SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62244 Cluster: 40S ribosomal protein S15a; n=205; Euka...   136   5e-31
UniRef50_UPI0000608089 Cluster: PREDICTED: similar to Rps15a pro...   129   4e-29
UniRef50_UPI0000D9C93A Cluster: PREDICTED: similar to ribosomal ...   116   6e-25
UniRef50_Q9LX88 Cluster: 40S ribosomal protein S15a-4; n=14; Mag...   114   2e-24
UniRef50_A6NIS3 Cluster: Uncharacterized protein ENSP00000348155...   113   4e-24
UniRef50_UPI0001552BC3 Cluster: PREDICTED: similar to Rps15a pro...   112   7e-24
UniRef50_Q01GJ6 Cluster: Ribosomal protein S15; n=1; Ostreococcu...    55   2e-14
UniRef50_O05636 Cluster: 30S ribosomal protein S8P; n=12; Archae...    77   2e-13
UniRef50_Q8U014 Cluster: 30S ribosomal protein S8P; n=24; Archae...    72   9e-12
UniRef50_Q9M0E0 Cluster: 40S ribosomal protein S15a-5; n=5; Magn...    70   4e-11
UniRef50_Q8PV35 Cluster: 30S ribosomal protein S8P; n=14; Euryar...    66   8e-10
UniRef50_O28369 Cluster: 30S ribosomal protein S8P; n=3; Euryarc...    62   1e-08
UniRef50_Q8SQL9 Cluster: 40S RIBOSOMAL PROTEIN S15A; n=1; Enceph...    60   3e-08
UniRef50_A0RVY8 Cluster: 30S ribosomal protein S8P; n=3; Thermop...    52   1e-05
UniRef50_A7D102 Cluster: Ribosomal protein S8; n=1; Halorubrum l...    50   3e-05
UniRef50_Q6L1B2 Cluster: 30S ribosomal protein S8P; n=4; Euryarc...    50   5e-05
UniRef50_Q74NG1 Cluster: 30S ribosomal protein S8P; n=1; Nanoarc...    42   0.008
UniRef50_UPI0000E1E986 Cluster: PREDICTED: hypothetical protein;...    42   0.014
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    37   0.31 
UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ...    34   2.9  
UniRef50_Q2GL45 Cluster: 30S ribosomal protein S8; n=8; Ricketts...    34   2.9  
UniRef50_Q06SG0 Cluster: Chloroplast 30S ribosomal protein S8; n...    33   6.7  
UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;...    32   8.8  
UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...    32   8.8  
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...    32   8.8  
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...    32   8.8  
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...    32   8.8  

>UniRef50_P62244 Cluster: 40S ribosomal protein S15a; n=205;
           Eukaryota|Rep: 40S ribosomal protein S15a - Homo sapiens
           (Human)
          Length = 130

 Score =  136 bits (328), Expect = 5e-31
 Identities = 64/69 (92%), Positives = 68/69 (98%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALKSI+NAEKRGKRQVLIRPCSKVIV+FLTVMM HGYIGEFEI+DDHRAGK
Sbjct: 1   MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + D+E+W  NLLPSRQFG++VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARR 118


>UniRef50_UPI0000608089 Cluster: PREDICTED: similar to Rps15a
           protein; n=5; Amniota|Rep: PREDICTED: similar to Rps15a
           protein - Mus musculus
          Length = 253

 Score =  129 bits (312), Expect = 4e-29
 Identities = 62/69 (89%), Positives = 65/69 (94%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALKSI+NAEKRGKRQVLIRPCSKVIV FLTVMM HGY GEFEI+DDHR GK
Sbjct: 124 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVWFLTVMMKHGYTGEFEIIDDHRDGK 183

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 184 IVVNLTGRL 192



 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVIS RFDV + D+++W  NLLP RQFG++VL T  GI+ HEEARR
Sbjct: 194 KCGVISLRFDVQLKDLDKWQNNLLPLRQFGFIVLTTLAGIIDHEEARR 241


>UniRef50_UPI0000D9C93A Cluster: PREDICTED: similar to ribosomal
           protein S15a; n=1; Macaca mulatta|Rep: PREDICTED:
           similar to ribosomal protein S15a - Macaca mulatta
          Length = 345

 Score =  116 bits (278), Expect = 6e-25
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = -3

Query: 442 SDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNLTG 263
           SDALKSI+NAEKRGKRQVLIR CSKVIV+FL+VMM HGYIGEFEI+DDH AGKIVVNLTG
Sbjct: 174 SDALKSINNAEKRGKRQVLIRLCSKVIVRFLSVMMKHGYIGEFEIIDDHTAGKIVVNLTG 233

Query: 262 RL 257
           RL
Sbjct: 234 RL 235



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVI+ RFDV   D+E+W  NL PS QFG++VL TS GIM HEEAR+
Sbjct: 237 KCGVINTRFDVQPKDLEKWRNNLFPSCQFGFIVLTTSAGIMDHEEARQ 284


>UniRef50_Q9LX88 Cluster: 40S ribosomal protein S15a-4; n=14;
           Magnoliophyta|Rep: 40S ribosomal protein S15a-4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 130

 Score =  114 bits (274), Expect = 2e-24
 Identities = 53/69 (76%), Positives = 61/69 (88%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR++VL+D LKS++NAEKRGKRQV+IRP SKVI+KFL VM  HGYIGEFE VDDHR+GK
Sbjct: 1   MVRISVLNDGLKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVV L GRL
Sbjct: 61  IVVELNGRL 69



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWT-NLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + +IE WT  LLPSRQFG++VL TS GIM HEEARR
Sbjct: 71  KCGVISPRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARR 118


>UniRef50_A6NIS3 Cluster: Uncharacterized protein ENSP00000348155;
           n=33; Eukaryota|Rep: Uncharacterized protein
           ENSP00000348155 - Homo sapiens (Human)
          Length = 129

 Score =  113 bits (271), Expect = 4e-24
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 4/83 (4%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVR NVL+DALK I+NA+KRGKRQVL+RPCS+VI++FLTV M HGYIGEFEI DDHRAGK
Sbjct: 1   MVRTNVLADALKRINNAKKRGKRQVLLRPCSEVIIRFLTV-MKHGYIGEFEITDDHRAGK 59

Query: 283 IVVNLTGRLK--SVVS--FHLVL 227
           +VV LT RL    V+S  FH+ L
Sbjct: 60  MVVYLTDRLNKCGVISPRFHVQL 82



 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRF V + D+E+W  NLLPS QFG+++L TS GI   EEARR
Sbjct: 70  KCGVISPRFHVQLKDLEKWQNNLLPSYQFGFIILTTSAGITDREEARR 117


>UniRef50_UPI0001552BC3 Cluster: PREDICTED: similar to Rps15a
           protein; n=3; Mus musculus|Rep: PREDICTED: similar to
           Rps15a protein - Mus musculus
          Length = 239

 Score =  112 bits (269), Expect = 7e-24
 Identities = 54/71 (76%), Positives = 60/71 (84%)
 Frame = -3

Query: 469 LAMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRA 290
           + MV MNVL DALKS ++AEK GKRQ  IR CSK IV+FLTVMM HGYI EFEI+DDHRA
Sbjct: 97  VTMVEMNVLVDALKSTNSAEKGGKRQFPIRLCSKAIVRFLTVMMKHGYISEFEIIDDHRA 156

Query: 289 GKIVVNLTGRL 257
           GK+VVNLTGRL
Sbjct: 157 GKMVVNLTGRL 167



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDV + D+E+W  NLLP+RQFG++VL T  GIM  EE R+
Sbjct: 169 KCGVISPRFDVQLKDLEKWQNNLLPARQFGFIVLTTLAGIMDREEGRQ 216


>UniRef50_Q01GJ6 Cluster: Ribosomal protein S15; n=1; Ostreococcus
           tauri|Rep: Ribosomal protein S15 - Ostreococcus tauri
          Length = 144

 Score = 54.8 bits (126), Expect(2) = 2e-14
 Identities = 24/46 (52%), Positives = 34/46 (73%)
 Frame = -3

Query: 469 LAMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXH 332
           ++ V +  +    +S++NAEKRGKRQVL+RP SKV++KFL VM  H
Sbjct: 31  VSSVALTSIFHRAESMYNAEKRGKRQVLVRPVSKVVIKFLQVMQKH 76



 Score = 46.4 bits (105), Expect(2) = 2e-14
 Identities = 19/25 (76%), Positives = 21/25 (84%)
 Frame = -3

Query: 331 GYIGEFEIVDDHRAGKIVVNLTGRL 257
           GYI EFE +DDHRAGKIVV L GR+
Sbjct: 107 GYINEFEFIDDHRAGKIVVELNGRI 131


>UniRef50_O05636 Cluster: 30S ribosomal protein S8P; n=12;
           Archaea|Rep: 30S ribosomal protein S8P - Sulfolobus
           acidocaldarius
          Length = 133

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 36/69 (52%), Positives = 48/69 (69%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           M  +N L++AL +++N E R  +Q LI P SK+I+  L VM   GYIGEFE +DD RAGK
Sbjct: 1   MPSINPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYIDDGRAGK 60

Query: 283 IVVNLTGRL 257
           I+V L GR+
Sbjct: 61  IIVQLLGRI 69



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTNL----LPSRQFGYLVLXTSGGIMXHEEARR 114
           KCG ISPR+ +  N + R  +     LPS++ G +++ T  G+M H +  R
Sbjct: 71  KCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIGIIIISTPKGVMSHRDGIR 121


>UniRef50_Q8U014 Cluster: 30S ribosomal protein S8P; n=24;
           Archaea|Rep: 30S ribosomal protein S8P - Pyrococcus
           furiosus
          Length = 130

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 35/69 (50%), Positives = 48/69 (69%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           M  ++ L++AL  I N+E+ GKR+V I+P SK+I + L VM  +GYIGEFE +DD RAG 
Sbjct: 1   MTLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGV 60

Query: 283 IVVNLTGRL 257
             V L GR+
Sbjct: 61  YRVQLLGRI 69



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEA 120
           K G I PRF V +++ E+W    LP+ +FG L++ TS G+M H+EA
Sbjct: 71  KAGAIKPRFPVKVSEFEKWEKRFLPAFEFGILIVSTSQGVMSHKEA 116


>UniRef50_Q9M0E0 Cluster: 40S ribosomal protein S15a-5; n=5;
           Magnoliophyta|Rep: 40S ribosomal protein S15a-5 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 129

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 31/64 (48%), Positives = 45/64 (70%)
 Frame = -3

Query: 448 VLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNL 269
           +L+DAL++I NAE+RGK  V ++P S V+  FL +M   GYI  F++ D HR G+I V+L
Sbjct: 5   ILNDALRTIVNAERRGKASVELKPISTVMSSFLRIMKEKGYIKNFQVYDPHRVGRITVDL 64

Query: 268 TGRL 257
            GR+
Sbjct: 65  QGRV 68



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/45 (46%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEA 120
           C  ++ R DV   +IE++T   LP+RQ+GY+V+ T  GI+ HEEA
Sbjct: 71  CKALTYRQDVRAKEIEKYTERTLPTRQWGYVVITTPDGILDHEEA 115


>UniRef50_Q8PV35 Cluster: 30S ribosomal protein S8P; n=14;
           Euryarchaeota|Rep: 30S ribosomal protein S8P -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 130

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 33/69 (47%), Positives = 44/69 (63%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MV ++ L++AL +I NAE  GK   ++RP SK I   L VM   GYIG+FE +DD +AG 
Sbjct: 1   MVLLDPLANALSTIKNAEAIGKSSCIVRPASKNIGNVLKVMQDLGYIGDFEFIDDGKAGI 60

Query: 283 IVVNLTGRL 257
             V L GR+
Sbjct: 61  YSVTLVGRI 69



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/47 (48%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEAR 117
           KCG I PR+ V     ERW    LP++ FG L+L TS G+M   EAR
Sbjct: 71  KCGAIKPRYSVGTGSFERWEKQFLPAKNFGALILTTSSGVMSQYEAR 117


>UniRef50_O28369 Cluster: 30S ribosomal protein S8P; n=3;
           Euryarchaeota|Rep: 30S ribosomal protein S8P -
           Archaeoglobus fulgidus
          Length = 129

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/66 (43%), Positives = 45/66 (68%)
 Frame = -3

Query: 454 MNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVV 275
           ++ LS+A+ +I NAE  G+++  I+P SK+I   L VM  +GYI  FE V++HR GK +V
Sbjct: 3   VDTLSNAMIAIKNAEMVGEKKCEIKPASKLIGNVLKVMKDYGYIKGFEYVENHRGGKFIV 62

Query: 274 NLTGRL 257
            L+G +
Sbjct: 63  ELSGNI 68



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           CG I PRF   + + E +    LP+R FG L++ T+ G+M  ++AR+
Sbjct: 71  CGAIRPRFSSSVTEYEMYEKRYLPARDFGILIVSTTKGVMSQKDARK 117


>UniRef50_Q8SQL9 Cluster: 40S RIBOSOMAL PROTEIN S15A; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S15A
           - Encephalitozoon cuniculi
          Length = 128

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/63 (42%), Positives = 43/63 (68%)
 Frame = -3

Query: 445 LSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIVVNLT 266
           L++  K+I+NA + GKRQ+L+R  ++ +  FL  M+ HGYI  F  + D R+GK +++L 
Sbjct: 5   LANMCKAINNASRAGKRQLLLRFSTEEMRMFLLQMLRHGYISGFSYIHDKRSGKSIIDLN 64

Query: 265 GRL 257
           GRL
Sbjct: 65  GRL 67



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEE 123
           +CG ISP + V  + IE + T LLP+RQFG+++  TS GI+ H+E
Sbjct: 69  RCGAISPNYIVKRDGIEDFRTRLLPARQFGHVLFNTSKGILDHKE 113


>UniRef50_A0RVY8 Cluster: 30S ribosomal protein S8P; n=3;
           Thermoprotei|Rep: 30S ribosomal protein S8P -
           Cenarchaeum symbiosum
          Length = 130

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/69 (36%), Positives = 40/69 (57%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           M   N+L++   +++N E R +    + P SK+ V+ L  +   GYIGEFE V+D R GK
Sbjct: 1   MPATNILANLFVTLYNTEARRRGDCQVYPTSKLGVEVLGTLKKAGYIGEFEHVEDSRGGK 60

Query: 283 IVVNLTGRL 257
             V+L  ++
Sbjct: 61  FSVHLLAKI 69



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEA 120
           KCG ISPRF V   +   W    LPS   G LV+ T+ G+M H EA
Sbjct: 71  KCGAISPRFKVKKGEYTFWEQQYLPSYDRGMLVVTTNQGVMSHHEA 116


>UniRef50_A7D102 Cluster: Ribosomal protein S8; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Ribosomal protein S8 -
           Halorubrum lacusprofundi ATCC 49239
          Length = 147

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 26/71 (36%), Positives = 36/71 (50%)
 Frame = -3

Query: 469 LAMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRA 290
           L M   +  ++AL  + NAE  G     + P S +I   L V+   GY+  FE VDD +A
Sbjct: 16  LIMTGNDPFTNALAGMDNAESVGHLSYTVEPASNIIGSVLEVLYDRGYVDGFEYVDDGKA 75

Query: 289 GKIVVNLTGRL 257
           GK  V L G +
Sbjct: 76  GKFEVELKGAI 86



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEAR 117
           +CG + PR+    ++ E+W    LP+R +G L++ TS G+M H EAR
Sbjct: 88  ECGAVKPRYSAGADEFEKWEKRYLPARDYGTLIVTTSHGVMSHYEAR 134


>UniRef50_Q6L1B2 Cluster: 30S ribosomal protein S8P; n=4;
           Euryarchaeota|Rep: 30S ribosomal protein S8P -
           Picrophilus torridus
          Length = 129

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query: 251 CGVISPRFDVPINDIERW-TNLLPSRQFGYLVLXTSGGIMXHEEARR 114
           CGVI PR  V  ++IER+ +  LP++ FG ++L T+ GIM H EAR+
Sbjct: 71  CGVIKPRLSVKNSNIERYESRYLPAQDFGIIILTTTKGIMSHIEARK 117


>UniRef50_Q74NG1 Cluster: 30S ribosomal protein S8P; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S8P -
           Nanoarchaeum equitans
          Length = 129

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = -3

Query: 451 NVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGKIV 278
           ++++D L  + N  ++G+ +    P S +I+K + +M   GYI  + +VD  R GKI+
Sbjct: 4   DIVADFLSHLTNVRRKGEDKTAFFPVSNLIIKLVEIMKREGYIKNYRLVDSSR-GKII 60



 Score = 37.1 bits (82), Expect = 0.31
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEAR 117
           +   I PRF V  +++E++    LP+  FG L+L TS G++ + EA+
Sbjct: 70  EANAIKPRFPVEYSELEKYEKRYLPALNFGRLILSTSKGLITNREAK 116


>UniRef50_UPI0000E1E986 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 116

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 17/28 (60%), Positives = 23/28 (82%)
 Frame = -3

Query: 325 IGEFEIVDDHRAGKIVVNLTGRLKSVVS 242
           IG+FE++DDHRAGKIV NL+ ++  V S
Sbjct: 9   IGKFEVIDDHRAGKIVENLSDKVTQVCS 36


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 37.1 bits (82), Expect = 0.31
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 553 HWPSFYNVVTGKTL 594
           HWPSFYNVVTGKTL
Sbjct: 5   HWPSFYNVVTGKTL 18


>UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 275

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = +1

Query: 472 FSSRFVANRIXRGARYPIRPIVSRIT 549
           F+  +   R   GARYPIRPIVSRIT
Sbjct: 250 FNQAYRYRRPRGGARYPIRPIVSRIT 275


>UniRef50_Q2GL45 Cluster: 30S ribosomal protein S8; n=8;
           Rickettsiales|Rep: 30S ribosomal protein S8 - Anaplasma
           phagocytophilum (strain HZ)
          Length = 133

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = -3

Query: 445 LSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEF 314
           ++D L  + N +  G  +V+  PCSKV++  L +++  GYI  F
Sbjct: 7   IADFLTRLRNGQA-GMNKVVYVPCSKVVMAVLRILVEEGYIESF 49


>UniRef50_Q06SG0 Cluster: Chloroplast 30S ribosomal protein S8; n=1;
           Stigeoclonium helveticum|Rep: Chloroplast 30S ribosomal
           protein S8 - Stigeoclonium helveticum (Green alga)
          Length = 176

 Score = 32.7 bits (71), Expect = 6.7
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = -3

Query: 451 NVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEI 308
           + +SD L  I NA    K+ VLI P +K+ +K   ++   GYI  FEI
Sbjct: 4   DTISDMLTRIRNASIVRKKSVLI-PYTKMNLKIAEILEKEGYILSFEI 50


>UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 195

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 179 LAVVLQRRDWENP 191


>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 68  LAVVLQRRDWENP 80


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 22  LAVVLQRRDWENP 34


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 26  LAVVLQRRDWENP 38


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +3

Query: 555 LAVVLQRRDWENP 593
           LAVVLQRRDWENP
Sbjct: 8   LAVVLQRRDWENP 20


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 468,800,768
Number of Sequences: 1657284
Number of extensions: 8118100
Number of successful extensions: 14736
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 14485
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14721
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41488046300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -