SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1HQ32 Cluster: Carboxypeptidase inhibitor; n=1; Bombyx...   175   3e-43
UniRef50_Q16UL4 Cluster: Putative uncharacterized protein; n=2; ...    52   8e-06
UniRef50_A0NBL1 Cluster: ENSANGP00000031597; n=1; Anopheles gamb...    45   9e-04
UniRef50_Q9W2F6 Cluster: CG10433-PA, isoform A; n=3; Sophophora|...    42   0.006
UniRef50_UPI00015B6284 Cluster: PREDICTED: similar to conserved ...    35   0.71 
UniRef50_A0NE78 Cluster: ENSANGP00000031025; n=2; Culicidae|Rep:...    35   0.71 
UniRef50_Q7S8P7 Cluster: Putative uncharacterized protein NCU086...    34   1.6  
UniRef50_Q1DAE2 Cluster: Putative lipoprotein; n=1; Myxococcus x...    33   2.2  
UniRef50_A7SUC9 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    33   2.9  
UniRef50_UPI00015B629C Cluster: PREDICTED: similar to ENSANGP000...    33   3.8  
UniRef50_A2EB56 Cluster: Type III restriction enzyme, res subuni...    32   5.0  
UniRef50_A2EZT8 Cluster: Putative uncharacterized protein; n=1; ...    32   6.6  
UniRef50_UPI00006A196F Cluster: UPI00006A196F related cluster; n...    31   8.7  
UniRef50_Q7UXS4 Cluster: Putative uncharacterized protein tadB; ...    31   8.7  
UniRef50_A1GA48 Cluster: Band 7 protein precursor; n=1; Salinisp...    31   8.7  
UniRef50_Q14CX7 Cluster: TPR repeat-containing protein C12orf30;...    31   8.7  

>UniRef50_Q1HQ32 Cluster: Carboxypeptidase inhibitor; n=1; Bombyx
           mori|Rep: Carboxypeptidase inhibitor - Bombyx mori (Silk
           moth)
          Length = 113

 Score =  175 bits (427), Expect = 3e-43
 Identities = 77/77 (100%), Positives = 77/77 (100%)
 Frame = +3

Query: 24  MKFLLFCAMCILVYGNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQ 203
           MKFLLFCAMCILVYGNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQ
Sbjct: 1   MKFLLFCAMCILVYGNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQ 60

Query: 204 QKDGIECCYGVSVKETR 254
           QKDGIECCYGVSVKETR
Sbjct: 61  QKDGIECCYGVSVKETR 77



 Score = 84.2 bits (199), Expect = 1e-15
 Identities = 35/40 (87%), Positives = 36/40 (90%)
 Frame = +2

Query: 242 KRDQSRKHGGECFSKGYCSQSLIYEEASDCPEGXDCCILV 361
           K  + RKHGGECFSKGYCSQSLIYEEASDCPEG DCCILV
Sbjct: 74  KETRCRKHGGECFSKGYCSQSLIYEEASDCPEGNDCCILV 113


>UniRef50_Q16UL4 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 130

 Score = 51.6 bits (118), Expect = 8e-06
 Identities = 25/67 (37%), Positives = 37/67 (55%)
 Frame = +3

Query: 93  IDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVKETRVGSTAE 272
           ++  + E  C R+GGLC    DC S + A  GLCP+    G+ECCY V ++   V + AE
Sbjct: 41  VNVYKTERACARQGGLCVQRNDCKS-LTAIKGLCPENANRGVECCYEV-IQSEAVHTCAE 98

Query: 273 NVSRKAT 293
           ++    T
Sbjct: 99  HLGECMT 105



 Score = 32.3 bits (70), Expect = 5.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 260 KHGGECFSKGYCSQSLIYEEASDCPEGXDCCILV 361
           +H GEC +  +C    +   A+DC E   CC+LV
Sbjct: 98  EHLGECMT--HCRSQALTRRATDCGEEETCCVLV 129


>UniRef50_A0NBL1 Cluster: ENSANGP00000031597; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031597 - Anopheles gambiae
           str. PEST
          Length = 136

 Score = 44.8 bits (101), Expect = 9e-04
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +3

Query: 75  EDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGV 236
           E+ +  +   + E PC   GG+C    +C     A +GLCP+    G++CCY V
Sbjct: 43  EESYLGVKLYKMERPCAMLGGMCVQTSECKQR-PANSGLCPENTHLGVDCCYEV 95


>UniRef50_Q9W2F6 Cluster: CG10433-PA, isoform A; n=3;
           Sophophora|Rep: CG10433-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 127

 Score = 41.9 bits (94), Expect = 0.006
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +3

Query: 120 CRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVK 245
           C   GGLC    DC  +  +  GLCP    +G+ECCY + V+
Sbjct: 51  CVMVGGLCVAESDC-IEPTSNKGLCPTSAGEGVECCYELPVR 91


>UniRef50_UPI00015B6284 Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 195

 Score = 35.1 bits (77), Expect = 0.71
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +2

Query: 233 SVRKRDQSRKHG---GECFSKGYCSQSLIYEEASDCPEGXDCCILV 361
           SV + D   + G   GEC     C+Q +   +A DC EG  CC+LV
Sbjct: 151 SVVREDAKHRCGHFLGECMKS--CTQEIQVLQADDCEEGTTCCVLV 194


>UniRef50_A0NE78 Cluster: ENSANGP00000031025; n=2; Culicidae|Rep:
           ENSANGP00000031025 - Anopheles gambiae str. PEST
          Length = 132

 Score = 35.1 bits (77), Expect = 0.71
 Identities = 18/57 (31%), Positives = 26/57 (45%)
 Frame = +3

Query: 15  HVIMKFLLFCAMCILVYGNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRART 185
           H    F L CA+ ++         C++D  +Q   CR + G CT A  C S+ R  T
Sbjct: 5   HSPCSFTLLCAIALVAVLIRSTQSCDLDQTQQG--CRIDNGQCTCAFGCKSEFRYAT 59


>UniRef50_Q7S8P7 Cluster: Putative uncharacterized protein
           NCU08656.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU08656.1 - Neurospora crassa
          Length = 454

 Score = 33.9 bits (74), Expect = 1.6
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = -1

Query: 220 SIPSFCCLGQSPVLALISDGQSSATVHK--PPSLRHGSSCSMESISQKSSSLFP 65
           S P    +G +  L ++S+G SS T     P S    SS S  S S  SSSLFP
Sbjct: 231 SDPWVTSVGGTQFLPVVSNGSSSTTASSGMPSSSSSSSSSSSSSSSSSSSSLFP 284


>UniRef50_Q1DAE2 Cluster: Putative lipoprotein; n=1; Myxococcus
           xanthus DK 1622|Rep: Putative lipoprotein - Myxococcus
           xanthus (strain DK 1622)
          Length = 305

 Score = 33.5 bits (73), Expect = 2.2
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 12  EHVIMKFLLFCAMCILVYGNSEDDFCEIDSIEQEDPCRREGGLCTVAEDCPSDIRARTGL 191
           +HV+M   LF A+ ++  G+++DD  E       +P  +  GLC+ ++ CPS      GL
Sbjct: 63  KHVVMG--LFLALTVMGCGSTKDDDGEGPD---GNPNEQSAGLCSASKACPSGQFCFNGL 117

Query: 192 C 194
           C
Sbjct: 118 C 118


>UniRef50_A7SUC9 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 165

 Score = 33.1 bits (72), Expect = 2.9
 Identities = 15/36 (41%), Positives = 17/36 (47%)
 Frame = -2

Query: 150 PQYTNHLPCGTDPLVQWNLFHRNHLHCFRKLKCTLH 43
           P  T HL C   P    +L   +HL C R L CT H
Sbjct: 40  PSSTGHLSCTDHPSSTGHLSCTDHLSCTRHLSCTRH 75


>UniRef50_UPI00015B629C Cluster: PREDICTED: similar to
           ENSANGP00000031597; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000031597 - Nasonia
           vitripennis
          Length = 203

 Score = 32.7 bits (71), Expect = 3.8
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = +2

Query: 236 VRKRDQSR-KHG-GECFSKGYCSQSLIYEEASDCPEGXDCCILV 361
           +R+ D+ R +H  GEC    YC++ ++   A DC  G  CC+L+
Sbjct: 159 IRESDKHRCRHFLGECME--YCNEEIV-ARADDCENGEKCCVLL 199


>UniRef50_A2EB56 Cluster: Type III restriction enzyme, res subunit
           family protein; n=1; Trichomonas vaginalis G3|Rep: Type
           III restriction enzyme, res subunit family protein -
           Trichomonas vaginalis G3
          Length = 1042

 Score = 32.3 bits (70), Expect = 5.0
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +1

Query: 169 ISEPELDSVLSSKKTESNAVTECP*KRPESEARRRMFLERLLQSI 303
           +SEPE+  +L+ KK     V + P KR     ++R FL++L   I
Sbjct: 6   VSEPEIQDLLNPKKGVEITVKKKPRKRSRMTKKKREFLKKLATKI 50


>UniRef50_A2EZT8 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 678

 Score = 31.9 bits (69), Expect = 6.6
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASDSGLFYGHSVTAFDSV 210
           +L+   ++ C S+ +N+L+  SDS +FY     AF S+
Sbjct: 276 QLVEDKELQCDSIPQNLLQNTSDSSIFYDKDRNAFLSL 313


>UniRef50_UPI00006A196F Cluster: UPI00006A196F related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A196F UniRef100 entry -
           Xenopus tropicalis
          Length = 208

 Score = 31.5 bits (68), Expect = 8.7
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 4/55 (7%)
 Frame = +3

Query: 45  AMCILVYGNSEDDFCEIDSIEQEDPCRREG----GLCTVAEDCPSDIRARTGLCP 197
           AM   + G    D C +  I   D CR +G     LC +   CP D+    G+CP
Sbjct: 1   AMTCHLKGICPPDLCRLKGICPPDLCRLKGICPPDLCRLKGICPPDLCRLKGICP 55


>UniRef50_Q7UXS4 Cluster: Putative uncharacterized protein tadB;
           n=1; Pirellula sp.|Rep: Putative uncharacterized protein
           tadB - Rhodopirellula baltica
          Length = 314

 Score = 31.5 bits (68), Expect = 8.7
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +3

Query: 147 VAEDCPSDIRARTGLCPKQQKDGI 218
           +AEDCPS IR    LC +QQ+ G+
Sbjct: 170 IAEDCPSPIREEFALCYEQQELGM 193


>UniRef50_A1GA48 Cluster: Band 7 protein precursor; n=1; Salinispora
           arenicola CNS205|Rep: Band 7 protein precursor -
           Salinispora arenicola CNS205
          Length = 459

 Score = 31.5 bits (68), Expect = 8.7
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASDSGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVLSHS 144
           K+  IS    SSL++++    +  GL  G  +T  D   LL R  +S+GS+   T    S
Sbjct: 397 KMTVISTDGASSLTKSVAGNVAQ-GLQLGSDLTGIDLAGLLTRLAASTGSEPHGTPAVDS 455

Query: 143 TQT 135
           T+T
Sbjct: 456 TET 458


>UniRef50_Q14CX7 Cluster: TPR repeat-containing protein C12orf30;
           n=35; Euteleostomi|Rep: TPR repeat-containing protein
           C12orf30 - Homo sapiens (Human)
          Length = 972

 Score = 31.5 bits (68), Expect = 8.7
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = -3

Query: 299 DCSSLSRNILRRASDSGLFYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD   FY   +T FDSVF L+
Sbjct: 247 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 277


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,995,920
Number of Sequences: 1657284
Number of extensions: 7339181
Number of successful extensions: 21976
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 21207
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21959
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23511729640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -