SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2U2J5 Cluster: Predicted protein; n=1; Aspergillus ory...    39   0.099
UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;...    36   0.70 
UniRef50_UPI0000ECB683 Cluster: UPI0000ECB683 related cluster; n...    36   1.2  
UniRef50_Q9Z9B9 Cluster: Putative uncharacterized protein; n=1; ...    35   1.6  
UniRef50_Q92EA7 Cluster: Lin0553 protein; n=8; Listeria|Rep: Lin...    35   1.6  
UniRef50_Q7S6R0 Cluster: Predicted protein; n=1; Neurospora cras...    35   1.6  
UniRef50_A6GE10 Cluster: Serine/threonine protein kinase; n=1; P...    35   2.1  
UniRef50_A0UCD2 Cluster: Putative uncharacterized protein precur...    35   2.1  
UniRef50_Q5JVS0-2 Cluster: Isoform 2 of Q5JVS0 ; n=2; Catarrhini...    34   2.8  
UniRef50_Q4C665 Cluster: Heat shock protein DnaJ, N-terminal:Hea...    34   2.8  
UniRef50_Q5JVS0 Cluster: Intracellular hyaluronan-binding protei...    34   2.8  
UniRef50_UPI00015B53CB Cluster: PREDICTED: hypothetical protein;...    34   3.7  
UniRef50_UPI000150AA0B Cluster: hypothetical protein TTHERM_0069...    34   3.7  
UniRef50_Q6GLG8 Cluster: Hyaluronan binding protein 4; n=2; Xeno...    34   3.7  
UniRef50_Q39MN1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.7  
UniRef50_Q7PUS5 Cluster: ENSANGP00000009724; n=1; Anopheles gamb...    34   3.7  
UniRef50_UPI000023F071 Cluster: hypothetical protein FG07834.1; ...    33   4.9  
UniRef50_Q6PB22 Cluster: MGC68500 protein; n=2; Xenopus laevis|R...    33   4.9  
UniRef50_A5KMX1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.9  
UniRef50_A4SAJ5 Cluster: Predicted protein; n=1; Ostreococcus lu...    33   4.9  
UniRef50_Q8IBY3 Cluster: Putative uncharacterized protein PF07_0...    33   4.9  
UniRef50_Q9I9R0 Cluster: Intracellular hyaluronan-binding protei...    33   6.5  
UniRef50_UPI000150A717 Cluster: Glycoprotease family protein; n=...    33   8.6  
UniRef50_Q0RJS8 Cluster: Putative sensory box/GGDEF domain/EAL d...    33   8.6  
UniRef50_A7ARE7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.6  

>UniRef50_Q2U2J5 Cluster: Predicted protein; n=1; Aspergillus
           oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 321

 Score = 39.1 bits (87), Expect = 0.099
 Identities = 17/47 (36%), Positives = 32/47 (68%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVK 331
           KS +AG+G +K  ++++K   +KP+PKP K +T   +K  K+T+ ++
Sbjct: 83  KSTKAGKGTKKTTKKAKKSSTAKPKPKPRKQLT-EKQKEAKKTRELR 128


>UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG4170-PA - Nasonia vitripennis
          Length = 437

 Score = 36.3 bits (80), Expect = 0.70
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDALKAR 200
           ME +Y + V N+++L LD++ DPL+ LK R
Sbjct: 1   MENTYSITVTNKFSLALDEDEDPLEILKLR 30


>UniRef50_UPI0000ECB683 Cluster: UPI0000ECB683 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECB683 UniRef100 entry -
           Gallus gallus
          Length = 577

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 2/22 (9%)
 Frame = -1

Query: 627 CQKKRGPRG--PSRRLTRWSWW 568
           C+ +RGPRG  P+RR  RW WW
Sbjct: 337 CRGRRGPRGRSPARRRRRWRWW 358


>UniRef50_Q9Z9B9 Cluster: Putative uncharacterized protein; n=1;
           Chlamydophila pneumoniae|Rep: Putative uncharacterized
           protein - Chlamydia pneumoniae (Chlamydophila
           pneumoniae)
          Length = 461

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = +2

Query: 221 KEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHARSIVML 400
           K+ Q+  +R+Q+K EP+  KG  VP+ + +         +S+ E++    ++ A S    
Sbjct: 45  KKPQKGSERKQAKKEPRARKGYLVPSSRTLSARAQKMKNSSRKESSGGCNEISANS-TPR 103

Query: 401 SVRLR 415
           SV+LR
Sbjct: 104 SVKLR 108


>UniRef50_Q92EA7 Cluster: Lin0553 protein; n=8; Listeria|Rep:
           Lin0553 protein - Listeria innocua
          Length = 701

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 17/66 (25%), Positives = 30/66 (45%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRDLHARS 388
           E  +K  ++     + K EP+P K   + T+K   E   +K+  S +  N  + DL    
Sbjct: 44  EAIKKTPEKKEMEPEPKKEPEPPKKEEIETKKPSTEPSKLKANPSSIPENSTIADLFPDP 103

Query: 389 IVMLSV 406
           ++  SV
Sbjct: 104 VMAESV 109


>UniRef50_Q7S6R0 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 336

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTS--KVENNRRVRDLHA 382
           E +++ ++R RKR +S    KPAK    P RK  K+  N K   S  K  +N++     A
Sbjct: 126 EESEEPEERPRKRAKSAANKKPAKKAKSPKRKNKKKAPNKKKKASNKKKASNKKASKKKA 185

Query: 383 R 385
           +
Sbjct: 186 K 186


>UniRef50_A6GE10 Cluster: Serine/threonine protein kinase; n=1;
           Plesiocystis pacifica SIR-1|Rep: Serine/threonine
           protein kinase - Plesiocystis pacifica SIR-1
          Length = 566

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 2/95 (2%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNV-KSXTSKVENNRRV 367
           +S RA       D  + + E+ +P P PA  V +       +  +V  S       N R 
Sbjct: 433 ESLRAASSKVARDDEAARAEEREPAPAPAPAVELALAPESPDVVDVGPSKLRSAHFNARK 492

Query: 368 RDLHARSIVMLSVRLRVVVKIGRRTVPQ-KXGRSS 469
           RDL+ R+      +LR  VK+  R  P  K  R+S
Sbjct: 493 RDLYRRAGRCSDGQLRRTVKVAVRVDPSGKVSRAS 527


>UniRef50_A0UCD2 Cluster: Putative uncharacterized protein precursor;
            n=2; Burkholderia cepacia complex|Rep: Putative
            uncharacterized protein precursor - Burkholderia
            multivorans ATCC 17616
          Length = 1418

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 4/102 (3%)
 Frame = +2

Query: 194  SARAGE--GAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIK-ETQNVKSXTSKVENNRR 364
            ++RAG   G ++  QR+++R      P+ A+ V    R+  +  T +V+         R+
Sbjct: 813  ASRAGREYGFERAIQRAKRRPSHVAIPRMARAVRFAYRQHRRLRTHDVERHIGFDREPRK 872

Query: 365  VRDLHARS-IVMLSVRLRVVVKIGRRTVPQKXGRSSAGHRDA 487
             R    R+ +   + R R   +IG    P +  R++A HRDA
Sbjct: 873  PRGTERRADVAARAQRQRAAGQIGEHLRPVRAARAAADHRDA 914


>UniRef50_Q5JVS0-2 Cluster: Isoform 2 of Q5JVS0 ; n=2;
           Catarrhini|Rep: Isoform 2 of Q5JVS0 - Homo sapiens
           (Human)
          Length = 308

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDALK 194
           M+ S+G  V NR+   LDDE+DP D L+
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILR 43


>UniRef50_Q4C665 Cluster: Heat shock protein DnaJ, N-terminal:Heat
           shock protein DnaJ, N- terminal; n=2; Chroococcales|Rep:
           Heat shock protein DnaJ, N-terminal:Heat shock protein
           DnaJ, N- terminal - Crocosphaera watsonii
          Length = 311

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 3/73 (4%)
 Frame = +2

Query: 218 QKEDQRSRKREQSKPEPKP-AKGVTVPTRKGIKETQNVKSXTSKVEN--NRRVRDLHARS 388
           +K  Q+++ + Q KPEPKP AK  +   ++  KE        S ++N   R  +D+   +
Sbjct: 161 EKVKQKAKPKPQPKPEPKPKAKKSSPSKQEKTKEETRKSDNKSGIKNALKRAEQDMERNN 220

Query: 389 IVMLSVRLRVVVK 427
           +    V LR ++K
Sbjct: 221 LSQAIVELREILK 233


>UniRef50_Q5JVS0 Cluster: Intracellular hyaluronan-binding protein
           4; n=14; Eutheria|Rep: Intracellular hyaluronan-binding
           protein 4 - Homo sapiens (Human)
          Length = 413

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDALK 194
           M+ S+G  V NR+   LDDE+DP D L+
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILR 43


>UniRef50_UPI00015B53CB Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 684

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 5/104 (4%)
 Frame = +2

Query: 242 KREQSKPEPKPAKGVTVPTRKGIKE-TQNVKSXTSKVENNRRVRDLHAR-SIVMLSVR-- 409
           KR+ +K   K    +    R   KE T  V      +   +++R LH R S+V ++    
Sbjct: 577 KRKDNKSLAKEVDEMEEAIRDKEKEITALVHLYNEVMSLKQQMRQLHERNSLVCIASEDP 636

Query: 410 -LRVVVKIGRRTVPQKXGRSSAGHRDASLAIVGLLQRAPQF*RQ 538
             R V +   RT P    +S  GH   +L + GLL++   F RQ
Sbjct: 637 GFRHVTRSRSRTAPSLGSKSHIGHTPNALRLAGLLRQIQAFQRQ 680


>UniRef50_UPI000150AA0B Cluster: hypothetical protein
           TTHERM_00691750; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00691750 - Tetrahymena
           thermophila SB210
          Length = 331

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 19/71 (26%), Positives = 39/71 (54%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
           K+ +  +  QK+ Q  +K   ++ +PK  +  T   +K  ++ +N K+ +SK++N +  +
Sbjct: 180 KANKKQKRQQKQQQEQQKVNMNEQQPKSQQ--TSEDKKDKQKQENQKT-SSKIQNEKETQ 236

Query: 371 DLHARSIVMLS 403
            +H   IV LS
Sbjct: 237 KIHEEKIVNLS 247


>UniRef50_Q6GLG8 Cluster: Hyaluronan binding protein 4; n=2; Xenopus
           tropicalis|Rep: Hyaluronan binding protein 4 - Xenopus
           tropicalis (Western clawed frog) (Silurana tropicalis)
          Length = 339

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDAL 191
           M+ ++G  V NR+   LDDE+DPLD L
Sbjct: 1   MQDNFGCAVENRFNQLLDDESDPLDFL 27


>UniRef50_Q39MN1 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia sp. 383|Rep: Putative uncharacterized
           protein - Burkholderia sp. (strain 383) (Burkholderia
           cepacia (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 310

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 40/139 (28%), Positives = 59/139 (42%), Gaps = 2/139 (1%)
 Frame = +2

Query: 200 RAGE-GAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKV-ENNRRVRD 373
           RAG+ G  +   R R+R Q++  P    G  +    G +E     +   +V + ++ VR 
Sbjct: 72  RAGQHGLYRRVDRPRRR-QNQFHP----GAVLQADHGRRERSRRAAVPQRVGQPDQHVRS 126

Query: 374 LHARSIVMLSVRLRVVVKIGRRTVPQKXGRSSAGHRDASLAIVGLLQRAPQF*RQQPGRC 553
              R   +   RLR VV   +    Q+ GR S GH  A+    G+  R+    R +  R 
Sbjct: 127 DARRRTGLSRARLRGVVPDRQ----QRDGRESPGHTQAA---AGMGARSAAQSRARLVRA 179

Query: 554 RAFAVHQDHRVSLRXGPRG 610
           R    HQ HR   R   RG
Sbjct: 180 RQHRAHQQHRPECRVSGRG 198


>UniRef50_Q7PUS5 Cluster: ENSANGP00000009724; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000009724 - Anopheles gambiae
           str. PEST
          Length = 445

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 2/26 (7%)
 Frame = +3

Query: 120 SYGVGVVNRYALFL--DDETDPLDAL 191
           SYG+ V NRY LF   DDE DP++A+
Sbjct: 5   SYGINVANRYDLFCIDDDEGDPIEAI 30


>UniRef50_UPI000023F071 Cluster: hypothetical protein FG07834.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07834.1 - Gibberella zeae PH-1
          Length = 394

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = +2

Query: 200 RAGEGAQKEDQRSRKREQSKPEPKPAKGV-TVPTRKGIKETQNVKSXTSKVENNR 361
           R G  A + D+R +K+  +KP P+P K      TRK +K      + + K    R
Sbjct: 128 RRGSSATQPDRRRQKQSPAKPGPEPTKSARRASTRKTLKAEPTATAASEKPRRGR 182


>UniRef50_Q6PB22 Cluster: MGC68500 protein; n=2; Xenopus laevis|Rep:
           MGC68500 protein - Xenopus laevis (African clawed frog)
          Length = 404

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDAL 191
           M+ ++G  V NR+   LDDE+DPLD L
Sbjct: 18  MQDNFGCAVGNRFHQLLDDESDPLDFL 44


>UniRef50_A5KMX1 Cluster: Putative uncharacterized protein; n=1;
            Ruminococcus torques ATCC 27756|Rep: Putative
            uncharacterized protein - Ruminococcus torques ATCC 27756
          Length = 1912

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 14/50 (28%), Positives = 26/50 (52%)
 Frame = +2

Query: 203  AGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVE 352
            AG  ++K   ++  +E+ KP+PKP +    PT+    +  +    T K+E
Sbjct: 1744 AGNKSEKASVKATTKEEQKPDPKPEEDKEAPTKPSDLKVTDKTDTTVKIE 1793


>UniRef50_A4SAJ5 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 249

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 2/101 (1%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVP--TRKGIKETQNVKSXTSKVENNRR 364
           +SARAGE  + E + S   E  K +  PA+ V +     + + ET +++    K     +
Sbjct: 73  QSARAGEAKRAEAESSSFLESVKAKLTPAEAVEIRRLAERYVDETDDIEYFAGKT-REEQ 131

Query: 365 VRDLHARSIVMLSVRLRVVVKIGRRTVPQKXGRSSAGHRDA 487
           +++L A     +  R+R ++  GR   P      S    DA
Sbjct: 132 MKELEATQRADVEARVRDLLGDGRGYGPSSVPARSTSADDA 172


>UniRef50_Q8IBY3 Cluster: Putative uncharacterized protein
           PF07_0044; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF07_0044 - Plasmodium
           falciparum (isolate 3D7)
          Length = 201

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 233 RSRKREQSKPEPKPAKGVTVPTRKGIKETQN--VKSXTSKVENNRRVRDL 376
           +S K+++ K E    K      +KGIKE +N   KS   KV+N ++++D+
Sbjct: 28  KSEKKKKKKNENLSIKKKKKEEKKGIKEKKNKKTKSKKKKVKNTKKIKDI 77


>UniRef50_Q9I9R0 Cluster: Intracellular hyaluronan-binding protein
           4; n=2; Gallus gallus|Rep: Intracellular
           hyaluronan-binding protein 4 - Gallus gallus (Chicken)
          Length = 357

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 111 MEXSYGVGVVNRYALFLDDETDPLDALK 194
           ME S+   V NR+   LDDE+DP D L+
Sbjct: 14  MEGSFSCTVANRFYQLLDDESDPFDNLR 41


>UniRef50_UPI000150A717 Cluster: Glycoprotease family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Glycoprotease family
           protein - Tetrahymena thermophila SB210
          Length = 868

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 251 QSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVRD 373
           ++K  P+P KG TVPT + I   Q+ +       NN  +++
Sbjct: 181 RTKKPPQPKKGATVPTNQSINNLQSAQQELQLNYNNNNIKN 221


>UniRef50_Q0RJS8 Cluster: Putative sensory box/GGDEF domain/EAL
           domain protein; n=1; Frankia alni ACN14a|Rep: Putative
           sensory box/GGDEF domain/EAL domain protein - Frankia
           alni (strain ACN14a)
          Length = 715

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +2

Query: 197 ARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR-- 370
           A AGE  ++       R    P P       V T  G++    V+  T + + NR +R  
Sbjct: 188 AEAGEAVEQPLAVRLTRPDGSPAPVLIVSTAVVTDDGVQVVSRVQDITEREQANRYLRLV 247

Query: 371 -DLHARSIVMLSVRLRVVVKIGRRTVPQKXGRSSA 472
            D    S++++    R V  +GR T  +  G ++A
Sbjct: 248 LDHSPVSMLLIDQSGRSVFGLGRHTAEEAAGLAAA 282


>UniRef50_A7ARE7 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 781

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRK--REQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRR 364
           K+  A + A K+ +++ K  ++Q KP+PK  KG    + K  K+ +  K  + K      
Sbjct: 571 KAKNASKKAAKKPKKAAKNSKKQKKPKPKKGKGAKANSGKNAKKAKKDKKKSKKDAKESE 630

Query: 365 VRDL 376
            +D+
Sbjct: 631 KKDM 634


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 554,529,887
Number of Sequences: 1657284
Number of extensions: 9092722
Number of successful extensions: 27270
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 25410
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27133
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -