SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30110.Seq
         (444 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9GP16 Cluster: 60S ribosomal protein L31; n=27; Coelom...   153   1e-36
UniRef50_P62899 Cluster: 60S ribosomal protein L31; n=48; Metazo...   126   3e-28
UniRef50_Q9V597 Cluster: 60S ribosomal protein L31; n=173; Eukar...   118   6e-26
UniRef50_Q9GN74 Cluster: 60S ribosomal protein L31; n=20; Coelom...   115   4e-25
UniRef50_UPI00005A08CD Cluster: PREDICTED: similar to ribosomal ...   105   6e-22
UniRef50_Q4PI65 Cluster: Putative uncharacterized protein; n=1; ...    99   2e-20
UniRef50_P51420 Cluster: 60S ribosomal protein L31-3; n=12; Euka...    99   2e-20
UniRef50_UPI0000DA1BEE Cluster: PREDICTED: similar to ribosomal ...    87   2e-16
UniRef50_UPI0001505641 Cluster: 60S ribosomal protein L31 (RPL31...    85   5e-16
UniRef50_UPI0000D9FB71 Cluster: PREDICTED: similar to ribosomal ...    83   3e-15
UniRef50_Q22DH9 Cluster: 60S ribosomal protein L31, putative; n=...    77   2e-13
UniRef50_Q7RSL1 Cluster: Ribosomal protein L31e, putative; n=7; ...    69   5e-11
UniRef50_UPI000049A444 Cluster: 60S ribosomal protein L31; n=2; ...    68   8e-11
UniRef50_Q6Y207 Cluster: Ribosomal protein L31; n=9; Euteleostom...    62   4e-09
UniRef50_UPI00005A10F5 Cluster: PREDICTED: similar to ribosomal ...    61   1e-08
UniRef50_Q06740 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_Q1X7K2 Cluster: Ribosomal protein L31; n=7; Trypanosoma...    52   4e-06
UniRef50_Q7QSE2 Cluster: GLP_426_16236_15916; n=1; Giardia lambl...    48   9e-05
UniRef50_UPI00005A550D Cluster: PREDICTED: similar to ribosomal ...    48   1e-04
UniRef50_Q98RR6 Cluster: 60S ribosomal protein L31; n=1; Guillar...    45   8e-04
UniRef50_P54009 Cluster: 50S ribosomal protein L31e; n=7; Euryar...    44   0.001
UniRef50_Q74MC9 Cluster: NEQ364; n=1; Nanoarchaeum equitans|Rep:...    42   0.006
UniRef50_UPI00015BAD97 Cluster: LSU ribosomal protein L31E; n=1;...    42   0.008
UniRef50_Q8PYQ4 Cluster: 50S ribosomal protein L31e; n=11; Eurya...    42   0.008
UniRef50_Q9YD25 Cluster: 50S ribosomal protein L31e; n=1; Aeropy...    41   0.010
UniRef50_A2X8Z3 Cluster: Putative uncharacterized protein; n=1; ...    40   0.018
UniRef50_Q8U3S7 Cluster: 50S ribosomal protein L31e; n=5; Thermo...    40   0.032
UniRef50_O28213 Cluster: 50S ribosomal protein L31e; n=1; Archae...    38   0.074
UniRef50_A0CQV2 Cluster: Chromosome undetermined scaffold_24, wh...    35   0.91 
UniRef50_A3DNH4 Cluster: 50S ribosomal protein L31e; n=2; Desulf...    34   1.2  
UniRef50_A0RW54 Cluster: Ribosomal protein L31E; n=2; Thermoprot...    33   2.1  
UniRef50_A2EKX9 Cluster: Ribosomal protein L31e, putative; n=6; ...    33   2.8  
UniRef50_Q820F4 Cluster: Holliday junction ATP-dependent DNA hel...    33   2.8  
UniRef50_Q02B40 Cluster: HAD-superfamily hydrolase, subfamily IA...    33   3.7  

>UniRef50_Q9GP16 Cluster: 60S ribosomal protein L31; n=27;
           Coelomata|Rep: 60S ribosomal protein L31 - Heliothis
           virescens (Noctuid moth) (Owlet moth)
          Length = 124

 Score =  153 bits (372), Expect = 1e-36
 Identities = 71/72 (98%), Positives = 72/72 (100%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD+R
Sbjct: 1   MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDVR 60

Query: 218 VDTRLNKFLWSK 253
           VDTRLNKFLWSK
Sbjct: 61  VDTRLNKFLWSK 72



 Score = 86.2 bits (204), Expect = 3e-16
 Identities = 42/52 (80%), Positives = 42/52 (80%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           GVRNVPF          NDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE
Sbjct: 73  GVRNVPFRVRVRLSRRRNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 124


>UniRef50_P62899 Cluster: 60S ribosomal protein L31; n=48;
           Metazoa|Rep: 60S ribosomal protein L31 - Homo sapiens
           (Human)
          Length = 125

 Score =  126 bits (303), Expect = 3e-28
 Identities = 56/72 (77%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +W+K
Sbjct: 64  IDTRLNKAVWAK 75



 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 27/48 (56%), Positives = 33/48 (68%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 396
           G+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 76  GIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>UniRef50_Q9V597 Cluster: 60S ribosomal protein L31; n=173;
           Eukaryota|Rep: 60S ribosomal protein L31 - Drosophila
           melanogaster (Fruit fly)
          Length = 124

 Score =  118 bits (284), Expect = 6e-26
 Identities = 53/72 (73%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +WSK
Sbjct: 61  IDTRLNKHIWSK 72



 Score = 61.7 bits (143), Expect = 7e-09
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 73  GIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>UniRef50_Q9GN74 Cluster: 60S ribosomal protein L31; n=20;
           Coelomata|Rep: 60S ribosomal protein L31 - Aedes aegypti
           (Yellowfever mosquito)
          Length = 124

 Score =  115 bits (277), Expect = 4e-25
 Identities = 52/72 (72%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           MAK K E+K KSAINEVVTRE T+NL++RLH VG+KKRAPRA+K +RKFAEK+MGT D+R
Sbjct: 1   MAKTKTEKKAKSAINEVVTRECTINLNRRLHKVGYKKRAPRAVKIVRKFAEKEMGTNDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK LW +
Sbjct: 61  IDTRLNKALWHR 72



 Score = 63.7 bits (148), Expect = 2e-09
 Identities = 28/52 (53%), Positives = 38/52 (73%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+RN PF          NDDEDS +KL+TLVTYVPV++ K LQTENV+++++
Sbjct: 73  GIRNPPFRIRVRLSRRRNDDEDSPNKLYTLVTYVPVSTFKELQTENVESTED 124


>UniRef50_UPI00005A08CD Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L31 - Canis familiaris
          Length = 130

 Score =  105 bits (251), Expect = 6e-22
 Identities = 43/54 (79%), Positives = 52/54 (96%)
 Frame = +2

Query: 92  TREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           TREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R+DTRLNK +W+K
Sbjct: 60  TREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAK 113


>UniRef50_Q4PI65 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 175

 Score =   99 bits (238), Expect = 2e-20
 Identities = 45/76 (59%), Positives = 59/76 (77%)
 Frame = +2

Query: 44  KPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 223
           K +  +K +SA+N+VVTREYTVNLHKR+H V FKKRAPRAIKE+  FA+K MGT D+R+D
Sbjct: 55  KSQKGKKTRSALNDVVTREYTVNLHKRVHDVAFKKRAPRAIKEVVAFAQKAMGTKDVRLD 114

Query: 224 TRLNKFLWSKESEMFP 271
            +LN+ +W    + FP
Sbjct: 115 PKLNQEVWKYGVKNFP 130



 Score = 32.3 bits (70), Expect = 4.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFT-LVTYVPVASIKGLQTENVD 396
           GV+N P           NDDE +  KL+T  V  + + + KGLQT  +D
Sbjct: 125 GVKNFPRRLRVRLERKRNDDEGAKEKLYTYAVPVLGLGTAKGLQTTVID 173


>UniRef50_P51420 Cluster: 60S ribosomal protein L31-3; n=12;
           Eukaryota|Rep: 60S ribosomal protein L31-3 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 119

 Score =   99 bits (238), Expect = 2e-20
 Identities = 45/66 (68%), Positives = 55/66 (83%)
 Frame = +2

Query: 56  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 235
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60

Query: 236 KFLWSK 253
           K +WSK
Sbjct: 61  KQIWSK 66



 Score = 31.9 bits (69), Expect = 6.4
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 396
           G+R  P           NDDED+  + F+LVT   +P   + GL T+ ++
Sbjct: 67  GIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>UniRef50_UPI0000DA1BEE Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to ribosomal protein L31 - Rattus norvegicus
          Length = 163

 Score = 86.6 bits (205), Expect = 2e-16
 Identities = 40/62 (64%), Positives = 49/62 (79%)
 Frame = +2

Query: 41  AKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 220
           AK  G++KG SAINE+VTREYT+N+HKR+H VGFK  AP A+KEI KFA K MGTP+  +
Sbjct: 4   AKKGGKKKGHSAINEMVTREYTINIHKRIHEVGFKMHAPWALKEIWKFAIKAMGTPEFVI 63

Query: 221 DT 226
            T
Sbjct: 64  CT 65


>UniRef50_UPI0001505641 Cluster: 60S ribosomal protein L31 (RPL31C);
           n=1; Arabidopsis thaliana|Rep: 60S ribosomal protein L31
           (RPL31C) - Arabidopsis thaliana
          Length = 85

 Score = 85.4 bits (202), Expect = 5e-16
 Identities = 39/56 (69%), Positives = 47/56 (83%)
 Frame = +2

Query: 56  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 223
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVD 56


>UniRef50_UPI0000D9FB71 Cluster: PREDICTED: similar to ribosomal
           protein L31, partial; n=1; Macaca mulatta|Rep:
           PREDICTED: similar to ribosomal protein L31, partial -
           Macaca mulatta
          Length = 129

 Score = 83.0 bits (196), Expect = 3e-15
 Identities = 40/77 (51%), Positives = 55/77 (71%)
 Frame = +2

Query: 89  VTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMF 268
           VTR YT N+ K + GVGFKKR P+A+KEI+KFA K+M T D+R+DTR NK +W+K +   
Sbjct: 25  VTRGYTSNIQKHIRGVGFKKRGPQALKEIQKFAMKEMRTLDVRLDTRQNKAVWNKGTSNV 84

Query: 269 PSVSV*GFHEDVMMMKI 319
             V + GF E++M + I
Sbjct: 85  SWVPICGF-ENMMKLNI 100



 Score = 31.9 bits (69), Expect = 6.4
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +1

Query: 325 HKLFTLVTYVPVASIKGL 378
           HKL+TL+TYVPV + K L
Sbjct: 101 HKLYTLITYVPVTTFKNL 118


>UniRef50_Q22DH9 Cluster: 60S ribosomal protein L31, putative; n=1;
           Tetrahymena thermophila SB210|Rep: 60S ribosomal protein
           L31, putative - Tetrahymena thermophila SB210
          Length = 111

 Score = 77.0 bits (181), Expect = 2e-13
 Identities = 33/56 (58%), Positives = 41/56 (73%)
 Frame = +2

Query: 104 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFP 271
           TVNLHK+ H + FKK+APRAI+EI   A+K MGT D+R+DT LNKF+WS      P
Sbjct: 12  TVNLHKQCHKISFKKKAPRAIREIVAIAKKTMGTDDVRIDTELNKFIWSNGIRNIP 67



 Score = 33.5 bits (73), Expect = 2.1
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDA 399
           G+RN+P           N++E +  + +TLV ++ V S  GL TE   A
Sbjct: 62  GIRNIPRRVRVRLCKRKNEEEGAQSQFYTLVQHLQVDSYHGLLTEKTKA 110


>UniRef50_Q7RSL1 Cluster: Ribosomal protein L31e, putative; n=7;
           Apicomplexa|Rep: Ribosomal protein L31e, putative -
           Plasmodium yoelii yoelii
          Length = 142

 Score = 68.9 bits (161), Expect = 5e-11
 Identities = 30/54 (55%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  TREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           T+  T+NL K  H V +K++APRAIKEI+  A K M T D+R+D +LNKF+WSK
Sbjct: 39  TKVITINLSKLTHDVCYKRKAPRAIKEIKNIAGKLMHTKDVRLDVKLNKFIWSK 92



 Score = 38.7 bits (86), Expect = 0.056
 Identities = 19/45 (42%), Positives = 25/45 (55%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 387
           G+RN P           N+DEDS  +++TLV +V V S KGL  E
Sbjct: 93  GIRNPPKRVRVKIERVRNEDEDSKERMYTLVQHVMVDSYKGLVNE 137


>UniRef50_UPI000049A444 Cluster: 60S ribosomal protein L31; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L31 - Entamoeba histolytica HM-1:IMSS
          Length = 150

 Score = 68.1 bits (159), Expect = 8e-11
 Identities = 35/75 (46%), Positives = 47/75 (62%)
 Frame = +2

Query: 29  KITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP 208
           K+   KP  E K K      +TRE T+++HK LH   FKKRAP+AIK IR  A K M T 
Sbjct: 28  KVGNKKPSKEIKAKEMAP--ITREMTIHMHKYLHKESFKKRAPKAIKIIRFLAIKTMKTH 85

Query: 209 DIRVDTRLNKFLWSK 253
           +++ D  LN+F+WS+
Sbjct: 86  NVKFDMGLNQFIWSQ 100



 Score = 36.3 bits (80), Expect = 0.30
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 313 EDSAHKLFTLVTYVPVASIKGLQTENVDASQ 405
           E    K +TLV+YVPVAS KGL T+ V+ ++
Sbjct: 119 EGEEGKFYTLVSYVPVASFKGLVTKTVEETE 149


>UniRef50_Q6Y207 Cluster: Ribosomal protein L31; n=9;
           Euteleostomi|Rep: Ribosomal protein L31 - Pagrus major
           (Red sea bream) (Chrysophrys major)
          Length = 91

 Score = 62.5 bits (145), Expect = 4e-09
 Identities = 29/48 (60%), Positives = 34/48 (70%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 396
           GVRNVP+          N+DEDS +KL+TLVTYVPV + KGLQT NVD
Sbjct: 42  GVRNVPYRMRVRLSRKRNEDEDSPNKLYTLVTYVPVTTCKGLQTVNVD 89



 Score = 51.6 bits (118), Expect = 7e-06
 Identities = 22/31 (70%), Positives = 26/31 (83%)
 Frame = +2

Query: 161 AIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           A   IRKFA K+MGTPD+R+DTRLNK +WSK
Sbjct: 11  APSRIRKFAVKEMGTPDVRMDTRLNKAVWSK 41


>UniRef50_UPI00005A10F5 Cluster: PREDICTED: similar to ribosomal
           protein L31; n=2; Eutheria|Rep: PREDICTED: similar to
           ribosomal protein L31 - Canis familiaris
          Length = 175

 Score = 60.9 bits (141), Expect = 1e-08
 Identities = 27/48 (56%), Positives = 34/48 (70%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 396
           G+RNVP+          N+DEDS +KL+TLVTYVPV ++K LQT NVD
Sbjct: 126 GIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTLKNLQTVNVD 173



 Score = 58.4 bits (135), Expect = 6e-08
 Identities = 23/37 (62%), Positives = 32/37 (86%)
 Frame = +2

Query: 143 KKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           +K   RA+K+IRKFA K++GTPD+R+DTRLNK +W+K
Sbjct: 89  RKERRRALKDIRKFAMKELGTPDVRIDTRLNKAVWAK 125


>UniRef50_Q06740 Cluster: Putative uncharacterized protein; n=1;
           Saccharomyces cerevisiae|Rep: Putative uncharacterized
           protein - Saccharomyces cerevisiae (Baker's yeast)
          Length = 77

 Score = 59.7 bits (138), Expect = 3e-08
 Identities = 31/50 (62%), Positives = 34/50 (68%)
 Frame = -1

Query: 234 FKRVSTRMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTT 85
           F   + R S VP+C  ANF ISL ALGA FL  TP + LCKL VYSRVTT
Sbjct: 28  FNSGARRTSSVPMCNLANFLISLTALGALFLKETPCNLLCKLMVYSRVTT 77


>UniRef50_Q1X7K2 Cluster: Ribosomal protein L31; n=7;
           Trypanosomatidae|Rep: Ribosomal protein L31 - Leishmania
           major
          Length = 188

 Score = 52.4 bits (120), Expect = 4e-06
 Identities = 25/57 (43%), Positives = 34/57 (59%)
 Frame = +2

Query: 83  EVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           + V+ E T++L K L    F KRAP AIK I+ F  + M T D R+D  LN ++W K
Sbjct: 82  DAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHK 138



 Score = 33.9 bits (74), Expect = 1.6
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLF-TLVTYVPVASIKGLQTENVD 396
           GV+ VP              E + HK F T+++ VPVAS KGL T+ V+
Sbjct: 139 GVKGVPGRVRVLIQRKSETTEGNKHKHFYTVISNVPVASFKGLTTKTVE 187


>UniRef50_Q7QSE2 Cluster: GLP_426_16236_15916; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_426_16236_15916 - Giardia lamblia
           ATCC 50803
          Length = 106

 Score = 48.0 bits (109), Expect = 9e-05
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +2

Query: 89  VTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSK 253
           +  E+T+ L+K + G   KK AP AI+ IR   EK     D+R+D  +N F+WS+
Sbjct: 3   IVYEHTIRLNKAVRGKPSKKAAPIAIRAIRAQVEKLAKVEDVRLDPSVNVFVWSR 57


>UniRef50_UPI00005A550D Cluster: PREDICTED: similar to ribosomal
           protein L31; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L31 - Canis familiaris
          Length = 141

 Score = 47.6 bits (108), Expect = 1e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +2

Query: 137 GFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 238
           GF++  P  +KEIRKFA K+MGTPD+ +D   NK
Sbjct: 49  GFREACPSGLKEIRKFAMKEMGTPDVHMDPGFNK 82



 Score = 32.7 bits (71), Expect = 3.7
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 1/75 (1%)
 Frame = +1

Query: 145 KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQIPLV*GVRN-VPFXXXXXXXXXXNDDEDS 321
           +ACP   +   K   K  G           +     G+RN VP            +DEDS
Sbjct: 52  EACPSGLKEIRKFAMKEMGTPDVHMDPGFNKAVQAEGIRNNVPHRIPVRLSRKCKEDEDS 111

Query: 322 AHKLFTLVTYVPVAS 366
            +KL+ LVT VPV +
Sbjct: 112 PNKLYRLVTCVPVTT 126


>UniRef50_Q98RR6 Cluster: 60S ribosomal protein L31; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L31 - Guillardia theta
           (Cryptomonas phi)
          Length = 97

 Score = 44.8 bits (101), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 32/55 (58%)
 Frame = +2

Query: 110 NLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPS 274
           N+HKR+ G  F KR   AIKEI+KFA K     +IR++  LN  + S  S   P+
Sbjct: 15  NIHKRVFGKKFNKRVSIAIKEIKKFAWKLTKCNNIRIEPELNMQICSNGSSNPPN 69


>UniRef50_P54009 Cluster: 50S ribosomal protein L31e; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L31e -
           Methanococcus jannaschii
          Length = 87

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 20/60 (33%), Positives = 36/60 (60%)
 Frame = +2

Query: 95  REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPS 274
           R YT+ L   ++     KRAPRAIK+I++F ++ M    +++D  LN+ +W +  +  P+
Sbjct: 9   RIYTIPLRDVINKSVRTKRAPRAIKKIKQFLKRHMKAEIVKIDNELNEKIWERGIQKPPA 68


>UniRef50_Q74MC9 Cluster: NEQ364; n=1; Nanoarchaeum equitans|Rep:
           NEQ364 - Nanoarchaeum equitans
          Length = 79

 Score = 41.9 bits (94), Expect = 0.006
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +2

Query: 98  EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPS 274
           EYTVNL K +      KR  +A+K +++F  +      +++   LNKF+W +     P+
Sbjct: 2   EYTVNLRKAVLVTSRFKRTKKAVKALKEFVMRHTKAKIVKISQELNKFIWKRGGRKPPT 60


>UniRef50_UPI00015BAD97 Cluster: LSU ribosomal protein L31E; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L31E - Ignicoccus hospitalis KIN4/I
          Length = 101

 Score = 41.5 bits (93), Expect = 0.008
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +2

Query: 101 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGT--PDIRVDTRLNKFLWS 250
           YT+NL +RL+      RA RA++ +R+F  +  G    D+++D  +N +LWS
Sbjct: 10  YTINL-RRLYWGRRSNRAKRAVRMVREFVARHFGVEPEDVKIDNTVNNYLWS 60


>UniRef50_Q8PYQ4 Cluster: 50S ribosomal protein L31e; n=11;
           Euryarchaeota|Rep: 50S ribosomal protein L31e -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 93

 Score = 41.5 bits (93), Expect = 0.008
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 65  GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGT--PDIRVDTRLNK 238
           GK A + V  + YT+ L + +  V   KRA RA+KE+R F  + M T    +++D  +N+
Sbjct: 3   GKMADDMVKEQIYTIPL-REVRKVPAWKRAGRAVKEVRGFLVRHMKTEAEQVKLDKTINE 61

Query: 239 FLWSKESEMFP 271
            LW K  E  P
Sbjct: 62  CLWEKGCEKPP 72


>UniRef50_Q9YD25 Cluster: 50S ribosomal protein L31e; n=1; Aeropyrum
           pernix|Rep: 50S ribosomal protein L31e - Aeropyrum
           pernix
          Length = 104

 Score = 41.1 bits (92), Expect = 0.010
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 101 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPS 274
           Y VNL +R++     +RA RA++ +R+F  +     ++ +D  LN ++WS+  E  P+
Sbjct: 9   YVVNL-RRVYWGRRTRRAIRAVRMVREFVRRHTKADEVVIDNELNNYIWSRSREKPPA 65


>UniRef50_A2X8Z3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 93

 Score = 40.3 bits (90), Expect = 0.018
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 80  NEVVTREYTVNLHKRLHG 133
           +EVVTREYT+NLHKRLHG
Sbjct: 13  DEVVTREYTINLHKRLHG 30


>UniRef50_Q8U3S7 Cluster: 50S ribosomal protein L31e; n=5;
           Thermococcaceae|Rep: 50S ribosomal protein L31e -
           Pyrococcus furiosus
          Length = 95

 Score = 39.5 bits (88), Expect = 0.032
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +2

Query: 101 YTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWSKESEMFPS 274
           +TV + K    V   KRAPRA+K +R+F  +     ++ +D ++N+ +W +  E  PS
Sbjct: 11  FTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPKVNEKIWERGIEKPPS 68


>UniRef50_O28213 Cluster: 50S ribosomal protein L31e; n=1;
           Archaeoglobus fulgidus|Rep: 50S ribosomal protein L31e -
           Archaeoglobus fulgidus
          Length = 88

 Score = 38.3 bits (85), Expect = 0.074
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query: 86  VVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP--DIRVDTRLNKFLWSKES 259
           VV R Y++ L  ++       RA +A K +RKF  + M     ++++DT +N+ +W + +
Sbjct: 5   VVERVYSIRLRHKMKRYPRWLRAKKAAKYVRKFLSRHMKVEPENVKIDTAVNEKIWERGA 64

Query: 260 EMFPS 274
           E  P+
Sbjct: 65  EKPPT 69


>UniRef50_A0CQV2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=9; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_24,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 372

 Score = 34.7 bits (76), Expect = 0.91
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +1

Query: 226 SLKQIPLV*GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 387
           SL +     G+RN+P            +++D   K +TL  +VPV +  GL+TE
Sbjct: 314 SLNEAVWARGIRNLPRRIRVRLQRKKKEEDDGKGKYYTLAQHVPVDTFDGLKTE 367


>UniRef50_A3DNH4 Cluster: 50S ribosomal protein L31e; n=2;
           Desulfurococcales|Rep: 50S ribosomal protein L31e -
           Staphylothermus marinus (strain ATCC 43588 / DSM 3639 /
           F1)
          Length = 102

 Score = 34.3 bits (75), Expect = 1.2
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +2

Query: 89  VTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD-IRVDTRLNKFLWSKESEM 265
           +TR   V   KR++      RA RA++ IRK+  +     + I +D  +N+++WS+  E 
Sbjct: 7   ITRSIHVIPLKRVYWGRRTNRADRAVRLIRKYVRRHFKEAEKIIIDPAVNEYVWSRSREK 66

Query: 266 FP 271
            P
Sbjct: 67  PP 68


>UniRef50_A0RW54 Cluster: Ribosomal protein L31E; n=2;
           Thermoprotei|Rep: Ribosomal protein L31E - Cenarchaeum
           symbiosum
          Length = 217

 Score = 33.5 bits (73), Expect = 2.1
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +2

Query: 95  REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLW 247
           R YT+ L K L      +RA RAI  I++FA   M   +IR+D  ++  +W
Sbjct: 7   RVYTIPLGKVLLSPD-NRRAMRAINMIKEFATHHMKNANIRIDEEVSHQIW 56


>UniRef50_A2EKX9 Cluster: Ribosomal protein L31e, putative; n=6;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L31e,
           putative - Trichomonas vaginalis G3
          Length = 133

 Score = 33.1 bits (72), Expect = 2.8
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +1

Query: 310 DEDSAHKLFTLVTYVPVASIKGLQTENV 393
           DE+ A K+ T+ +Y  VAS  GLQT+ V
Sbjct: 103 DEEDAEKMVTIASYKNVASFNGLQTQKV 130


>UniRef50_Q820F4 Cluster: Holliday junction ATP-dependent DNA
           helicase ruvA; n=6; Actinomycetales|Rep: Holliday
           junction ATP-dependent DNA helicase ruvA - Streptomyces
           avermitilis
          Length = 203

 Score = 33.1 bits (72), Expect = 2.8
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +2

Query: 23  KLKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR-APRAIKEIRKFAEKQM 199
           +LK  + +P G   G  AI   VT  +   LH  L G+G+  R A  A+  +   AE   
Sbjct: 126 ELKDRLGEPLGT--GGPAIGRAVTTGWREQLHAALIGLGYATREADEAVAAVAPQAEAAG 183

Query: 200 GTPDI 214
           GTP +
Sbjct: 184 GTPQV 188


>UniRef50_Q02B40 Cluster: HAD-superfamily hydrolase, subfamily IA,
           variant 3; n=1; Solibacter usitatus Ellin6076|Rep:
           HAD-superfamily hydrolase, subfamily IA, variant 3 -
           Solibacter usitatus (strain Ellin6076)
          Length = 202

 Score = 32.7 bits (71), Expect = 3.7
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +2

Query: 101 YTV-NLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLWS 250
           YT   + KRL G G  +R    + E R F E+   T D+RVD      +WS
Sbjct: 31  YTAAEIPKRLAGTGLVERFETGLMEPRDFVEEMSRTLDLRVDYDQFSQIWS 81


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 402,175,840
Number of Sequences: 1657284
Number of extensions: 7030521
Number of successful extensions: 14103
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 13844
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14101
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 22761518346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -