SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8MSF5 Cluster: GM16138p; n=12; Arthropoda|Rep: GM16138...   113   4e-24
UniRef50_A3EXS3 Cluster: Putative ribonuclease; n=1; Maconellico...    73   4e-12
UniRef50_A7RHU7 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    69   6e-11
UniRef50_Q28WM7 Cluster: GA10879-PA; n=1; Drosophila pseudoobscu...    64   2e-09
UniRef50_Q20589 Cluster: Putative uncharacterized protein; n=2; ...    64   3e-09
UniRef50_Q9NDV2 Cluster: Ribonuclease precursor; n=1; Ceratitis ...    57   3e-07
UniRef50_Q9W286 Cluster: CG11269-PA; n=1; Drosophila melanogaste...    54   2e-06
UniRef50_O02142 Cluster: Putative uncharacterized protein; n=2; ...    52   8e-06
UniRef50_A2EQF7 Cluster: Putative uncharacterized protein; n=2; ...    37   0.31 
UniRef50_A7CT65 Cluster: Helix-turn-helix-domain containing prot...    35   1.6  
UniRef50_P73896 Cluster: Sll0242 protein; n=1; Synechocystis sp....    33   3.8  
UniRef50_Q65QK6 Cluster: Putative uncharacterized protein; n=3; ...    33   6.6  
UniRef50_Q9WUP4 Cluster: SRD5A2L; n=24; Tetrapoda|Rep: SRD5A2L -...    32   8.7  
UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia nu...    32   8.7  

>UniRef50_Q8MSF5 Cluster: GM16138p; n=12; Arthropoda|Rep: GM16138p -
           Drosophila melanogaster (Fruit fly)
          Length = 95

 Score =  113 bits (271), Expect = 4e-24
 Identities = 48/84 (57%), Positives = 66/84 (78%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KLSLCGL++SVWGI+QL LMG+F+YI +VAL+EDLP +E+   HS+EDF     + Y  N
Sbjct: 7   KLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEY--HSLEDFYAAANRAYNQN 64

Query: 181 AQNCWIAALLYLITLVVSGHQFWL 252
           A NCWIAA +Y++TL++S  QF++
Sbjct: 65  AYNCWIAACIYVLTLLLSAQQFYM 88


>UniRef50_A3EXS3 Cluster: Putative ribonuclease; n=1;
           Maconellicoccus hirsutus|Rep: Putative ribonuclease -
           Maconellicoccus hirsutus (hibiscus mealybug)
          Length = 72

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 37/65 (56%), Positives = 44/65 (67%)
 Frame = +1

Query: 58  MGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLITLVVSG 237
           MG FY + ++AL EDLP  E+ P  S E F      GY  NA NCWIAA LY+ITL+VSG
Sbjct: 1   MGFFYKVHSLALAEDLPGLEE-PFESHEKFYSVANTGYDQNAYNCWIAACLYVITLLVSG 59

Query: 238 HQFWL 252
           HQF+L
Sbjct: 60  HQFYL 64


>UniRef50_A7RHU7 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 88

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 34/84 (40%), Positives = 55/84 (65%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KLS C  +LS+WG+I L L+GVF+  +++AL+ED+P D+              + G++  
Sbjct: 8   KLSNCCFILSLWGVIMLLLLGVFFKTKSIALVEDIPKDKG-------------DAGFSST 54

Query: 181 AQNCWIAALLYLITLVVSGHQFWL 252
           A+NC+IAA +Y +TL++S HQ W+
Sbjct: 55  AKNCFIAAGIYGVTLIISIHQKWV 78


>UniRef50_Q28WM7 Cluster: GA10879-PA; n=1; Drosophila
           pseudoobscura|Rep: GA10879-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 94

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 32/78 (41%), Positives = 48/78 (61%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           K S   L +S W +IQLTLMG+F+ + ++AL++DLP       HS+EDF    +  Y + 
Sbjct: 6   KCSFFCLFISAWAVIQLTLMGIFFLLNSMALIDDLPLTPIF--HSLEDFRTHADVTYQVV 63

Query: 181 AQNCWIAALLYLITLVVS 234
           A  C++ ALLYL   ++S
Sbjct: 64  AIRCFVTALLYLCFGILS 81


>UniRef50_Q20589 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 95

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 34/76 (44%), Positives = 47/76 (61%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           K+S   +V+SVWG+I L L+GVF+YI+AV L  DL F+       +   VI+ +  Y   
Sbjct: 11  KMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHG---KVPSSVIDAK--YNEK 65

Query: 181 AQNCWIAALLYLITLV 228
           A  CWIAA LY +TL+
Sbjct: 66  ATQCWIAAGLYAVTLI 81


>UniRef50_Q9NDV2 Cluster: Ribonuclease precursor; n=1; Ceratitis
           capitata|Rep: Ribonuclease precursor - Ceratitis
           capitata (Mediterranean fruit fly)
          Length = 138

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +1

Query: 28  SVWGIIQLTLM-GVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNA 183
           SVWGIIQL LM G+F+YI +VAL+EDLP DE+   +S+E+F       Y  NA
Sbjct: 73  SVWGIIQLVLMMGLFFYINSVALIEDLPIDEEF--NSVEEFYTAATSAYNQNA 123


>UniRef50_Q9W286 Cluster: CG11269-PA; n=1; Drosophila
           melanogaster|Rep: CG11269-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 107

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/72 (36%), Positives = 42/72 (58%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           K  L  L +S WG + L L+G+F+Y++++ LLE LP     P  S E F  + ++ Y   
Sbjct: 6   KCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFP--SQEAFKEQADEAYQDV 63

Query: 181 AQNCWIAALLYL 216
           +  C++AA+ YL
Sbjct: 64  STRCFVAAVFYL 75


>UniRef50_O02142 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 93

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +1

Query: 19  LVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSI-EDFVIEVEKGYTLNAQNCW 195
           L L++WG + + ++G  +Y ++V L EDLP + K    S+  D      K Y  NA NCW
Sbjct: 11  LFLALWGTVFMAILGGLFYNQSVGLFEDLPKESKAMEKSLWADRTTNFNKLYQQNAYNCW 70

Query: 196 IAALLYL 216
           IA  +Y+
Sbjct: 71  IACGVYI 77


>UniRef50_A2EQF7 Cluster: Putative uncharacterized protein; n=2;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 126

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +1

Query: 13  CGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNC 192
           C +V+SVWGI+ L +M + + I     + DL     NP H+ +D           N +  
Sbjct: 17  CYVVISVWGIVMLGIMAILFGIDKAGTIGDL-----NPHHTRKD-----------NTKTL 60

Query: 193 WIAALLYLITLVVS 234
           WI  ++Y I  ++S
Sbjct: 61  WINVIIYFIVCILS 74


>UniRef50_A7CT65 Cluster: Helix-turn-helix-domain containing protein
           AraC type; n=1; Opitutaceae bacterium TAV2|Rep:
           Helix-turn-helix-domain containing protein AraC type -
           Opitutaceae bacterium TAV2
          Length = 298

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +1

Query: 175 LNAQNCWIAALLYLITL------VVSGHQFWLKIVPQLVCNIEGVVIFAV 306
           LN   CWI A L  +T+      VV G   + KIVPQL+   EGVV + +
Sbjct: 9   LNMLGCWIQAGLSGVTIAVEPGRVVQGAAQFCKIVPQLILGCEGVVSYFI 58


>UniRef50_P73896 Cluster: Sll0242 protein; n=1; Synechocystis sp.
           PCC 6803|Rep: Sll0242 protein - Synechocystis sp.
           (strain PCC 6803)
          Length = 929

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)
 Frame = +1

Query: 148 VIEVEKGYTLNAQNCWIAALLYLITLVVSGHQFWL---KIVPQLVCNIEGVVIFAVNSIP 318
           ++ V  G+ L   N W  ++L L   V++G  FW+    ++ QL+    G  + A+ S P
Sbjct: 126 LVVVNDGFNLTGTNPWFDSVLVLGGEVIAGSLFWIFTGILLSQLIHGTLGQYLKAITSFP 185

Query: 319 L*NCFFFCQK 348
                 FCQ+
Sbjct: 186 A-TVVSFCQQ 194


>UniRef50_Q65QK6 Cluster: Putative uncharacterized protein; n=3;
           Proteobacteria|Rep: Putative uncharacterized protein -
           Mannheimia succiniciproducens (strain MBEL55E)
          Length = 284

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 2/101 (1%)
 Frame = +1

Query: 19  LVLSVW-GIIQLTLMGVFYYIRA-VALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNC 192
           L+L  W G+    ++  F ++    A   DL + + N     E  VIE   GY LN    
Sbjct: 143 LILEFWAGVTACAILAFFAFLMPKYAKTNDLLYLKLNNRLEKEVDVIERNNGYQLNKHYG 202

Query: 193 WIAALLYLITLVVSGHQFWLKIVPQLVCNIEGVVIFAVNSI 315
           W+A L   I+   +    W+ +   L+  +  V I     +
Sbjct: 203 WLAKLRIRISNREAAGYLWIGVAMALLFGVTVVQIATTQGV 243


>UniRef50_Q9WUP4 Cluster: SRD5A2L; n=24; Tetrapoda|Rep: SRD5A2L -
           Mus musculus (Mouse)
          Length = 330

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +1

Query: 40  IIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLI 219
           ++Q     V+Y +  + +L  +P D+KN       +V+    G  L  Q  W   L  ++
Sbjct: 172 VVQYCFGLVYYVLVGLTVLSQVPMDDKNV------YVL----GKNLLIQARWFHILGMVM 221

Query: 220 TLVVSGHQFWLKIV-PQLVCNIEGVVIFAVNSIPL*NCFFFCQKQVAICNYVCN*VVFLS 396
               S HQ+   ++   L  N +GVVI   + IP  + F    + V+  NY+   ++++S
Sbjct: 222 FFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWF----EYVSSANYLAELMIYIS 277

Query: 397 I 399
           +
Sbjct: 278 M 278


>UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia
           nubilalis|Rep: Reverse transcriptase - Ostrinia
           nubilalis (European corn borer)
          Length = 497

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -2

Query: 578 KWADDLWQYAGKNWMRKVEDRAL 510
           +W DDL + AG  WM+  +DR+L
Sbjct: 459 RWTDDLVKVAGSTWMQAAQDRSL 481


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 594,503,780
Number of Sequences: 1657284
Number of extensions: 11406261
Number of successful extensions: 27582
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 26922
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27569
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41073165837
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -