1;
           Encephalitozoon cuniculi|Rep: T COMPLEX PROTEIN 1 GAMMA
           SUBUNIT - Encephalitozoon cuniculi
          Length = 519

 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 32/81 (39%), Positives = 53/81 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V HP+A+ L+ELA+ QD+EVGDGTTSVV++AAE+L     ++   +HP  I    
Sbjct: 65  LRELDVAHPSARSLIELAKTQDDEVGDGTTSVVLLAAEILNEMTYILDRDVHPIRICKAL 124

Query: 425 RLACKEAVKYIQDNLTVTVES 487
             A +  +K I D   ++++S
Sbjct: 125 GRALEICIKAI-DGAAISLDS 144



 Score = 32.7 bits (71), Expect = 6.7
 Identities = 11/47 (23%), Positives = 28/47 (59%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           ++ ++ +      +++++ LGP  + KM++  I  + +TN+G  IL+
Sbjct: 20  IQNESAIAAKTISSVIRTCLGPRAMQKMVLTKINSIELTNDGNAILR 66


>UniRef50_Q8THX2 Cluster: Hsp60; n=2; Methanosarcina
           acetivorans|Rep: Hsp60 - Methanosarcina acetivorans
          Length = 535

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/72 (41%), Positives = 46/72 (63%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HP    L +LA+  D+  GDGT + VI A+ L+KNA  L++  +HPT II GY
Sbjct: 86  LKEIDVLHPIVTSLKKLAESMDKACGDGTKTAVIFASNLIKNAVRLIRAGVHPTIIIEGY 145

Query: 425 RLACKEAVKYIQ 460
            LA ++  + +Q
Sbjct: 146 ELAMQKTYEMLQ 157



 Score = 40.7 bits (91), Expect = 0.025
 Identities = 16/33 (48%), Positives = 27/33 (81%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           ++ SSLGP G++K++V+ +GD+ VT++G  ILK
Sbjct: 55  LLGSSLGPKGMNKIIVNPVGDIFVTSDGKVILK 87


>UniRef50_Q7QR58 Cluster: GLP_301_27994_26207; n=3; Eukaryota|Rep:
           GLP_301_27994_26207 - Giardia lamblia ATCC 50803
          Length = 595

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSII---SGY 424
           +++ HPAA+ LV++A+ QD E+GDGTTSVV++A  +LK+   L++  +HP  II   S  
Sbjct: 74  LDIVHPAARCLVDIAKSQDSEIGDGTTSVVVLAGSILKSCMPLIEVNVHPRLIIRVLSEA 133

Query: 425 RLACKEAVKYIQDNL 469
              C   +K I+ N+
Sbjct: 134 LSMCIAKIKEIEVNM 148



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 16/44 (36%), Positives = 30/44 (68%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           N+       ++++++LGP G+DK++V   G  TV+N+GATI+ +
Sbjct: 31  NIRACVAISDVLQTTLGPRGMDKLIVSK-GKPTVSNDGATIITL 73


>UniRef50_Q9N358 Cluster: T-complex protein 1 subunit theta; n=1;
           Caenorhabditis elegans|Rep: T-complex protein 1 subunit
           theta - Caenorhabditis elegans
          Length = 581

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 24/71 (33%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E++HPAA++++   ++Q++++GD T +VVI+AA LL++A  L+   + P  + +GY
Sbjct: 72  LKELEIQHPAARIIIMATEMQEKQIGDNTNTVVILAAALLEHAANLIHMGMTPQEVAAGY 131

Query: 425 RLACKEAVKYI 457
             A ++A++ +
Sbjct: 132 EQAAEKALEIL 142



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           D    +N+       + ++S+ GP G++KM+++ I  + VTN+ ATILK
Sbjct: 25  DEAVQRNIEACTELASQIRSAYGPNGMNKMVINHIEKLFVTNDAATILK 73


>UniRef50_Q54PX2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 617

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 28/73 (38%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++ HPA ++L+ +A+ QDE VGDGTTSVV++   LL+NA + +   IHP   I GY
Sbjct: 67  LQYLKITHPAPRLLIGIAKSQDETVGDGTTSVVLLTCILLQNALKFILLSIHPIIFIKGY 126

Query: 425 RLACKEAVKYIQD 463
           +++    +  I +
Sbjct: 127 QISLDFCLNVINE 139



 Score = 40.7 bits (91), Expect = 0.025
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
 Frame = +3

Query: 102 GDPVRT--QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKMWK 260
           G+ ++T  +N+         +KS+LGP G DK++VD   +   TN+GATIL+  K
Sbjct: 17  GNSIKTIKENIQACMEIYYHLKSTLGPFGRDKLIVDKNNNYLSTNDGATILQYLK 71


>UniRef50_P40227 Cluster: T-complex protein 1 subunit zeta; n=71;
           Eukaryota|Rep: T-complex protein 1 subunit zeta - Homo
           sapiens (Human)
          Length = 531

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 123

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 124 EAAKEKALQFLEE 136



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 64


>UniRef50_Q98RX6 Cluster: T-complex protein 1, delta subunit; n=1;
           Guillardia theta|Rep: T-complex protein 1, delta subunit
           - Guillardia theta (Cryptomonas phi)
          Length = 519

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 28/71 (39%), Positives = 47/71 (66%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K+++++HP AK+LV L++ QD E GDGTTSVV++  + L N+  L+K  I    I + +
Sbjct: 57  LKSIKIDHPVAKILVNLSKTQDIEAGDGTTSVVLLGGKFLSNSVSLIKNGIKVMDISNSF 116

Query: 425 RLACKEAVKYI 457
           + + K + K I
Sbjct: 117 KHSLKISKKII 127



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/35 (51%), Positives = 26/35 (74%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILKMWK 260
           +K+S GP G+DKM+ ++ G   +TN+GATILK  K
Sbjct: 28  IKTSFGPHGMDKMIQNEKG-YLITNDGATILKSIK 61


>UniRef50_Q98S23 Cluster: T-complex protein 1 beta SU; n=1;
           Guillardia theta|Rep: T-complex protein 1 beta SU -
           Guillardia theta (Cryptomonas phi)
          Length = 500

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 26/72 (36%), Positives = 47/72 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN++    A+ +L ++  +QD E+GDGTT++  +  E+L+ A+ L+   IHP SII GY
Sbjct: 48  LKNIKSNTIASLILKDVCSVQDLELGDGTTTICCLIGEMLREAENLMNQNIHPHSIIEGY 107

Query: 425 RLACKEAVKYIQ 460
           R++ K  +  ++
Sbjct: 108 RISAKIVIDILR 119



 Score = 41.5 bits (93), Expect = 0.014
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           + ++LGP G DK+L+D+ G +  TN+GATILK
Sbjct: 18  LSTTLGPNGKDKILIDNEGHINTTNDGATILK 49


>UniRef50_Q7R1S9 Cluster: GLP_190_44957_46648; n=2; Giardia
           intestinalis|Rep: GLP_190_44957_46648 - Giardia lamblia
           ATCC 50803
          Length = 563

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 33/76 (43%), Positives = 46/76 (60%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           +EV HPAAK+LV  AQ Q  E GDGT  VV  A ELL+ A +L++  +  T II+GY  A
Sbjct: 70  IEVNHPAAKMLVMAAQNQALEYGDGTNLVVTFAGELLERAKDLLEQGLVVTDIIAGYERA 129

Query: 434 CKEAVKYIQDNLTVTV 481
            +  +  +  N + T+
Sbjct: 130 LRHILNQLDGNSSSTL 145


>UniRef50_UPI00005A1481 Cluster: PREDICTED: similar to T-complex
           protein 1, zeta subunit (TCP-1-zeta) (CCT-zeta)
           (CCT-zeta-1); n=3; Canis lupus familiaris|Rep:
           PREDICTED: similar to T-complex protein 1, zeta subunit
           (TCP-1-zeta) (CCT-zeta) (CCT-zeta-1) - Canis familiaris
          Length = 514

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 26/72 (36%), Positives = 46/72 (63%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++ +HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 99  LHEMQTQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 158

Query: 425 RLACKEAVKYIQ 460
             A ++A+++++
Sbjct: 159 EAAKEKALQFLE 170



 Score = 33.5 bits (73), Expect = 3.8
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           +++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 68  VLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 99


>UniRef50_UPI000049A5F1 Cluster: T-complex protein 1 theta subunit;
           n=3; Entamoeba histolytica HM-1:IMSS|Rep: T-complex
           protein 1 theta subunit - Entamoeba histolytica
           HM-1:IMSS
          Length = 514

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 31/94 (32%), Positives = 53/94 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           I  +E +HPAA +++  A+ Q  E+GD T  V++ A EL+  A+ L++  +HPT I  GY
Sbjct: 63  ITELEFKHPAANMVINAAKQQQAEIGDFTNLVIMFAGELMTQAEGLLRMGLHPTIIADGY 122

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPKQP 526
           R   K   ++ ++ +  TV      SL+ +  +P
Sbjct: 123 RTGLKFFNEHCEELVLSTVAGDASVSLVEKYLKP 156


>UniRef50_P39079 Cluster: T-complex protein 1 subunit zeta; n=50;
           Eukaryota|Rep: T-complex protein 1 subunit zeta -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 546

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 25/73 (34%), Positives = 45/73 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++ P A ++   A  QDE  GDGTT+VV +  ELL+ A   ++  +HP  I  G+
Sbjct: 63  LTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGF 122

Query: 425 RLACKEAVKYIQD 463
            +A KE++K++ +
Sbjct: 123 EIARKESMKFLDE 135



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           NV       ++++++LGP G  KMLVD  G++ +T +G  +L
Sbjct: 22  NVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLL 63


>UniRef50_Q5CTZ7 Cluster: Putative T complex chaperonin; n=2;
           Cryptosporidium|Rep: Putative T complex chaperonin -
           Cryptosporidium parvum Iowa II
          Length = 564

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/72 (36%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTK-IHPTSIISG 421
           I+ ++++HPAA ++V   + Q EE GD + +V+I A ELL+NA +L+    +HP+ I++G
Sbjct: 69  IEELDIQHPAANMVVMACKRQAEEYGDASNTVLIFAGELLRNAAKLLNDNGLHPSDIVAG 128

Query: 422 YRLACKEAVKYI 457
           Y +A + ++  +
Sbjct: 129 YEIALERSLSLL 140


>UniRef50_Q55BE5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 624

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 25/46 (54%), Positives = 37/46 (80%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADEL 382
           + N++VEHPAA +LV +A  QD E+GDGTTS+V++A E+LK+  +L
Sbjct: 78  LSNIKVEHPAAVILVNIALSQDREIGDGTTSIVLLAGEILKSLTKL 123



 Score = 39.5 bits (88), Expect = 0.058
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           GD     ++       +I+K+SLGP  + K+++ D G   ++N+GATIL
Sbjct: 30  GDNALQSSINSALSIFSILKTSLGPRSMSKLIIKDNGSYIISNDGATIL 78


>UniRef50_Q8SQP2 Cluster: T COMPLEX PROTEIN 1 BETA SUBUNIT; n=1;
           Encephalitozoon cuniculi|Rep: T COMPLEX PROTEIN 1 BETA
           SUBUNIT - Encephalitozoon cuniculi
          Length = 508

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 32/79 (40%), Positives = 51/79 (64%), Gaps = 3/79 (3%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           + N+ ++ P+A++L+  +  QD E GDGTTSV I+A+ L+K A +L   ++HPT I+ GY
Sbjct: 62  LNNLMIDSPSARILIGSSTGQDWEEGDGTTSVAILASLLVKEAGKL---EMHPTKILRGY 118

Query: 425 RLA---CKEAVKYIQDNLT 472
           R+A   C+E +  I    T
Sbjct: 119 RMAQAKCEEILSSISFEAT 137



 Score = 32.3 bits (70), Expect = 8.8
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           T   GD  +   +       +I+K++LGP G+ KML      V VTN+GA IL
Sbjct: 12  TEERGDDAKRTILAGTDIVGDILKTTLGPKGMLKMLKGQ--HVNVTNDGAFIL 62


>UniRef50_A7D1F1 Cluster: Chaperonin Cpn60/TCP-1; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Chaperonin Cpn60/TCP-1 -
           Halorubrum lacusprofundi ATCC 49239
          Length = 564

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 29/80 (36%), Positives = 45/80 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +E++ P  +V+ +  Q     VGDGTT+  ++  ELL  AD L +  +HPTSI+ GY
Sbjct: 61  LDGLEIDAPIGRVIRDAVQAHARHVGDGTTTTALLVGELLDAADTLAERGLHPTSIVDGY 120

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A   A +   D L+V V+
Sbjct: 121 ARAASHA-RDALDELSVPVD 139



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/29 (65%), Positives = 23/29 (79%)
 Frame = +3

Query: 162 SSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           S+LGP GLDKM++D  G V VTN GAT+L
Sbjct: 33  STLGPNGLDKMVIDRSGSVVVTNTGATVL 61


>UniRef50_P47828 Cluster: T-complex protein 1 subunit theta; n=2;
           Candida albicans|Rep: T-complex protein 1 subunit theta
           - Candida albicans (Yeast)
          Length = 540

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 27/81 (33%), Positives = 50/81 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +E+ HP  K+L++ ++ Q+ E+GD T  V+I+A E L  A++L+   ++ + II G+
Sbjct: 72  LNELEIVHPVVKILIQASKQQEFEMGDNTNLVIILAGEFLNVAEKLLTLGLNVSEIIQGF 131

Query: 425 RLACKEAVKYIQDNLTVTVES 487
            LA K  +K + + +   VES
Sbjct: 132 NLANKFVMKTLDELVVEKVES 152



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           S  D    +NV       +I+ +S+GP G +K++V+ +G   +TN+ AT+L
Sbjct: 22  SNADGAIIRNVEAVREIASILLTSMGPSGRNKIIVNKLGKKFITNDAATML 72


>UniRef50_Q8SSH3 Cluster: T COMPLEX PROTEIN 1 DELTA SUBUNIT; n=1;
           Encephalitozoon cuniculi|Rep: T COMPLEX PROTEIN 1 DELTA
           SUBUNIT - Encephalitozoon cuniculi
          Length = 484

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/64 (42%), Positives = 40/64 (62%)
 Frame = +2

Query: 266 HPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEA 445
           HP   +L  ++  QDEE GDGTTSVVI+A  LL++   L++  +HP+ I     +A K  
Sbjct: 59  HPIHGILSSMSATQDEECGDGTTSVVILAGCLLESISSLLERNVHPSVICDNLEIAKKIG 118

Query: 446 VKYI 457
           ++YI
Sbjct: 119 LRYI 122



 Score = 40.7 bits (91), Expect = 0.025
 Identities = 24/47 (51%), Positives = 28/47 (59%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           VRT            + +SLGP GLDKM+V D   V VTN+GATILK
Sbjct: 9   VRTSVFQASQSLLQTLSTSLGPRGLDKMVVKDKKTV-VTNDGATILK 54


>UniRef50_Q5V6S3 Cluster: Thermosome alpha subunit; n=1; Haloarcula
           marismortui|Rep: Thermosome alpha subunit - Haloarcula
           marismortui (Halobacterium marismortui)
          Length = 538

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/68 (38%), Positives = 42/68 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           I+ +++ HP  +++ + A  QD  VGDGTT+ V++   LL+ A  L    +HPT+II GY
Sbjct: 58  IEWMDITHPVGRLVEQAAAAQDNTVGDGTTTAVVLVGALLEEAATLRSAGLHPTTIIDGY 117

Query: 425 RLACKEAV 448
             A + A+
Sbjct: 118 GRAVEAAL 125



 Score = 39.5 bits (88), Expect = 0.058
 Identities = 16/32 (50%), Positives = 26/32 (81%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           ++++LGP GLDKM+V + G V VTN+G+ I++
Sbjct: 28  IRTTLGPNGLDKMVVGENGTVIVTNDGSKIIE 59


>UniRef50_P46550 Cluster: T-complex protein 1 subunit zeta; n=22;
           Eukaryota|Rep: T-complex protein 1 subunit zeta -
           Caenorhabditis elegans
          Length = 539

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/72 (31%), Positives = 43/72 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + ++HP A ++ + +  QD+  GDGTTS V++  ELLK A+ LV   +HP  +  G+
Sbjct: 64  LHEMAIQHPTASMIAKASTAQDDVTGDGTTSTVLLIGELLKQAESLVLEGLHPRIVTEGF 123

Query: 425 RLACKEAVKYIQ 460
             A  + ++ ++
Sbjct: 124 EWANTKTLELLE 135



 Score = 35.5 bits (78), Expect = 0.95
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++S+LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISGARGLQDVMRSNLGPKGTLKMLVSGAGDIKLTKDGNVLL 64


>UniRef50_P47079 Cluster: T-complex protein 1 subunit theta; n=32;
           Dikarya|Rep: T-complex protein 1 subunit theta -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 568

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/73 (35%), Positives = 45/73 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +++ HPA KVLV   + Q  ++GDGT  V+I+A ELL  +++L+   +    II GY
Sbjct: 72  LRELDIVHPAVKVLVMATEQQKIDMGDGTNLVMILAGELLNVSEKLISMGLSAVEIIQGY 131

Query: 425 RLACKEAVKYIQD 463
            +A K  +K + +
Sbjct: 132 NMARKFTLKELDE 144



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 12/30 (40%), Positives = 24/30 (80%)
 Frame = +3

Query: 162 SSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +S+GP G +K++V+ +G + +TN+ AT+L+
Sbjct: 44  TSMGPCGRNKIIVNHLGKIIITNDAATMLR 73


>UniRef50_A2Z9B2 Cluster: T-complex protein 1, delta subunit; n=1;
           Oryza sativa (indica cultivar-group)|Rep: T-complex
           protein 1, delta subunit - Oryza sativa subsp. indica
           (Rice)
          Length = 517

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 30/80 (37%), Positives = 44/80 (55%)
 Frame = +2

Query: 269 PAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAV 448
           PAA++L +L++ QD   GDGTT+VV++A  LL  A  L+    HPT+      L    AV
Sbjct: 89  PAARMLADLSRSQDAAAGDGTTTVVVLAGSLLHRAQSLLSAGAHPTAAADALHLLAARAV 148

Query: 449 KYIQDNLTVTVESLGRPSLI 508
             I   + + VE   R +L+
Sbjct: 149 G-ILHGMAIPVELSDRDALV 167



 Score = 33.5 bits (73), Expect = 3.8
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 9/57 (15%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDI---GD------VTVTNEGATIL 248
           D VR+ N+          ++SLGP G+DKM+       GD      V +TN+GATIL
Sbjct: 25  DDVRSLNIAAGRAVTAAARTSLGPRGMDKMISSSSSGGGDQAAHEAVIITNDGATIL 81


>UniRef50_Q9GYV7 Cluster: Chaperonin-containing TCP-1, zeta subunit;
           n=3; Entamoeba histolytica|Rep: Chaperonin-containing
           TCP-1, zeta subunit - Entamoeba histolytica
          Length = 540

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + ++HP A ++   A  QD+ VGDGTTS V++  E++K  +  +   IHP  ++ G 
Sbjct: 64  LNEMHIQHPTANLIARAATSQDDIVGDGTTSTVLLCGEIMKLCEPYLNEGIHPRLLVEGI 123

Query: 425 RLACKEAVKYI 457
            LA +    Y+
Sbjct: 124 ELARQHLFDYL 134


>UniRef50_A2DR42 Cluster: Chaperonin subunit zeta CCTzeta; n=2;
           Trichomonas vaginalis|Rep: Chaperonin subunit zeta
           CCTzeta - Trichomonas vaginalis G3
          Length = 528

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/72 (34%), Positives = 42/72 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ + HP A ++   A  QDE  GDGTTS +I+   +LK  +  +   +HP  + +G 
Sbjct: 64  LKNLTIIHPTAIMISRAAAAQDENTGDGTTSTIILIDAMLKQCERRLAEGVHPRVLTTGL 123

Query: 425 RLACKEAVKYIQ 460
             A  EA+++I+
Sbjct: 124 EDARDEALRFIE 135



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +I+K++LGP G  KMLV   GDV +T +G  +LK
Sbjct: 32  DILKTNLGPCGTLKMLVGGAGDVQLTKDGTVLLK 65


>UniRef50_Q7R133 Cluster: GLP_12_22978_24657; n=9; Eukaryota|Rep:
           GLP_12_22978_24657 - Giardia lamblia ATCC 50803
          Length = 559

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  + + HP A  +   A  QD+ VGDGTT++V++  ELL+ A   +   +HP  ++ G+
Sbjct: 64  LSELPINHPIAAFIATAATAQDDIVGDGTTTMVLLVGELLRQAARWLAEDVHPRVLVDGF 123

Query: 425 RLACKEAVKYI 457
            LA    + ++
Sbjct: 124 ELAKARVISFL 134



 Score = 36.3 bits (80), Expect = 0.54
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           +++++ GP G  KMLV   GD+ +T +GA +L
Sbjct: 33  LIRTNFGPAGTYKMLVSGAGDIKITKDGAVLL 64


>UniRef50_Q98S00 Cluster: T-complex protein1, epsilon-SU; n=1;
           Guillardia theta|Rep: T-complex protein1, epsilon-SU -
           Guillardia theta (Cryptomonas phi)
          Length = 511

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 23/72 (31%), Positives = 44/72 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++  +V+     ++ E+++  D+E GDGTT VV++ + LL+ A +L++  +HP  II GY
Sbjct: 53  LEKAKVKGLIRSMICEMSKSHDDETGDGTTGVVLLTSFLLEEAIKLIENGVHPIRIIEGY 112

Query: 425 RLACKEAVKYIQ 460
              C   V +++
Sbjct: 113 FYCCDFCVNHLE 124



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKMWK 260
           +N+       +++KSS GP G DK + D+ G + +TN+GATIL+  K
Sbjct: 11  RNINKITSLASVLKSSFGPYGFDKAIRDNDGSLIITNDGATILEKAK 57


>UniRef50_Q4N6Q7 Cluster: Chaperonin 60 kDa, putative; n=3;
           Piroplasmida|Rep: Chaperonin 60 kDa, putative -
           Theileria parva
          Length = 551

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +2

Query: 236 CHNI-KNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSI 412
           C+ I   +EV HP  K+++   + Q  + GDGT ++V +  +LL NA EL++  +H + I
Sbjct: 66  CNTILAELEVVHPVGKIVLSSVESQKLQFGDGTNTLVALLGDLLTNAGELLQDGVHISDI 125

Query: 413 ISGYRLACKEAVKYIQDNLTVTVESL 490
             GY +A  + ++++   +   ++ L
Sbjct: 126 RKGYEIAFNKLMEHLPSLVCYNIKDL 151


>UniRef50_Q7NEX9 Cluster: 60 kDa chaperonin; n=1; Gloeobacter
           violaceus|Rep: 60 kDa chaperonin - Gloeobacter violaceus
          Length = 505

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/82 (32%), Positives = 49/82 (59%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++ +HPAA++++++A+ QD  VGDGTT+  ++A  LL    E V+  I   ++I+G R  
Sbjct: 57  LDAQHPAARLVIQVAEAQDRSVGDGTTTATVLAGALLDACLERVEQGIAINALIAGLRAG 116

Query: 434 CKEAVKYIQDNLTVTVESLGRP 499
            + A+  ++ +  V V  L  P
Sbjct: 117 VQAALDALR-SAAVPVTDLADP 137



 Score = 41.1 bits (92), Expect = 0.019
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+         V  +LGP GLD +LVDD G +T+TN+G  IL
Sbjct: 13  NIAAVRAIVETVAGTLGPKGLDVLLVDDAGRMTLTNDGVEIL 54


>UniRef50_Q8SR53 Cluster: T COMPLEX PROTEIN 1 ETA SUBUNIT; n=1;
           Encephalitozoon cuniculi|Rep: T COMPLEX PROTEIN 1 ETA
           SUBUNIT - Encephalitozoon cuniculi
          Length = 511

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVK 388
           +K++ + HP  ++LV L++ QD EVGDGTTSVVI+  E+L     L+K
Sbjct: 63  LKHMNIRHPVGRLLVALSESQDSEVGDGTTSVVILTTEILSCLKPLIK 110



 Score = 36.3 bits (80), Expect = 0.54
 Identities = 18/43 (41%), Positives = 26/43 (60%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           NV         ++S+LGP G+DK+      ++ VTN+GATILK
Sbjct: 24  NVDVCTKIAEFLESTLGPYGMDKLFAGK--EIVVTNDGATILK 64


>UniRef50_Q7RHQ2 Cluster: T-complex protein 1; n=5; Plasmodium|Rep:
           T-complex protein 1 - Plasmodium yoelii yoelii
          Length = 621

 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           + ++E+ HP   +L +L++  + E GD T  V  IA E+L+ A  L+    +   II+G+
Sbjct: 148 LNDLEINHPVVNILKKLSETMNYEYGDNTNYVFTIATEMLEKASYLIHDGFNVNDIINGF 207

Query: 425 RLACKEAVKYIQDNLTVTVES 487
           +L   E  K + ++ +  +E+
Sbjct: 208 KLGYNEIDKILTESTSFKIEN 228


>UniRef50_A1HR08 Cluster: 60 kDa chaperonin; n=3; Clostridiales|Rep:
           60 kDa chaperonin - Thermosinus carboxydivorans Nor1
          Length = 529

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++V HPAAK+L+ +A+ Q  EVGDGTT+  I+A  L+      V   +    +I G 
Sbjct: 63  LDKMDVNHPAAKMLINIAKAQQAEVGDGTTTATIMAGGLVAEGVNQVLRGVPVARVIEGV 122

Query: 425 RLACKEAVKYIQ 460
           R     A++ I+
Sbjct: 123 RYGVARAIEEIK 134



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           V+ ++GP GLD MLVD  G+V +TN+G TIL
Sbjct: 33  VEGTIGPKGLDTMLVDRFGEVIITNDGVTIL 63


>UniRef50_A4QPH3 Cluster: CESK1 protein; n=12; Theria|Rep: CESK1
           protein - Homo sapiens (Human)
          Length = 562

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>UniRef50_Q29236 Cluster: T-complex protein 1 subunit zeta; n=15;
           Euteleostomi|Rep: T-complex protein 1 subunit zeta - Sus
           scrofa (Pig)
          Length = 104

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSI 412
           +  ++++HP A ++ ++A  QD+  GDG TS V+I  ELLK AD  +   +HP  I
Sbjct: 49  LHEMQIQHPTASLIAKVATAQDDITGDGXTSNVLIIGELLKQADLYISEGLHPRII 104



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 8   NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 49


>UniRef50_Q3AF10 Cluster: 60 kDa chaperonin; n=1; Carboxydothermus
           hydrogenoformans Z-2901|Rep: 60 kDa chaperonin -
           Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 521

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/89 (28%), Positives = 49/89 (55%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++ +HPAA+++V +A+ Q+ EVGDGTT+  ++A  L+      +   +  + +++G   A
Sbjct: 64  MDAQHPAARMVVNMARAQEREVGDGTTTAAVLAGALVSEGVNQILKGVPVSKVLAGMNRA 123

Query: 434 CKEAVKYIQDNLTVTVESLGRPSLITQPK 520
              A+  I+ N  + V S+    L+   K
Sbjct: 124 LNHALFLIRKN-AIKVGSITDDRLLAAAK 151



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +V +SLGP GLD MLVD  G+V VTN+G TIL +
Sbjct: 30  VVANSLGPKGLDAMLVDRFGEVVVTNDGVTILTL 63


>UniRef50_Q3ILY6 Cluster: Thermosome subunit 4; n=1; Natronomonas
           pharaonis DSM 2160|Rep: Thermosome subunit 4 -
           Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)
          Length = 548

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  +E+E P A  +   A  Q     DGTT  V++   LL  A+ L+   +HPT+II G+
Sbjct: 58  LDRMEIEDPVATTVARAASSQQVATTDGTTRTVLLTGALLSAAESLLAAGVHPTTIIDGF 117

Query: 425 RLACKEAVKYIQ 460
             A   A + +Q
Sbjct: 118 NTATYSAREQLQ 129



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +3

Query: 156 VKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           V+++ GP G+DKMLV   G V VTN+GA IL
Sbjct: 28  VRTTFGPNGMDKMLVGRNGTVLVTNDGARIL 58


>UniRef50_Q9XG35 Cluster: T-complex protein gamma SU; n=1;
           Guillardia theta|Rep: T-complex protein gamma SU -
           Guillardia theta (Cryptomonas phi)
          Length = 502

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 22/79 (27%), Positives = 43/79 (54%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +  +HP  K+L+EL+  Q+ E GDGT  V+I+ +E++ N   L+K  I    II+  
Sbjct: 45  LREINSDHPFLKILLELSSNQEFECGDGTKEVLILTSEVISNCQILIKKTIPTWKIINSL 104

Query: 425 RLACKEAVKYIQDNLTVTV 481
                 ++  +   L++ +
Sbjct: 105 NELFNNSISLLSHELSINL 123


>UniRef50_Q54TX7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 631

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 20/47 (42%), Positives = 39/47 (82%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELV 385
           +K++++EHP +K++VEL+   D++ GDGTTSVV++++ LL+ + +L+
Sbjct: 77  LKSIQLEHPCSKMMVELSFSMDDQNGDGTTSVVVLSSFLLRKSLKLL 123



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 15/43 (34%), Positives = 28/43 (65%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N++      +I+KS LGP   DK++++   ++ V+N+G T+LK
Sbjct: 36  NIIACITIGDIMKSLLGPCSRDKLIINKYNEIIVSNDGYTVLK 78


>UniRef50_Q554F9 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 614

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K++ + HP   +L +L+   D  V DGTTS VI+A +LLK +++L+    HP  II  +
Sbjct: 61  MKSLPISHPLGIILQQLSNSID--VCDGTTSGVILACKLLKESEKLLIRNYHPNLIIKAF 118

Query: 425 RLACKEAVKYIQDN 466
            +A +++   +  N
Sbjct: 119 TIAYEQSKLLLNSN 132


>UniRef50_A7TAW5 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 151

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 317 VGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQD 463
           VGDGTTSV ++  E LK   + V+  +HP  I+  YR A   A+K I++
Sbjct: 1   VGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIKE 49



 Score = 32.3 bits (70), Expect = 8.8
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 505 DHTAKTTMSSKLIGADADFFSEMVVDA 585
           +  A T +SSKLI    +FF++MVVDA
Sbjct: 67  ERCAATALSSKLIATQKEFFAKMVVDA 93


>UniRef50_UPI000155C75D Cluster: PREDICTED: similar to T-complex
           protein 1; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           similar to T-complex protein 1 - Ornithorhynchus
           anatinus
          Length = 392

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/83 (30%), Positives = 46/83 (55%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           +E+ HPAA++L E A  Q EE GDGT  VV++A  L++    +++T +    +      A
Sbjct: 122 LELGHPAARLLREAAFTQAEENGDGTAFVVLLAGALMEQVVVMLRTGLALADLRESLAAA 181

Query: 434 CKEAVKYIQDNLTVTVESLGRPS 502
              A++ +    T++++ L  P+
Sbjct: 182 TSRALRLLPGLATLSIDPLEDPA 204


>UniRef50_Q98S92 Cluster: T-complex protein1 eta SU; n=1; Guillardia
           theta|Rep: T-complex protein1 eta SU - Guillardia theta
           (Cryptomonas phi)
          Length = 512

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           + N   E    K+LVE+ + QD E GDGTTSV ++  E+L  + +L++       II   
Sbjct: 58  VSNTISEDSIEKILVEMVKSQDYEEGDGTTSVCLLTYEILIESFKLIQQGFDTKDIIKNL 117

Query: 425 R---LACKEAVKYI-QDN 466
           +   L C++ +  I +DN
Sbjct: 118 KKCGLLCQKILNEIAEDN 135



 Score = 33.1 bits (72), Expect = 5.0
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +3

Query: 117 TQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           +QN+        I+K+S GP  ++K++    G   +T++GATI+
Sbjct: 15  SQNISRIEKIIKILKTSFGPYSMNKIITRKNGRDVITSDGATIV 58


>UniRef50_Q86H80 Cluster: Similar to Mus musculus (Mouse). T-complex
           protein 1, epsilon subunit; n=2; Dictyostelium
           discoideum|Rep: Similar to Mus musculus (Mouse).
           T-complex protein 1, epsilon subunit - Dictyostelium
           discoideum (Slime mold)
          Length = 683

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 17/34 (50%), Positives = 27/34 (79%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           N +K+SLGP   DK++VD+ G++ VTN+G +I+K
Sbjct: 38  NFIKTSLGPKSGDKLIVDENGNIIVTNDGYSIIK 71



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +2

Query: 278 KVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIIS-GYRLACKEAVKY 454
           ++L++  + Q+   GDGTTSV+++      +A +L+  K  P  I+S  ++ +   A+K 
Sbjct: 135 ELLIDCCKTQERLYGDGTTSVLVLIGSFCSSALKLIFEKGIPPHIVSNAFQNSLNHALKL 194

Query: 455 IQDNLTVTV 481
           + +N  + V
Sbjct: 195 LNNNYYLNV 203


>UniRef50_Q5CLK3 Cluster: Hsp60; n=10; Cryptosporidium|Rep: Hsp60 -
           Cryptosporidium hominis
          Length = 618

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           A++L  +A   +EE GDGTT+  ++A  + K+  E V   ++P  ++ G +L  +  V  
Sbjct: 103 AQLLKNVAISTNEEAGDGTTTATVLARAIFKSGCEKVDAGLNPMDLLRGIKLGVEHVVNE 162

Query: 455 IQDNLTVTVES 487
           + D L+  V+S
Sbjct: 163 L-DLLSQPVKS 172


>UniRef50_Q2GQ09 Cluster: Putative uncharacterized protein; n=2;
           Fungi/Metazoa group|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 528

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 20/56 (35%), Positives = 34/56 (60%)
 Frame = +3

Query: 84  AGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           A +R  G+ +R  N+       +++KS+LGP+G  KMLVD  G + +T +G  +L+
Sbjct: 11  AESRRRGEALRV-NISAGEGLQDVLKSNLGPLGTIKMLVDGAGQIKLTKDGNVLLR 65



 Score = 36.7 bits (81), Expect = 0.41
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLK 367
           ++ +++++P A ++   A  QD+  GDGTTSVV++  +  K
Sbjct: 64  LREMQIQNPTAVMIARAATAQDDICGDGTTSVVLLFLDQFK 104


>UniRef50_Q9AW35 Cluster: T-complex protein 1, zeta SU; n=2;
           Eukaryota|Rep: T-complex protein 1, zeta SU - Guillardia
           theta (Cryptomonas phi)
          Length = 524

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/71 (23%), Positives = 38/71 (53%)
 Frame = +2

Query: 251 NVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRL 430
           ++++++P A ++ +    Q   +GDGT S++ +  E+ K+ +  ++  IHP  I+ G  +
Sbjct: 72  DMQIQNPFAILISKSIINQKNFLGDGTLSIITLLGEMFKSIESALQDNIHPEKILRGINM 131

Query: 431 ACKEAVKYIQD 463
                 K + D
Sbjct: 132 GYNYLKKNLSD 142



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 16/32 (50%), Positives = 23/32 (71%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATI 245
           +I+K+SLGP G  KML+   GD+ +T EG T+
Sbjct: 38  DILKTSLGPFGKFKMLISKNGDLKITKEGLTL 69


>UniRef50_A2E548 Cluster: TCP-1/cpn60 chaperonin family protein;
           n=1; Trichomonas vaginalis G3|Rep: TCP-1/cpn60
           chaperonin family protein - Trichomonas vaginalis G3
          Length = 526

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = +2

Query: 266 HPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEA 445
           HP A  +V  A  Q++   DG   ++ +   +LK ++  +   +HP  I+ G + A   A
Sbjct: 67  HPTAIFIVRAAMAQEKMYHDGVNKLITLIDAILKESEYAISDGVHPRKIVRGLQEARDIA 126

Query: 446 VKYIQD 463
           +K++++
Sbjct: 127 MKHLEE 132


>UniRef50_Q8RIT4 Cluster: 60 kDa chaperonin; n=5;
           Desulfitobacterium|Rep: 60 kDa chaperonin -
           Desulfitobacterium hafniense (Desulfitobacterium
           frappieri)
          Length = 541

 Score = 39.5 bits (88), Expect = 0.058
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 4/67 (5%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG----YRL 430
           E+  A++  E+A+  DE  GDGTT+ +++   +L+   +L++  + P  +  G     RL
Sbjct: 71  ENMGARLCKEVARQTDELTGDGTTTAIVLLQAMLQGGLQLIEAGVEPARLRQGMERAVRL 130

Query: 431 ACKEAVK 451
            C E  +
Sbjct: 131 VCAEITR 137


>UniRef50_Q94596 Cluster: Chaperonin HSP60, mitochondrial precursor;
           n=8; Trypanosomatidae|Rep: Chaperonin HSP60,
           mitochondrial precursor - Leishmania major
          Length = 589

 Score = 39.5 bits (88), Expect = 0.058
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A ++ ++A L ++  GDGTT+  +++  + K     V +  +P  +  G  LAC+E
Sbjct: 80  ENLGANLVRQVAGLTNDNAGDGTTTATVLSGAIFKEGFRSVASGTNPMDLKRGIDLACRE 139

Query: 443 A-VKYIQDNLTVTVES 487
             +   + +  VT +S
Sbjct: 140 VLISLAEQSRPVTSKS 155


>UniRef50_P10809 Cluster: 60 kDa heat shock protein, mitochondrial
           precursor; n=401; cellular organisms|Rep: 60 kDa heat
           shock protein, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 573

 Score = 39.1 bits (87), Expect = 0.077
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>UniRef50_UPI0001509EE1 Cluster: TCP-1/cpn60 chaperonin family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           TCP-1/cpn60 chaperonin family protein - Tetrahymena
           thermophila SB210
          Length = 541

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 19/77 (24%), Positives = 43/77 (55%)
 Frame = +2

Query: 257 EVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLAC 436
           +++   A +L + +   +   GDGTTS +IIA  +L+ +   ++ K +P  +  G   A 
Sbjct: 76  KLQEIGASLLRKASGSTNVHAGDGTTSTIIIAEAILRESSRFLEYKANPIEMKKGMDKAR 135

Query: 437 KEAVKYIQDNLTVTVES 487
           K  V+++ + +++ +E+
Sbjct: 136 KHIVEFLNE-ISIPIET 151


>UniRef50_UPI0000D66C43 Cluster: PREDICTED: similar to Heat shock
           protein 1 (chaperonin); n=1; Mus musculus|Rep:
           PREDICTED: similar to Heat shock protein 1 (chaperonin)
           - Mus musculus
          Length = 497

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTSTVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>UniRef50_Q4N0D8 Cluster: Chaperonin 60 kDa, putative; n=3;
           Piroplasmida|Rep: Chaperonin 60 kDa, putative -
           Theileria parva
          Length = 698

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ E+A   D+  GDGTTS  I+AAE+     + V    +   +  G + A K  ++ 
Sbjct: 184 AKLIQEIASSSDDRAGDGTTSTAILAAEIASKGVQYVNEGHNSIPLQKGIQKAGKLIIEE 243

Query: 455 IQ 460
           I+
Sbjct: 244 IK 245


>UniRef50_A7I798 Cluster: Chaperonin GroEL; n=2; cellular
           organisms|Rep: Chaperonin GroEL - Methanoregula boonei
           (strain 6A8)
          Length = 537

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/66 (27%), Positives = 36/66 (54%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  AK++ E+AQ   ++ GDGTT+  ++A  ++    + + +  +P  +  G   A   
Sbjct: 67  ENMGAKLVKEVAQKTQDKTGDGTTTATLLAQSMIVEGLKNITSGSNPIEVKKGIDAAVNA 126

Query: 443 AVKYIQ 460
           +V YI+
Sbjct: 127 SVGYIK 132


>UniRef50_Q6YR94 Cluster: 60 kDa chaperonin; n=31; cellular
           organisms|Rep: 60 kDa chaperonin - Onion yellows
           phytoplasma
          Length = 536

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 4/72 (5%)
 Frame = +2

Query: 248 KNVEVEHP----AAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSII 415
           K +E+++P     AK++ E+A   +++ GDGTT+  ++A  ++    + +    +P  + 
Sbjct: 57  KEIELKNPYQNMGAKLVYEVASKTNDKAGDGTTTATVLAQSMIHRGFDAIDAGANPVLVK 116

Query: 416 SGYRLACKEAVK 451
            G  LA     K
Sbjct: 117 EGIELAALTVAK 128


>UniRef50_P34940 Cluster: Chaperonin CPN60, mitochondrial precursor;
           n=9; Plasmodium|Rep: Chaperonin CPN60, mitochondrial
           precursor - Plasmodium falciparum (isolate FCR-3 /
           Gambia)
          Length = 700

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +2

Query: 278 KVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYI 457
           K++ E   + +++ GDGT+S  ++ A + K   E V    +P  I  G +LA K  ++ I
Sbjct: 138 KLMQESTNISNDKAGDGTSSTALMTATITKKGIEQVNRNHNPIPIQRGIQLASKMIIEKI 197

Query: 458 Q 460
           +
Sbjct: 198 K 198


>UniRef50_Q7RFB5 Cluster: Chaperonin cpn60, mitochondrial; n=1;
           Plasmodium yoelii yoelii|Rep: Chaperonin cpn60,
           mitochondrial - Plasmodium yoelii yoelii
          Length = 585

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +2

Query: 278 KVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYI 457
           K++ E   + +++ GDGT+S  ++ A + K   E V    +P  I  G +LA K  ++ I
Sbjct: 124 KLMQESTNISNDKAGDGTSSTALMTATITKKGIEQVNNNHNPIPIQRGIQLASKMIMEKI 183

Query: 458 Q 460
           +
Sbjct: 184 K 184



 Score = 33.1 bits (72), Expect = 5.0
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 102 GDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           G+  R + +       ++VK +LGP G + +L  D G   + N+G TI K
Sbjct: 61  GNECRNELLKGILTVSDVVKLTLGPRGRNVLLEKDYGSPLIINDGVTIAK 110


>UniRef50_Q1GVZ9 Cluster: 60 kDa chaperonin 1; n=122; cellular
           organisms|Rep: 60 kDa chaperonin 1 - Sphingopyxis
           alaskensis (Sphingomonas alaskensis)
          Length = 547

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 18/70 (25%), Positives = 39/70 (55%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A++L E+A   +++ GDGTT+  ++A  +++   + V   ++P  +  G  LA  +
Sbjct: 67  ENMGAQMLREVASKANDKAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGIDLAVTK 126

Query: 443 AVKYIQDNLT 472
            V+ ++   T
Sbjct: 127 VVEDLKARST 136


>UniRef50_Q4S9T9 Cluster: Chromosome 2 SCAF14695, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 2
           SCAF14695, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 609

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   + +    +P  I  G  +A    ++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAVAKEGFDTISKGANPVEIRRGVMMAVDTVIQE 154

Query: 455 IQ 460
           ++
Sbjct: 155 LK 156


>UniRef50_P47632 Cluster: 60 kDa chaperonin; n=15; Bacteria|Rep: 60
           kDa chaperonin - Mycoplasma genitalium
          Length = 543

 Score = 36.7 bits (81), Expect = 0.41
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYR---- 427
           VE+  AKV+   A   ++  GDGTT+  I+A E+     E++    +P +I  G      
Sbjct: 65  VENIGAKVISVAAVSTNDIAGDGTTTATILAQEMTNRGIEIINKGANPVNIRRGIEDASL 124

Query: 428 LACKEAVKY 454
           L  KE  KY
Sbjct: 125 LIIKELEKY 133


>UniRef50_Q7XKP6 Cluster: OSJNBb0013O03.10 protein; n=3; Oryza
           sativa|Rep: OSJNBb0013O03.10 protein - Oryza sativa
           (Rice)
          Length = 189

 Score = 36.3 bits (80), Expect = 0.54
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +2

Query: 269 PAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELV 385
           PA  +L +L++ QD   GDGTT+V ++   LL++   L+
Sbjct: 6   PATCMLADLSRSQDATAGDGTTTVFVLTGSLLRHTHSLL 44


>UniRef50_A7RRC2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 563

 Score = 36.3 bits (80), Expect = 0.54
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +3

Query: 153 IVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           I+K S GP GLD ML    G++ +TN G+ IL+
Sbjct: 15  ILKKSFGPNGLDVMLRSSSGNILITNSGSMILE 47


>UniRef50_P21238 Cluster: RuBisCO large subunit-binding protein
           subunit alpha, chloroplast precursor; n=31; cellular
           organisms|Rep: RuBisCO large subunit-binding protein
           subunit alpha, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 586

 Score = 35.9 bits (79), Expect = 0.72
 Identities = 18/67 (26%), Positives = 37/67 (55%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           +E+  A ++ E+A   ++  GDGTT+  I+A E++K+    V +  +P S+  G     +
Sbjct: 110 MENAGAALIREVASKTNDSAGDGTTTASILAREIIKHGLLSVTSGANPVSLKRGIDKTVQ 169

Query: 440 EAVKYIQ 460
             ++ +Q
Sbjct: 170 GLIEELQ 176


>UniRef50_Q9FXL5 Cluster: Chaperonin-60 alpha subunit; n=3;
           Magnoliophyta|Rep: Chaperonin-60 alpha subunit -
           Avicennia marina (Grey mangrove)
          Length = 326

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/69 (24%), Positives = 37/69 (53%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           +E+  A ++ E+A   ++  GDGTT+  ++A E++K     V +  +P S+  G     +
Sbjct: 113 MENAGAALIREVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSVKRGIDKTMQ 172

Query: 440 EAVKYIQDN 466
             ++ ++ N
Sbjct: 173 GLIEELEKN 181


>UniRef50_Q870E6 Cluster: Heat shock protein 60; n=1; Piromyces sp.
           E2|Rep: Heat shock protein 60 - Piromyces sp. E2
          Length = 446

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/67 (22%), Positives = 36/67 (53%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A+++ ++A   ++E GDGTT+  ++A  +     + V   ++P  +  G + A   
Sbjct: 11  ENLGARIVQDVAIKTNDEAGDGTTTATVLARAIFAEGLKNVSAGVNPVELRRGVQKAVDV 70

Query: 443 AVKYIQD 463
            V ++++
Sbjct: 71  VVDFLKE 77


>UniRef50_P0A521 Cluster: 60 kDa chaperonin 2; n=1802; cellular
           organisms|Rep: 60 kDa chaperonin 2 - Mycobacterium bovis
          Length = 540

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 4/72 (5%)
 Frame = +2

Query: 248 KNVEVEHP----AAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSII 415
           K +E+E P     A+++ E+A+  D+  GDGTT+  ++A  L++     V    +P  + 
Sbjct: 57  KEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLK 116

Query: 416 SGYRLACKEAVK 451
            G   A ++  +
Sbjct: 117 RGIEKAVEKVTE 128


>UniRef50_Q25BV5 Cluster: 60 kDa chaperonin; n=1; Methylomicrobium
           sp. NI|Rep: 60 kDa chaperonin - Methylomicrobium sp. NI
          Length = 559

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG 421
           A++L ++A     EVGDGTT+ +++A  L   + + V    HP  I  G
Sbjct: 72  ARMLRDVAGSVSREVGDGTTTAIVLAQTLAIESIKSVAAGFHPLQIKQG 120


>UniRef50_Q9AW47 Cluster: Chaperonin-containing-TCP1 theta subunit;
           n=1; Guillardia theta|Rep: Chaperonin-containing-TCP1
           theta subunit - Guillardia theta (Cryptomonas phi)
          Length = 515

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 16/65 (24%), Positives = 37/65 (56%)
 Frame = +2

Query: 266 HPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEA 445
           HP++K++      QD+E GDG+  + +++ E+L+ +  L+K       +I+  +   K +
Sbjct: 70  HPSSKLITSYIFYQDKEFGDGSGLLFLLSCEILEKSLYLIKKGFFTYQLINCLKNIEKIS 129

Query: 446 VKYIQ 460
           +K ++
Sbjct: 130 LKILE 134


>UniRef50_P08823 Cluster: RuBisCO large subunit-binding protein
           subunit alpha, chloroplast precursor; n=13;
           Eukaryota|Rep: RuBisCO large subunit-binding protein
           subunit alpha, chloroplast precursor - Triticum aestivum
           (Wheat)
          Length = 543

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 16/54 (29%), Positives = 31/54 (57%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG 421
           +E+  A ++ E+A   ++  GDGTT+  ++A E++K     V +  +P S+  G
Sbjct: 66  MENAGAALIREVASKTNDSAGDGTTTACVLAREIIKLGILSVTSGANPVSLKKG 119


>UniRef50_Q47TE8 Cluster: 60 kDa chaperonin 1; n=4; cellular
           organisms|Rep: 60 kDa chaperonin 1 - Thermobifida fusca
           (strain YX)
          Length = 541

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 4/84 (4%)
 Frame = +2

Query: 248 KNVEVEHP----AAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSII 415
           K +E+E P     A+++ E+A+  D+  GDGTT+  ++A  L++     V    +P  + 
Sbjct: 58  KEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPIGLK 117

Query: 416 SGYRLACKEAVKYIQDNLTVTVES 487
            G   A     + +  NL+  VE+
Sbjct: 118 RGIDAAVARISEELA-NLSKEVET 140


>UniRef50_Q55EH3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 584

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 13/53 (24%), Positives = 35/53 (66%)
 Frame = +2

Query: 326 GTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVE 484
           G ++ +++++ L++NA  L+   +   SIISGY+++   ++KY+ +  ++ ++
Sbjct: 65  GVSTSLLLSSSLMENALNLLYKGLDLNSIISGYKISLNYSLKYLNEMKSIKLD 117


>UniRef50_UPI00005A5A84 Cluster: PREDICTED: similar to heat shock
           protein 1 (chaperonin); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to heat shock protein 1 (chaperonin)
           - Canis familiaris
          Length = 173

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 293 LAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           +A   +EE GDGTT+  ++A  + K   E +    +P     G RLA
Sbjct: 74  VANNTNEEAGDGTTTATVLARSIAKKGFEKISNGANPVENRRGVRLA 120


>UniRef50_Q8RIT3 Cluster: 60 kDa chaperonin; n=4;
           Desulfitobacterium|Rep: 60 kDa chaperonin -
           Desulfitobacterium hafniense (Desulfitobacterium
           frappieri)
          Length = 523

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 13/61 (21%), Positives = 33/61 (54%)
 Frame = +2

Query: 278 KVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYI 457
           +++ E A+  ++  GDGTT+ V++A  +++   + +   ++P  +I G        V+ +
Sbjct: 71  QIIREAAEKTNDLAGDGTTTAVVLAQAMIEEGMKQIAAGLNPVCLIKGLERGAAAVVEAV 130

Query: 458 Q 460
           +
Sbjct: 131 R 131


>UniRef50_Q95UT0 Cluster: CPN60; n=1; Spironucleus barkhanus|Rep:
           CPN60 - Spironucleus barkhanus
          Length = 512

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 13/33 (39%), Positives = 24/33 (72%)
 Frame = +2

Query: 269 PAAKVLVELAQLQDEEVGDGTTSVVIIAAELLK 367
           P A++L E +Q  +++ GDGTT+  ++A EL++
Sbjct: 83  PGAQLLKEASQYVEQKAGDGTTTATLLANELIQ 115


>UniRef50_Q4YYM6 Cluster: Chaperone, putative; n=4; Plasmodium
           (Vinckeia)|Rep: Chaperone, putative - Plasmodium berghei
          Length = 542

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+        I+KS+LGP G  KMLV   G + +T +G  +L
Sbjct: 22  NINASKGMYEIIKSNLGPKGSYKMLVSASGAIKITKDGNVLL 63


>UniRef50_P29842 Cluster: 60 kDa chaperonin; n=18;
           Betaproteobacteria|Rep: 60 kDa chaperonin - Neisseria
           gonorrhoeae
          Length = 544

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 16/67 (23%), Positives = 36/67 (53%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A+++ E+A   ++  GDGTT+  ++A  ++    + V   ++PT +  G   A   
Sbjct: 67  ENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGIKAVTAGMNPTDLKRGIDKAVAA 126

Query: 443 AVKYIQD 463
            V+ +++
Sbjct: 127 LVEELKN 133


>UniRef50_Q9VPS5 Cluster: 60 kDa heat shock protein homolog 1,
           mitochondrial precursor; n=3; Drosophila
           melanogaster|Rep: 60 kDa heat shock protein homolog 1,
           mitochondrial precursor - Drosophila melanogaster (Fruit
           fly)
          Length = 648

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +E  GDGTT+  ++A  + K     +    +P  I  G  LA  + VK 
Sbjct: 89  AKLVQDVADNTNESAGDGTTTATVLARAIAKEGFNQITMGANPVEIRRGVMLAV-DVVKD 147

Query: 455 IQDNLTVTVES 487
               ++  VE+
Sbjct: 148 KLKEMSKAVET 158


>UniRef50_Q7NT31 Cluster: 60 kDa chaperonin 1; n=44; cellular
           organisms|Rep: 60 kDa chaperonin 1 - Chromobacterium
           violaceum
          Length = 538

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKE 442
           E+  A+++ E+A    +  GDGTT+  ++A  +++   + V + ++P  +  G   A   
Sbjct: 67  ENMGAQMVKEVASKTADVAGDGTTTATVLAQAIVQEGMKYVASGMNPMDLKRGIDKAVHA 126

Query: 443 AVKYIQ 460
            +K +Q
Sbjct: 127 VIKELQ 132


>UniRef50_UPI0000E46238 Cluster: PREDICTED: similar to chaperonin
           containing TCP1, subunit 6A isoform 1; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           chaperonin containing TCP1, subunit 6A isoform 1 -
           Strongylocentrotus purpuratus
          Length = 485

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 13/33 (39%), Positives = 23/33 (69%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 32  DVLRTNLGPKGTIKMLVSGSGDIKLTKDGNVLL 64


>UniRef50_Q1GFR8 Cluster: Carbon monoxide dehydrogenase large chain;
           n=113; Bacteria|Rep: Carbon monoxide dehydrogenase large
           chain - Silicibacter sp. (strain TM1040)
          Length = 792

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = +2

Query: 293 LAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLT 472
           LAQ +   VGD   +VV  +AEL ++A E ++ +I     +   + A  E    + D+LT
Sbjct: 106 LAQGKVRHVGDPIAAVVAESAELARDAAEAIELEIEELPAVIDMKAALAEEAPKVHDDLT 165


>UniRef50_A7P765 Cluster: Chromosome chr9 scaffold_7, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr9 scaffold_7, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 634

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 18/63 (28%), Positives = 32/63 (50%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  A+++ + A   ++  GDGTT+ V++A  L+    ++V    +P  I  G     K
Sbjct: 130 VENIGARLVRQAASKTNDLAGDGTTTSVVLAQGLITEGVKVVAAGANPVQITRGIENTTK 189

Query: 440 EAV 448
             V
Sbjct: 190 ALV 192


>UniRef50_Q8VB89 Cluster: Wsv094; n=1; Shrimp white spot syndrome
           virus|Rep: Wsv094 - White spot syndrome virus (WSSV)
          Length = 163

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 13/32 (40%), Positives = 15/32 (46%)
 Frame = -1

Query: 158 YYVCYSRCCHYILCSHWVSAGSCPCYRQRCSY 63
           YY C   CC+Y  C  +     C CY  RC Y
Sbjct: 52  YYCCCYYCCYYYYCC-YCCYYCCCCYHCRCHY 82


>UniRef50_Q010P5 Cluster: Chaperonin-60, mitochondrial; n=2;
           cellular organisms|Rep: Chaperonin-60, mitochondrial -
           Ostreococcus tauri
          Length = 639

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 17/81 (20%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           A ++ +++   ++  GDGTT+  ++A  +     + V   ++P  +  G   A +  VK 
Sbjct: 104 ASLVKQVSVSTNDVAGDGTTTATVLARAIFSEGCKSVAAGMNPMDLRRGINAAVEHVVKE 163

Query: 455 IQDNLTV--TVESLGRPSLIT 511
           ++ N+ +  T E + +   I+
Sbjct: 164 LKKNVKMISTTEEIAQVGTIS 184


>UniRef50_P21240 Cluster: RuBisCO large subunit-binding protein
           subunit beta, chloroplast precursor; n=24;
           Viridiplantae|Rep: RuBisCO large subunit-binding protein
           subunit beta, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 600

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 18/63 (28%), Positives = 31/63 (49%)
 Frame = +2

Query: 260 VEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACK 439
           VE+  AK++ + A   ++  GDGTT+ V++A   +    ++V    +P  I  G     K
Sbjct: 121 VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAK 180

Query: 440 EAV 448
             V
Sbjct: 181 ALV 183


>UniRef50_P59698 Cluster: 60 kDa chaperonin 2; n=3;
           Chlamydophila|Rep: 60 kDa chaperonin 2 - Chlamydophila
           caviae
          Length = 536

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +2

Query: 263 EHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           E+   K++ E A   + +VGDG+T+ +++   L  +  + V   + P  I  G +LA
Sbjct: 66  ENTGLKLIKEAALQMEAQVGDGSTTAIVLTDALFASGLKGVAVGLDPLEIKQGIQLA 122


>UniRef50_Q4REW1 Cluster: Chromosome 13 SCAF15122, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 13
           SCAF15122, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 628

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLK 367
           + +EHP A+V+V+         GDG+ + V++ A LL+
Sbjct: 76  LRLEHPLARVVVDCVLKHSAATGDGSKTFVLLLASLLR 113


>UniRef50_Q8F380 Cluster: Putative uncharacterized protein; n=4;
           Leptospira|Rep: Putative uncharacterized protein -
           Leptospira interrogans
          Length = 161

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +2

Query: 278 KVLVE--LAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIIS 418
           +V+VE  +A LQ E   D + S  + AAE LKNA E  KTK+   S +S
Sbjct: 65  EVIVEPLIASLQQETARDSSLSPALKAAEKLKNASE-EKTKLEAYSELS 112


>UniRef50_A5EYB7 Cluster: Macrolide-specific ABC-type efflux
           protein; n=1; Dichelobacter nodosus VCS1703A|Rep:
           Macrolide-specific ABC-type efflux protein -
           Dichelobacter nodosus (strain VCS1703A)
          Length = 394

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHP---TSIISG 421
           +EVE     +LV L  L D+E  DGTTSV ++ AE  +    +VKT +       I+SG
Sbjct: 314 IEVERAEKTLLVPLTALHDDE--DGTTSVNVLTAE-QQPQKRIVKTGLEDGINAQIVSG 369


>UniRef50_A5ESP5 Cluster: Ribonuclease P protein component; n=11;
           Bradyrhizobiaceae|Rep: Ribonuclease P protein component
           - Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
          Length = 136

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +2

Query: 356 ELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVESLGRPSLITQPKQPCHL 535
           EL+K  D L   + H   ++ G R A     + + D+L  T+  L RP    QP++P   
Sbjct: 62  ELVKRLDPL-SMRPHSDYVLIGRRDALSRDFQTMLDDLQTTLRRLDRPQAKPQPRKPSDA 120

Query: 536 N 538
           N
Sbjct: 121 N 121


>UniRef50_Q4Q711 Cluster: Chaperonin HSP60/CNP60, putative; n=6;
           Trypanosomatidae|Rep: Chaperonin HSP60/CNP60, putative -
           Leishmania major
          Length = 538

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +2

Query: 257 EVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLAC 436
           + E   AK++ ++A   ++  GDGTT+  I+A  +     + V T  +P  +  G     
Sbjct: 73  QFEDVGAKLIRQVAGKTNDVAGDGTTTATILAWSIFAEGYKSVATGANPMDLKRG----I 128

Query: 437 KEAVKYIQDNL 469
             AV+ I DNL
Sbjct: 129 DAAVEIILDNL 139


>UniRef50_A0C3G4 Cluster: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 539

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 15/55 (27%), Positives = 28/55 (50%)
 Frame = +2

Query: 320 GDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVE 484
           GDGTT+  +IAA + +     V    +P  I  G + A    ++Y+++  T  ++
Sbjct: 91  GDGTTTSALIAANIFEMGQAYVSAGHNPIYITRGLKEAKNRVLEYLEEIKTTEID 145


>UniRef50_O34191 Cluster: 60 kDa chaperonin; n=148;
           Rickettsiales|Rep: 60 kDa chaperonin - Anaplasma
           phagocytophilum (Ehrlichia phagocytophila)
          Length = 541

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 4/72 (5%)
 Frame = +2

Query: 245 IKNVEVEHPAA----KVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSI 412
           +K+++ E P A     ++ + A   +++VGDGTT+  I+ A++++   +         SI
Sbjct: 56  MKSIKPEEPLAAAIASIITQSASQCNDKVGDGTTTCSILTAKVIEEVSKAKAAGSDIVSI 115

Query: 413 ISGYRLACKEAV 448
            +G  L  KEAV
Sbjct: 116 KNGI-LKAKEAV 126


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 566,883,788
Number of Sequences: 1657284
Number of extensions: 10418982
Number of successful extensions: 23934
Number of sequences better than 10.0: 138
Number of HSP's better than 10.0 without gapping: 23169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23914
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41488046300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -