SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...   221   1e-56
UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...   217   3e-55
UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224; cell...   181   2e-44
UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;...   178   1e-43
UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1 alph...   163   4e-39
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...   146   5e-34
UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n...   145   1e-33
UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5; Fungi/M...   137   3e-31
UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation...   132   6e-30
UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-lik...   132   6e-30
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...   129   6e-29
UniRef50_P15170 Cluster: G1 to S phase transition protein 1 homo...   128   1e-28
UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20; Archae...   127   3e-28
UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|R...   126   4e-28
UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   125   1e-27
UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2; Chilodo...   124   2e-27
UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1, sub...   122   9e-27
UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3; Di...   122   9e-27
UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal ...   121   2e-26
UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3; ...   120   5e-26
UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococ...   118   1e-25
UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2; ...   118   1e-25
UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alph...   118   1e-25
UniRef50_A2AX44 Cluster: Translation elongation factor 1 like; n...   116   4e-25
UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;...   115   1e-24
UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase subu...   115   1e-24
UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneur...   114   2e-24
UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1; ...   114   2e-24
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...   113   4e-24
UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;...   113   6e-24
UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor...   113   6e-24
UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor...   112   7e-24
UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9; Magnoliophyta...   112   1e-23
UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor...   111   2e-23
UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|R...   111   2e-23
UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n...   110   3e-23
UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces cere...   109   9e-23
UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase subu...   108   2e-22
UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...   108   2e-22
UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1; ...   107   2e-22
UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1; ...   107   2e-22
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...   107   2e-22
UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory pr...   107   3e-22
UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6; Eukaryota...   107   3e-22
UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p - ...   107   3e-22
UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep: A...   107   3e-22
UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;...   106   6e-22
UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor...   106   6e-22
UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O2...   105   8e-22
UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase subu...   105   8e-22
UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative; ...   105   1e-21
UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1; ...   105   1e-21
UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2; ...   105   1e-21
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...   105   1e-21
UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase subu...   103   6e-21
UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1; ...   103   6e-21
UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2; Dicty...   101   1e-20
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...   101   2e-20
UniRef50_O74774 Cluster: Elongation factor 1 alpha related prote...   100   3e-20
UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),...    99   1e-19
UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain ...    97   4e-19
UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha; ...    95   1e-18
UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha; ...    95   2e-18
UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;...    92   1e-17
UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, wh...    91   2e-17
UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA; ...    88   2e-16
UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain ...    88   2e-16
UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Re...    87   3e-16
UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3; Endopte...    86   1e-15
UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3; Le...    85   2e-15
UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n...    84   3e-15
UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n...    83   5e-15
UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal ...    83   7e-15
UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha; ...    83   9e-15
UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate adenylyl...    82   1e-14
UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus mobilis|...    82   1e-14
UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia intestin...    82   2e-14
UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1; Geoba...    81   3e-14
UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA; ...    79   8e-14
UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1; ...    79   1e-13
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    79   1e-13
UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain ...    78   2e-13
UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep...    78   2e-13
UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12; Rhizobi...    77   3e-13
UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113, w...    77   3e-13
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...    76   1e-12
UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain...    75   1e-12
UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;...    75   2e-12
UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella n...    75   2e-12
UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large subu...    75   2e-12
UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1; Tetrahy...    75   2e-12
UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large subu...    74   3e-12
UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfat...    74   3e-12
UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransfera...    74   3e-12
UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1; ...    74   4e-12
UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1; E...    73   5e-12
UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE S...    73   5e-12
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    73   5e-12
UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase s...    73   7e-12
UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5; Tr...    72   1e-11
UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1; ...    72   1e-11
UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia sp...    72   2e-11
UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large subu...    72   2e-11
UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large subu...    72   2e-11
UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2; Cryptosporidium...    71   4e-11
UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1; ...    70   5e-11
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    70   7e-11
UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes...    70   7e-11
UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium t...    69   9e-11
UniRef50_P18905 Cluster: Elongation factor Tu; n=2; Coleochaetal...    69   9e-11
UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Re...    69   1e-10
UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella ...    69   2e-10
UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase la...    68   2e-10
UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large subu...    68   3e-10
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    68   3e-10
UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes...    68   3e-10
UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1; ...    67   4e-10
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    67   5e-10
UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondr...    66   6e-10
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    66   6e-10
UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate adeny...    66   8e-10
UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes...    66   1e-09
UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2; Cys...    65   1e-09
UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1; ...    65   1e-09
UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1; ...    65   1e-09
UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /...    65   2e-09
UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes lud...    65   2e-09
UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subu...    64   3e-09
UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large subu...    63   8e-09
UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferas...    62   1e-08
UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacop...    62   1e-08
UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large subu...    62   2e-08
UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit Cys...    61   2e-08
UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation elo...    60   4e-08
UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14; Ac...    60   5e-08
UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n...    60   5e-08
UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase s...    60   7e-08
UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular or...    59   1e-07
UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n...    58   2e-07
UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole gen...    58   2e-07
UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha, ...    58   3e-07
UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation elo...    57   4e-07
UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large subu...    57   5e-07
UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole geno...    56   9e-07
UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|R...    55   2e-06
UniRef50_A6CK31 Cluster: Selenocysteine-specific translation elo...    55   2e-06
UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain...    54   3e-06
UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n...    54   5e-06
UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation elo...    54   5e-06
UniRef50_A3SGF9 Cluster: Translation elongation factor, selenocy...    54   5e-06
UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation elo...    53   6e-06
UniRef50_A1FN34 Cluster: Selenocysteine-specific translation elo...    53   6e-06
UniRef50_Q46497 Cluster: Selenocysteine-specific elongation fact...    53   6e-06
UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation elo...    53   8e-06
UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation elo...    52   1e-05
UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:...    52   1e-05
UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation fact...    52   1e-05
UniRef50_Q3E0L1 Cluster: Translation elongation factor, selenocy...    52   2e-05
UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1; Plasm...    52   2e-05
UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein transla...    51   3e-05
UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation fact...    51   3e-05
UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation elo...    51   3e-05
UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation elo...    51   3e-05
UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific tr...    50   4e-05
UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfat...    50   4e-05
UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation fact...    50   6e-05
UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole gen...    50   6e-05
UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit...    49   1e-04
UniRef50_A6G2B2 Cluster: Translation elongation factor, selenocy...    48   2e-04
UniRef50_A0KL71 Cluster: Selenocysteine-specific translation elo...    48   2e-04
UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative; ...    48   2e-04
UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation fact...    48   2e-04
UniRef50_Q47F25 Cluster: Translation elongation factor, selenocy...    48   2e-04
UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131, w...    48   2e-04
UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase; ...    48   2e-04
UniRef50_A0YGX4 Cluster: Translation elongation factor, selenocy...    48   3e-04
UniRef50_Q46455 Cluster: Selenocysteine-specific elongation fact...    48   3e-04
UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation elo...    47   5e-04
UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding; ...    47   5e-04
UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whol...    46   7e-04
UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation...    46   7e-04
UniRef50_Q1NKM4 Cluster: Translation elongation factor, selenocy...    46   7e-04
UniRef50_Q1ETS8 Cluster: Translation elongation factor, selenocy...    46   7e-04
UniRef50_O36041 Cluster: Eukaryotic translation initiation facto...    46   7e-04
UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromo...    46   0.001
UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole geno...    46   0.001
UniRef50_Q30SC0 Cluster: Translation elongation factor, selenocy...    46   0.001
UniRef50_Q57918 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_P43927 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5...    46   0.001
UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation elo...    45   0.002
UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep: CG1...    45   0.002
UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1...    45   0.002
UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111, w...    45   0.002
UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex ae...    44   0.003
UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation elo...    44   0.004
UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Re...    44   0.004
UniRef50_P14081 Cluster: Selenocysteine-specific elongation fact...    44   0.004
UniRef50_A3Q882 Cluster: Selenocysteine-specific translation elo...    44   0.005
UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1...    43   0.007
UniRef50_Q7Q5R3 Cluster: ENSANGP00000020583; n=3; Diptera|Rep: E...    43   0.007
UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=1...    43   0.007
UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation fact...    43   0.009
UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation elo...    43   0.009
UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b ga...    43   0.009
UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation fact...    43   0.009
UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibbere...    43   0.009
UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=2...    43   0.009
UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3; Coeloma...    42   0.012
UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5...    42   0.012
UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila melanogaster...    42   0.012
UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gam...    42   0.012
UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding...    42   0.015
UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospir...    42   0.015
UniRef50_A6DB59 Cluster: Putative selenocysteine-specific elonga...    42   0.020
UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=1...    42   0.020
UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translati...    41   0.027
UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation elo...    41   0.027
UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole gen...    41   0.027
UniRef50_P72689 Cluster: Translation initiation factor IF-2; n=8...    41   0.027
UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation...    41   0.036
UniRef50_A6DKQ3 Cluster: Translation initiation factor IF-2; n=1...    41   0.036
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    41   0.036
UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=1...    41   0.036
UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2...    41   0.036
UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3...    41   0.036
UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation facto...    40   0.047
UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2; ...    40   0.047
UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1; ...    40   0.062
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    40   0.062
UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3...    40   0.062
UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation elo...    40   0.082
UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyc...    40   0.082
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    40   0.082
UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4...    40   0.082
UniRef50_P46199 Cluster: Translation initiation factor IF-2, mit...    40   0.082
UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific tr...    39   0.11 
UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1...    39   0.11 
UniRef50_A7I3V0 Cluster: Translation initiation factor IF-2; n=1...    39   0.11 
UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2; O...    39   0.11 
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    39   0.11 
UniRef50_UPI0000E87FA9 Cluster: translation initiation factor IF...    39   0.14 
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    39   0.14 
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    39   0.14 
UniRef50_A6BAW2 Cluster: BipA protein; n=1; Vibrio parahaemolyti...    39   0.14 
UniRef50_A5ZAJ3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation fa...    39   0.14 
UniRef50_Q9PGR3 Cluster: Translation initiation factor IF-2; n=2...    39   0.14 
UniRef50_P47388 Cluster: Translation initiation factor IF-2; n=6...    39   0.14 
UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8...    39   0.14 
UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=1...    39   0.14 
UniRef50_Q3ZXU3 Cluster: Translation initiation factor IF-2; n=8...    39   0.14 
UniRef50_Q5KNR0 Cluster: GTPase, putative; n=1; Filobasidiella n...    38   0.19 
UniRef50_Q74IS8 Cluster: Translation initiation factor IF-2; n=3...    38   0.19 
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    38   0.19 
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    38   0.25 
UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3...    38   0.25 
UniRef50_Q62AN3 Cluster: Selenocysteine-specific translation elo...    38   0.25 
UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiat...    38   0.25 
UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2; Ba...    38   0.25 
UniRef50_A7PNB2 Cluster: Chromosome chr1 scaffold_22, whole geno...    38   0.25 
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    38   0.25 
UniRef50_Q8R5Z1 Cluster: Translation initiation factor IF-2; n=3...    38   0.25 
UniRef50_Q6MMS6 Cluster: Translation initiation factor IF-2; n=1...    38   0.25 
UniRef50_Q8YQJ1 Cluster: Translation initiation factor IF-2; n=7...    38   0.25 
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    38   0.33 
UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1...    38   0.33 
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_A7R247 Cluster: Chromosome undetermined scaffold_399, w...    38   0.33 
UniRef50_A7QHK9 Cluster: Chromosome chr5 scaffold_98, whole geno...    38   0.33 
UniRef50_Q4QHR7 Cluster: Eukaryotic translation initiation facto...    38   0.33 
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    38   0.33 
UniRef50_Q8D2X6 Cluster: Translation initiation factor IF-2; n=1...    38   0.33 
UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific...    37   0.44 
UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3...    37   0.44 
UniRef50_A6NTY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.44 
UniRef50_A6G6E0 Cluster: Protein translation elongation factor G...    37   0.44 
UniRef50_A5NXM0 Cluster: Selenocysteine-specific translation elo...    37   0.44 
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.44 
UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14; Bacter...    37   0.44 
UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole gen...    37   0.44 
UniRef50_Q86H50 Cluster: Similar to mitochondrial initiation fac...    37   0.44 
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    37   0.44 
UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.44 
UniRef50_A5HWL3 Cluster: Elongation factor 1-alpha; n=6; Gloeopo...    37   0.44 
UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog; ...    37   0.44 
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    37   0.44 
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    37   0.44 
UniRef50_P55875 Cluster: Translation initiation factor IF-2; n=7...    37   0.44 
UniRef50_Q09130 Cluster: Eukaryotic translation initiation facto...    37   0.44 
UniRef50_Q9XEK9 Cluster: Translation initiation factor IF-2, chl...    37   0.44 
UniRef50_A7BBE2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.58 
UniRef50_A6PMK2 Cluster: Translation initiation factor IF-2; n=1...    37   0.58 
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.58 
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    37   0.58 
UniRef50_Q6FMS9 Cluster: Candida glabrata strain CBS138 chromoso...    37   0.58 
UniRef50_Q5FQM3 Cluster: Translation initiation factor IF-2; n=8...    37   0.58 
UniRef50_Q6AJY4 Cluster: Translation initiation factor IF-2; n=3...    37   0.58 
UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Re...    37   0.58 
UniRef50_UPI000023E7D4 Cluster: hypothetical protein FG06348.1; ...    36   0.77 
UniRef50_UPI000065EB23 Cluster: Translation initiation factor IF...    36   0.77 
UniRef50_Q39J67 Cluster: Putative uncharacterized protein; n=8; ...    36   0.77 
UniRef50_Q2GDP0 Cluster: Translation initiation factor IF-2; n=1...    36   0.77 
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    36   0.77 
UniRef50_Q7QZ18 Cluster: GLP_464_49314_47878; n=2; Giardia intes...    36   0.77 
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    36   0.77 
UniRef50_Q4N0F2 Cluster: Translation initiation factor IF-2, put...    36   0.77 
UniRef50_A0BPT3 Cluster: Chromosome undetermined scaffold_12, wh...    36   0.77 
UniRef50_Q6CDQ9 Cluster: Similar to DEHA0C03773g Debaryomyces ha...    36   0.77 
UniRef50_Q68WI4 Cluster: Translation initiation factor IF-2; n=1...    36   0.77 
UniRef50_P41091 Cluster: Eukaryotic translation initiation facto...    36   0.77 
UniRef50_A5UZQ2 Cluster: Translation initiation factor IF-2; n=5...    36   1.0  
UniRef50_A5D2S0 Cluster: Translation initiation factor 2; n=5; C...    36   1.0  
UniRef50_A1AV99 Cluster: Translation initiation factor IF-2; n=3...    36   1.0  
UniRef50_Q2XN58 Cluster: Auxin down-regulated protein; n=2; Glyc...    36   1.0  
UniRef50_O77136 Cluster: Translation initiation factor 2; n=1; A...    36   1.0  
UniRef50_A0BTU2 Cluster: Chromosome undetermined scaffold_128, w...    36   1.0  
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    36   1.0  
UniRef50_Q67P86 Cluster: Translation initiation factor IF-2; n=1...    36   1.0  
UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1...    36   1.0  
UniRef50_UPI00015BD5D6 Cluster: UPI00015BD5D6 related cluster; n...    36   1.3  
UniRef50_Q2LWU6 Cluster: Bacterial protein translation Initiatio...    36   1.3  
UniRef50_Q0AYI8 Cluster: Translation initiation factor IF-2; n=1...    36   1.3  
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    36   1.3  
UniRef50_A7AVU9 Cluster: Elongation factor Tu-like protein; n=1;...    36   1.3  
UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial, p...    36   1.3  
UniRef50_P57772 Cluster: Selenocysteine-specific elongation fact...    36   1.3  
UniRef50_Q5NQ27 Cluster: Translation initiation factor IF-2; n=2...    36   1.3  
UniRef50_Q73NP6 Cluster: Translation initiation factor IF-2; n=2...    36   1.3  
UniRef50_Q8A2A1 Cluster: Translation initiation factor IF-2; n=1...    36   1.3  
UniRef50_O67825 Cluster: Translation initiation factor IF-2; n=1...    36   1.3  
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    35   1.8  
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    35   1.8  
UniRef50_A0DB90 Cluster: Chromosome undetermined scaffold_44, wh...    35   1.8  
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    35   1.8  
UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5...    35   1.8  
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    35   1.8  
UniRef50_Q98R05 Cluster: Translation initiation factor IF-2; n=8...    35   1.8  
UniRef50_Q5HB61 Cluster: Translation initiation factor IF-2; n=6...    35   1.8  
UniRef50_Q8FXT2 Cluster: Translation initiation factor IF-2; n=3...    35   1.8  
UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family pr...    35   2.3  
UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation elo...    35   2.3  
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    35   2.3  
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    35   2.3  
UniRef50_A6CUD1 Cluster: Translation initiation factor IF-2; n=1...    35   2.3  
UniRef50_Q6BVE5 Cluster: Debaryomyces hansenii chromosome C of s...    35   2.3  
UniRef50_Q2GQL9 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    35   2.3  
UniRef50_Q3SWP9 Cluster: Translation initiation factor IF-2; n=8...    35   2.3  
UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: M...    35   2.3  
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    34   3.1  
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    34   3.1  
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    34   3.1  
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    34   3.1  
UniRef50_Q11PK5 Cluster: Translation initiation factor IF-2; n=1...    34   3.1  
UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus...    34   3.1  
UniRef50_Q0HFP5 Cluster: Transcriptional regulator, LysR family;...    34   3.1  
UniRef50_A7IC08 Cluster: Translation initiation factor IF-2; n=2...    34   3.1  
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    34   3.1  
UniRef50_Q8I243 Cluster: Selenocysteine-specific elongation fact...    34   3.1  
UniRef50_A7SA88 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.1  
UniRef50_A3LY41 Cluster: Predicted protein; n=3; Saccharomycetac...    34   3.1  
UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;...    34   3.1  
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    34   3.1  
UniRef50_Q5GS99 Cluster: Translation initiation factor IF-2; n=6...    34   3.1  
UniRef50_Q8F7K1 Cluster: Translation initiation factor IF-2; n=4...    34   3.1  
UniRef50_Q8KFT1 Cluster: Translation initiation factor IF-2; n=1...    34   3.1  
UniRef50_Q9AC25 Cluster: Translation initiation factor IF-2; n=1...    34   3.1  
UniRef50_UPI00015B5A9A Cluster: PREDICTED: similar to mitochondr...    34   4.1  
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    34   4.1  
UniRef50_Q4RW26 Cluster: Chromosome 9 SCAF14991, whole genome sh...    34   4.1  
UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_A5KJ69 Cluster: Putative uncharacterized protein; n=2; ...    34   4.1  
UniRef50_A5CEN6 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    34   4.1  
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    34   4.1  
UniRef50_A6MVX8 Cluster: Translation initiation factor 2; n=1; R...    34   4.1  
UniRef50_A4RU91 Cluster: Chloroplast translation initiation fact...    34   4.1  
UniRef50_Q7YXS0 Cluster: MB2; n=5; Plasmodium gallinaceum|Rep: M...    34   4.1  
UniRef50_Q4MYM5 Cluster: Elongation factor G, putative; n=2; The...    34   4.1  
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    34   4.1  
UniRef50_Q5KLM1 Cluster: GTP-binding protein 1 (G-protein 1), pu...    34   4.1  
UniRef50_Q4P257 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q1E0C9 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_A7TLH4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1, putat...    34   4.1  
UniRef50_Q4JA97 Cluster: GTP-binding protein 1; n=4; Sulfolobace...    34   4.1  
UniRef50_A0RUB8 Cluster: Translation initiation factor 2; n=2; T...    34   4.1  
UniRef50_Q9JHW4 Cluster: Selenocysteine-specific elongation fact...    34   4.1  
UniRef50_Q7VQM3 Cluster: Translation initiation factor IF-2; n=2...    34   4.1  
UniRef50_P17889 Cluster: Translation initiation factor IF-2; n=6...    34   4.1  
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    34   4.1  
UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31; Bacteri...    33   5.4  
UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongatio...    33   5.4  
UniRef50_Q2S1N7 Cluster: Translation initiation factor IF-2; n=1...    33   5.4  
UniRef50_Q8GDR1 Cluster: GTP-binding protein LepA; n=1; Heliobac...    33   5.4  
UniRef50_A5GVA3 Cluster: Putative uncharacterized protein SynRCC...    33   5.4  
UniRef50_A5FJF9 Cluster: Translation initiation factor IF-2; n=6...    33   5.4  
UniRef50_A3ZU78 Cluster: Translation initiation factor; n=1; Bla...    33   5.4  
UniRef50_A2VTQ7 Cluster: Elongation factor EF-Tu; n=1; Burkholde...    33   5.4  
UniRef50_A1I9J9 Cluster: Translation elongation factor G; n=1; C...    33   5.4  
UniRef50_A0LE19 Cluster: Translation initiation factor IF-2; n=1...    33   5.4  
UniRef50_A7P1C4 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   5.4  
UniRef50_Q9N398 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_Q4QBM3 Cluster: Translation initiation factor IF-2, put...    33   5.4  
UniRef50_Q239N3 Cluster: Elongation factor Tu GTP binding domain...    33   5.4  
UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain...    33   5.4  
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    33   5.4  
UniRef50_A6R794 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    33   5.4  
UniRef50_Q97S57 Cluster: Translation initiation factor IF-2; n=9...    33   5.4  
UniRef50_Q4FNM9 Cluster: Translation initiation factor IF-2; n=2...    33   5.4  
UniRef50_Q6MD64 Cluster: Translation initiation factor IF-2; n=1...    33   5.4  
UniRef50_Q9PKU0 Cluster: Translation initiation factor IF-2; n=1...    33   5.4  
UniRef50_O59683 Cluster: Translation initiation factor IF-2, mit...    33   5.4  
UniRef50_UPI0000D9AD7A Cluster: PREDICTED: similar to eukaryotic...    33   7.2  
UniRef50_Q8R6N2 Cluster: ABC-type multidrug/protein/lipid transp...    33   7.2  
UniRef50_Q10878 Cluster: POSSIBLE FATTY-ACID-CoA LIGASE FADD10; ...    33   7.2  
UniRef50_Q4C3K5 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    33   7.2  
UniRef50_Q1IIT3 Cluster: Translation initiation factor IF-2; n=2...    33   7.2  
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    33   7.2  
UniRef50_A6EB22 Cluster: Translation initiation factor IF-2; n=2...    33   7.2  
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    33   7.2  
UniRef50_A0LHL8 Cluster: Translation initiation factor IF-2; n=1...    33   7.2  
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    33   7.2  
UniRef50_A2Y968 Cluster: Putative uncharacterized protein; n=2; ...    33   7.2  
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    33   7.2  
UniRef50_Q583L1 Cluster: Selenocysteine-tRNA-specific elongation...    33   7.2  
UniRef50_Q4UIN6 Cluster: GTP-binding protein, LepA subfamily, pu...    33   7.2  
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    33   7.2  
UniRef50_Q4P305 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_A1D3X4 Cluster: Mitochondrial translation initiation fa...    33   7.2  
UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41; B...    33   7.2  
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    33   7.2  
UniRef50_UPI0000DA1A06 Cluster: PREDICTED: similar to elongation...    33   9.5  
UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA...    33   9.5  
UniRef50_UPI00003933D9 Cluster: COG1217: Predicted membrane GTPa...    33   9.5  
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    33   9.5  
UniRef50_Q0RNV6 Cluster: Elongation factor G; n=1; Frankia alni ...    33   9.5  
UniRef50_A6G5J6 Cluster: Translation initiation factor IF-2; n=1...    33   9.5  
UniRef50_A6DY38 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2; ...    33   9.5  
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    33   9.5  
UniRef50_A3TP61 Cluster: Translation elongation factor EF-G; n=1...    33   9.5  
UniRef50_A0W5N5 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsi...    33   9.5  
UniRef50_O82501 Cluster: F2P3.9 protein; n=7; Magnoliophyta|Rep:...    33   9.5  
UniRef50_Q4QAJ7 Cluster: Translation initiation factor IF-2, put...    33   9.5  
UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;...    33   9.5  
UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella ve...    33   9.5  
UniRef50_A7AQ93 Cluster: GTP-binding protein LepA family protein...    33   9.5  
UniRef50_A6SF10 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_A6S378 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like ...    33   9.5  
UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;...    33   9.5  
UniRef50_A1CA46 Cluster: Translation elongation factor G2, putat...    33   9.5  
UniRef50_O78489 Cluster: Translation initiation factor IF-2, chl...    33   9.5  
UniRef50_Q9X1Y4 Cluster: Elongation factor G-like protein; n=5; ...    33   9.5  
UniRef50_P34811 Cluster: Elongation factor G, chloroplast precur...    33   9.5  
UniRef50_Q0AXN1 Cluster: Elongation factor G 1; n=1; Syntrophomo...    33   9.5  
UniRef50_P13639 Cluster: Elongation factor 2; n=491; Eukaryota|R...    33   9.5  

>UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397;
           root|Rep: Elongation factor 1-alpha 2 - Homo sapiens
           (Human)
          Length = 463

 Score =  221 bits (540), Expect = 1e-56
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 8e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score =  217 bits (529), Expect = 3e-55
 Identities = 103/128 (80%), Positives = 109/128 (85%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 359 KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 418

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 419 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 478

Query: 617 DNMLELQP 640
           DNMLE  P
Sbjct: 479 DNMLEPSP 486



 Score =  145 bits (352), Expect = 8e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 281 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 340

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 341 DKLKAERE 348


>UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224;
           cellular organisms|Rep: Elongation factor 1-alpha -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 449

 Score =  181 bits (440), Expect = 2e-44
 Identities = 85/125 (68%), Positives = 99/125 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHAL
Sbjct: 79  KFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQ+I   NKMD+T P Y      +  ++     KK+GYNP  + FVPISG+ G
Sbjct: 139 LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198

Query: 617 DNMLE 631
           DNM+E
Sbjct: 199 DNMIE 203



 Score =  130 bits (313), Expect = 5e-29
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;
           n=6; Fungi/Metazoa group|Rep: Elongation factor
           1-alpha-like protein - Magnaporthe grisea (Rice blast
           fungus) (Pyricularia grisea)
          Length = 473

 Score =  178 bits (434), Expect = 1e-43
 Identities = 84/124 (67%), Positives = 104/124 (83%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KY VT+IDAPGHRDFIKNMITGTSQADCA+L++ AGTGEFEAGISK+GQTREHAL
Sbjct: 80  KFETAKYQVTVIDAPGHRDFIKNMITGTSQADCAILVIGAGTGEFEAGISKDGQTREHAL 139

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGV+QLIV VNKMD+ +  +      +  ++  +  KKIG+NP +V FVPISG++G
Sbjct: 140 LAFTLGVRQLIVAVNKMDTAK--WAQSRYDEIVKETSNFLKKIGFNPDSVPFVPISGFNG 197

Query: 617 DNML 628
           D+M+
Sbjct: 198 DHMI 201



 Score =  127 bits (306), Expect = 3e-28
 Identities = 57/66 (86%), Positives = 63/66 (95%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           KEK+H+N+VVIGHVDSGKSTTTGHLIYK  GID+RTIEK+EKEA E+GKGSFKYAWVLDK
Sbjct: 4   KEKSHLNVVVIGHVDSGKSTTTGHLIYKLKGIDQRTIEKYEKEAAELGKGSFKYAWVLDK 63

Query: 211 LKAERE 228
           LKAERE
Sbjct: 64  LKAERE 69


>UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1
           alpha/Tu; n=1; Aspergillus oryzae|Rep: Translation
           elongation factor EF-1 alpha/Tu - Aspergillus oryzae
          Length = 534

 Score =  163 bits (396), Expect = 4e-39
 Identities = 76/124 (61%), Positives = 96/124 (77%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K+ VT+IDAPGHRD+IKN ITG SQADCA+L+ +A  GEFEAG+ + GQ+R+H +L
Sbjct: 190 FETPKFVVTVIDAPGHRDYIKNTITGASQADCAILVTSATNGEFEAGVDQGGQSRQHLVL 249

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A+TLGV+QLIV VNKMD+  P Y    L +  ++     KKIGYNP AVAFVPISG +GD
Sbjct: 250 AYTLGVRQLIVAVNKMDT--PRYTDDCLNEIVKETSDFIKKIGYNPKAVAFVPISGLYGD 307

Query: 620 NMLE 631
           N++E
Sbjct: 308 NLVE 311



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 31/85 (36%), Positives = 43/85 (50%), Gaps = 19/85 (22%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF-------------------E 153
           +EK HI  V +GH+D GKSTT   LIY+ G +    I ++                    
Sbjct: 95  REKPHITAVFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSLSSDLLCAGARPHDN 154

Query: 154 KEAQEMGKGSFKYAWVLDKLKAERE 228
              QE G  S+KY WV++KL+AER+
Sbjct: 155 HSPQEAGP-SYKYGWVIEKLRAERK 178


>UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellular
           organisms|Rep: Elongation factor 1-alpha - Sulfolobus
           solfataricus
          Length = 435

 Score =  146 bits (354), Expect = 5e-34
 Identities = 69/123 (56%), Positives = 87/123 (70%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +FET KY+ TIIDAPGHRDF+KNMITG SQAD A+L+V+A  GE+EAG+S  GQTREH +
Sbjct: 78  RFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGMSVEGQTREHII 137

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA T+G+ QLIV VNKMD TEPPY     ++   +     +  G+N   V FVP+    G
Sbjct: 138 LAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVRFVPVVAPAG 197

Query: 617 DNM 625
           DN+
Sbjct: 198 DNI 200



 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 32/65 (49%), Positives = 51/65 (78%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K H+N++VIGH+D GKST  G L+   G ID++T+++ E+ A+++GK S K+A++LD+L
Sbjct: 3   QKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRL 62

Query: 214 KAERE 228
           K ERE
Sbjct: 63  KEERE 67


>UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0538 UniRef100
           entry - Canis familiaris
          Length = 357

 Score =  145 bits (351), Expect = 1e-33
 Identities = 73/84 (86%), Positives = 76/84 (90%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTI DA GH+  IKNMITGT QADCAVLIVAAG GEFEAGISK GQTREHAL
Sbjct: 80  KFETSKYYVTITDATGHKH-IKNMITGTPQADCAVLIVAAGVGEFEAGISKMGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPY 508
           LA TLGVKQL+VGVNK+DSTEPPY
Sbjct: 139 LA-TLGVKQLVVGVNKIDSTEPPY 161



 Score =  117 bits (281), Expect = 3e-25
 Identities = 58/70 (82%), Positives = 60/70 (85%), Gaps = 2/70 (2%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDS--GKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           MGKE THINI+VI H     GKSTTTGHLIYKCGGIDKRTIEKFE EA EMGKGSF+YAW
Sbjct: 1   MGKEMTHINIIVISHWMHRLGKSTTTGHLIYKCGGIDKRTIEKFE-EAAEMGKGSFRYAW 59

Query: 199 VLDKLKAERE 228
           VLDKLKAE E
Sbjct: 60  VLDKLKAEHE 69


>UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Gibberella intermedia (Bulb rot disease fungus)
           (Fusariumproliferatum)
          Length = 108

 Score =  137 bits (331), Expect = 3e-31
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 1/69 (1%)
 Frame = +1

Query: 25  MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           MGKE KTH+N+VVIGHVDSGKSTTTGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWV
Sbjct: 1   MGKEDKTHLNVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV 60

Query: 202 LDKLKAERE 228
           LDKLKAERE
Sbjct: 61  LDKLKAERE 69



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 26/29 (89%), Positives = 28/29 (96%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTS 343
           KFET +YYVT+IDAPGHRDFIKNMITGTS
Sbjct: 80  KFETPRYYVTVIDAPGHRDFIKNMITGTS 108


>UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation
           factor 1 alpha; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to elongation factor 1 alpha -
           Strongylocentrotus purpuratus
          Length = 570

 Score =  132 bits (320), Expect = 6e-30
 Identities = 68/113 (60%), Positives = 81/113 (71%), Gaps = 1/113 (0%)
 Frame = +2

Query: 344 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDL 523
           +ADCAVL+VAAG GEFEAGISK+GQTREHALL +TLGVKQLIV VNKMDS +  Y     
Sbjct: 333 KADCAVLVVAAGIGEFEAGISKDGQTREHALLCYTLGVKQLIVAVNKMDSAQ--YNEARF 390

Query: 524 RKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDG-QVERK 679
           ++  R+     KK+GYNP AV F+PISGW GDNM+E     +    G  +ERK
Sbjct: 391 KEIVREVSGYIKKVGYNPKAVPFIPISGWVGDNMMEAATTTMPWFKGWSIERK 443


>UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-like;
           n=1; Homo sapiens|Rep: PREDICTED: similar to statin-like
           - Homo sapiens
          Length = 254

 Score =  132 bits (320), Expect = 6e-30
 Identities = 67/117 (57%), Positives = 78/117 (66%)
 Frame = +2

Query: 338 TSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSP 517
           + Q DCAVLIVA+G GE EAGISKN Q  EH LLA+TLG+KQLIV VNKMD TEPPY S 
Sbjct: 44  SGQEDCAVLIVASGVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNKMDITEPPYSST 103

Query: 518 DLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERKVRP 688
              +  ++     KKI YN   + FVPISGWHGDNMLE   K   S   ++   +RP
Sbjct: 104 CFEEISKEVKAYIKKISYNSQTLPFVPISGWHGDNMLEPGSKTRISLPKELSSNIRP 160


>UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porphyra
           purpurea|Rep: Elongation factor 1-alpha S - Porphyra
           purpurea
          Length = 515

 Score =  129 bits (312), Expect = 6e-29
 Identities = 59/68 (86%), Positives = 63/68 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHIN+VVIGHVD+GKSTTTGHLIYK GGID RTI KFE +A+EMGK SFKYAWVL
Sbjct: 1   MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score =  122 bits (293), Expect = 1e-26
 Identities = 75/155 (48%), Positives = 91/155 (58%), Gaps = 30/155 (19%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KF T+K+  T+IDAPGHRDFIKNMITGTSQAD A+L++      FEAGI++ G T+EHAL
Sbjct: 79  KFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG--NNFEAGIAEGGSTKEHAL 136

Query: 437 LAFTLGVKQLIVGVNKMDSTEP---------------PYVSPDLRK-SRRKYPHTFKKIG 568
           LA+TLGVKQL VG+NKMD  +                 Y+ P+L K   +K     KK G
Sbjct: 137 LAYTLGVKQLAVGINKMDDVKDKDGGPWAQGRYNEVVDYLGPELMKIGFKKKDKGDKKKG 196

Query: 569 YNP--------------AAVAFVPISGWHGDNMLE 631
                             +  FVPISGW GDNMLE
Sbjct: 197 DKKEKKDKKDKGEKKYVCSATFVPISGWTGDNMLE 231


>UniRef50_P15170 Cluster: G1 to S phase transition protein 1
           homolog; n=77; Eukaryota|Rep: G1 to S phase transition
           protein 1 homolog - Homo sapiens (Human)
          Length = 499

 Score =  128 bits (310), Expect = 1e-28
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 147 FETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 206

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     + +    + + K     KK+G+NP   + F+P SG  G
Sbjct: 207 AKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 267 ANLKEQSDFC 276



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20;
           Archaea|Rep: Elongation factor 1-alpha - Pyrobaculum
           aerophilum
          Length = 444

 Score =  127 bits (306), Expect = 3e-28
 Identities = 59/122 (48%), Positives = 80/122 (65%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET+K ++TIID PGHRDF+KNMI G SQAD A+ +++A  GEFEA I   GQ REH  L
Sbjct: 90  FETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFEAAIGPQGQGREHLFL 149

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             TLGV+Q++V VNKMD     Y      + + +     K +GY+P+ + F+P+S   GD
Sbjct: 150 IRTLGVQQIVVAVNKMDVVN--YDQKRYEQVKAEVSKLLKLLGYDPSKIHFIPVSAIKGD 207

Query: 620 NM 625
           N+
Sbjct: 208 NI 209



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 31/65 (47%), Positives = 50/65 (76%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K HIN+ V+GHVD+GKST  G L+Y+ G +D++ +++ E+ A+++GK  F +AW+LD+ 
Sbjct: 14  QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRF 73

Query: 214 KAERE 228
           K ERE
Sbjct: 74  KEERE 78


>UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|Rep:
           HBS1-like protein - Homo sapiens (Human)
          Length = 684

 Score =  126 bits (305), Expect = 4e-28
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 473

 Score =  125 bits (302), Expect = 1e-27
 Identities = 59/125 (47%), Positives = 83/125 (66%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQTREHA+
Sbjct: 123 RFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAI 182

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QLIV +NK+D     +          K  H  K++G+  + V +VP+SG  G
Sbjct: 183 LVRSLGVTQLIVAINKLDMMS--WSEERYLHIVSKLKHFLKQVGFKDSDVVYVPVSGLSG 240

Query: 617 DNMLE 631
           +N+++
Sbjct: 241 ENLVK 245



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 13/82 (15%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE-------------KEA 162
           K  + K  +N+V+IGHVD+GKST  GHL++  G + K+ + K+               E+
Sbjct: 31  KRHQGKELLNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTES 90

Query: 163 QEMGKGSFKYAWVLDKLKAERE 228
           ++ GK SF YAWVLD+   ERE
Sbjct: 91  KKAGKASFAYAWVLDETGEERE 112


>UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2;
           Chilodonella uncinata|Rep: Elongation factor 1-alpha -
           Chilodonella uncinata
          Length = 403

 Score =  124 bits (299), Expect = 2e-27
 Identities = 60/113 (53%), Positives = 76/113 (67%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++DAPGHRDF+K++ITG  QAD  +L+V A  GEFEAGISK+GQTRE ALLA+TLGVKQ 
Sbjct: 74  LVDAPGHRDFVKSLITGVCQADFCLLVVVAAAGEFEAGISKDGQTREQALLAYTLGVKQF 133

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNM 625
           IV V+KMD     Y      + + +    F K+G     + FV IS W GDN+
Sbjct: 134 IVVVSKMDHKSVNYSQIRFAEIQTEIRLMFTKMGVKADQIPFVAISAWFGDNI 186



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +1

Query: 76  SGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           SGKST   HL Y CGG+D+RT   ++++ + MG     + W++D+ + +R+
Sbjct: 1   SGKSTIVAHLAYLCGGLDRRTRMDYDEQRKLMGDKPLSFGWLMDRYRTDRD 51


>UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1,
           subunit alpha, putative; n=11; Apicomplexa|Rep:
           Translation elongation factor EF-1, subunit alpha,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 555

 Score =  122 bits (294), Expect = 9e-27
 Identities = 63/125 (50%), Positives = 78/125 (62%), Gaps = 1/125 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     TI+DAPGH++FI NMI+G +QAD  VLI++A  GEFE G  + GQTREH LL
Sbjct: 192 FETKDRRFTILDAPGHKNFIPNMISGAAQADIGVLIISARKGEFETGFERGGQTREHTLL 251

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPISGWHG 616
           A TLG+ QLIV +NKMD     +      + ++K     K  GYN    V FVPISG  G
Sbjct: 252 ARTLGINQLIVAINKMDDPTCNWSESRYEEIQKKITPYIKSCGYNINKDVFFVPISGLTG 311

Query: 617 DNMLE 631
            N+ E
Sbjct: 312 QNLSE 316



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 30/64 (46%), Positives = 48/64 (75%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           + H+NI+ IGHVD+GKST  G+++Y  G +D RTIEK+E+EA+E  + S+  A+++D  +
Sbjct: 117 RPHLNIIFIGHVDAGKSTACGNILYILGYVDDRTIEKYEREAKEKSRESWFLAFIMDINE 176

Query: 217 AERE 228
            ER+
Sbjct: 177 EERQ 180


>UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Dictyostelium discoideum|Rep: Hsp70 subfamily B
           suppressor 1 - Dictyostelium discoideum (Slime mold)
          Length = 317

 Score =  122 bits (294), Expect = 9e-27
 Identities = 65/130 (50%), Positives = 85/130 (65%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C R FET    +T++DAPGHRDFI NMI+GT+QAD A+L++ A   EFEAG S  GQT+E
Sbjct: 57  CVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILLINA--SEFEAGFSAEGQTKE 114

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           HALLA +LG+ +LIV VNKMDS E      D      K      K  +N   + F+PISG
Sbjct: 115 HALLAKSLGIMELIVAVNKMDSIEWDQSRYDYIVETIKTFLVHAK--FNEKNIRFIPISG 172

Query: 608 WHGDNMLELQ 637
           + G+N+++ Q
Sbjct: 173 FTGENLIDRQ 182



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 29/49 (59%), Positives = 38/49 (77%)
 Frame = +1

Query: 82  KSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           KSTT GH+++K G +DKRT+ KFE E+  MGK SF +AWVLD+ + ERE
Sbjct: 1   KSTTMGHILFKLGYVDKRTMSKFENESNRMGKSSFHFAWVLDEQEEERE 49


>UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 441

 Score =  121 bits (292), Expect = 2e-26
 Identities = 54/127 (42%), Positives = 82/127 (64%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K+ +TIID PG   + KNM+TG   AD AVL+++A   EFE G  K+GQT++  L 
Sbjct: 84  FETDKFQITIIDTPGDTQYTKNMMTGICLADAAVLMISAAADEFEKGFGKDGQTKDFILH 143

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           ++ LG+KQ+IV +NKMD ++  +      + +++    F+KI +N   + F+PIS + GD
Sbjct: 144 SYALGIKQMIVCINKMDDSKYSFCQKRFNEIKKEVKQQFEKINFNLQNIKFIPISAFLGD 203

Query: 620 NMLELQP 640
           N+LE  P
Sbjct: 204 NLLEKSP 210



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/72 (33%), Positives = 45/72 (62%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           ++K  I + VIG++ SGKST  GHL  + G ++ + +++ ++  +E G+    Y++++D 
Sbjct: 7   QKKERITLAVIGNIGSGKSTMCGHLAIQLGQVNDQKLKEVKQACEEEGQDGINYSYIMDT 66

Query: 211 LKAEREXVSQSI 246
            K ER+   QSI
Sbjct: 67  KKVERQR-KQSI 77


>UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 610

 Score =  120 bits (288), Expect = 5e-26
 Identities = 62/124 (50%), Positives = 84/124 (67%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQT+EHALL
Sbjct: 261 FETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQTKEHALL 320

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGV QLIV VNK+D+ +      D  K+      T ++ G++     FVP+SG+ G+
Sbjct: 321 LRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSVFLT-RQAGFSKP--KFVPVSGFTGE 377

Query: 620 NMLE 631
           N+++
Sbjct: 378 NLIK 381



 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 214 KAERE 228
           + ERE
Sbjct: 245 EEERE 249


>UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococcus
           tauri|Rep: EF-1 alpha-like protein - Ostreococcus tauri
          Length = 444

 Score =  118 bits (284), Expect = 1e-25
 Identities = 68/157 (43%), Positives = 91/157 (57%), Gaps = 12/157 (7%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK------- 409
           +++F T K++ TIIDAPGHRDFIKNMI+G +QAD A+L+V A  G F   I K       
Sbjct: 84  TKEFFTEKWHYTIIDAPGHRDFIKNMISGAAQADVALLMVPA-DGNFTVAIQKGNHKAGE 142

Query: 410 -NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIG----YN 574
             GQTR+HA L   LGVKQLI+G+NKMD     Y      + R +  +   K+G    Y 
Sbjct: 143 VQGQTRQHARLLNLLGVKQLIIGINKMDCDMAGYKQERYEEIRNEMKNMLIKVGWKKDYV 202

Query: 575 PAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERKVR 685
             +V  +PISGW+GDN+L+   K         E ++R
Sbjct: 203 EKSVPVLPISGWNGDNLLKKSEKMAXXXXXXXEAQMR 239



 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 36/68 (52%), Positives = 51/68 (75%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M + K H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK + EA  +GK SF +A+ +
Sbjct: 8   MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKAEADALGKSSFAFAFYM 67

Query: 205 DKLKAERE 228
           D+ K ERE
Sbjct: 68  DRQKEERE 75


>UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 532

 Score =  118 bits (284), Expect = 1e-25
 Identities = 55/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREH++L
Sbjct: 182 FETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQTREHSML 241

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
             T GVK L++ VNKMD     +     ++   K     +K+G+NP   + +VP SG  G
Sbjct: 242 VKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYVPCSGLTG 301



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 34/67 (50%), Positives = 48/67 (71%)
 Frame = +1

Query: 28  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 207
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 208 KLKAERE 228
               ERE
Sbjct: 164 TNDEERE 170


>UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alpha
           subunit; n=2; Euryarchaeota|Rep: Translation elongation
           factor EF-1 alpha subunit - Methanohalophilus
           portucalensis
          Length = 354

 Score =  118 bits (284), Expect = 1e-25
 Identities = 58/124 (46%), Positives = 78/124 (62%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           ++F+T KYY TI+D PGHRDF+KNMITG SQAD AVL+VAA  G          QT+EH 
Sbjct: 56  KRFDTDKYYFTIVDCPGHRDFVKNMITGASQADAAVLVVAATDGVM-------AQTKEHV 108

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            L+ TLG+ QLI+ VNKMD+T+  Y      + ++        +G+  A V F+P S + 
Sbjct: 109 FLSRTLGINQLIIAVNKMDATD--YSEDKYNQVKKDVSELLGMVGFKAADVPFIPTSAFE 166

Query: 614 GDNM 625
           GDN+
Sbjct: 167 GDNI 170



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/42 (54%), Positives = 30/42 (71%)
 Frame = +1

Query: 103 LIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           L+Y  G I +  I+KF +EA+E GK SF +AWV+D LK ERE
Sbjct: 5   LLYXTGAIPQHIIDKFREEAKEKGKESFAFAWVMDSLKEERE 46


>UniRef50_A2AX44 Cluster: Translation elongation factor 1 like;
           n=37; Eukaryota|Rep: Translation elongation factor 1
           like - Guillardia theta (Cryptomonas phi)
          Length = 472

 Score =  116 bits (280), Expect = 4e-25
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 12/138 (8%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK------- 409
           +++F T K++ TIIDAPGHRDFIKNMI+G++QAD A+L+V A  G F   I K       
Sbjct: 76  TKEFFTDKWHYTIIDAPGHRDFIKNMISGSAQADVALLMVPA-DGNFTTAIQKGDAKAGE 134

Query: 410 -NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN---- 574
             GQTR+HA +   LG+KQLIVG+NKMDS    Y      + R +  +   ++G+     
Sbjct: 135 IQGQTRQHARILNLLGIKQLIVGINKMDSDTAGYKEERYNEIRDEMRNMLIRVGWKKEFV 194

Query: 575 PAAVAFVPISGWHGDNML 628
            A+V  +PISGW GDN+L
Sbjct: 195 AASVPVIPISGWMGDNLL 212



 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 36/65 (55%), Positives = 51/65 (78%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           EK H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK ++EA  +GK SF +A+ +D+ 
Sbjct: 3   EKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKEEAANLGKSSFAFAFYMDRQ 62

Query: 214 KAERE 228
           K ERE
Sbjct: 63  KEERE 67


>UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1898-PA - Tribolium castaneum
          Length = 792

 Score =  115 bits (277), Expect = 1e-24
 Identities = 58/125 (46%), Positives = 77/125 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +FET   +VT++DAPGH+DFI NMI+G  QAD A+L+V A  GEFE G    GQTREHAL
Sbjct: 440 QFETKSKHVTLLDAPGHKDFIPNMISGAGQADVALLVVDATRGEFETGFDFGGQTREHAL 499

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V +NK+D+    +         +K     K+ G+    V FVP SG  G
Sbjct: 500 LVRSLGVTQLAVAINKLDTVS--WSKERFDDISQKLKVFLKQAGFREGDVTFVPCSGLTG 557

Query: 617 DNMLE 631
            N+++
Sbjct: 558 QNLVD 562



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 35/66 (53%), Positives = 51/66 (77%)
 Frame = +1

Query: 28  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 207
           G  K H+ +VVIGHVD+GKST  GHL+Y  G ++++T+ K+E+E++++GK SF YAWVLD
Sbjct: 363 GDSKEHLYMVVIGHVDAGKSTLMGHLLYDLGQVNQKTMHKYEQESRKVGKQSFMYAWVLD 422

Query: 208 KLKAER 225
           +   ER
Sbjct: 423 ETGEER 428


>UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Giardia intestinalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Giardia lamblia
           (Giardia intestinalis)
          Length = 465

 Score =  115 bits (277), Expect = 1e-24
 Identities = 54/124 (43%), Positives = 79/124 (63%), Gaps = 3/124 (2%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +TIIDAPGH+ F+ NMI+G +QAD A+L+++A  GEFE+G  + GQT EHALLA+  G+K
Sbjct: 97  ITIIDAPGHKGFVHNMISGAAQADTAILVISARKGEFESGFERGGQTSEHALLAYVNGIK 156

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNML---E 631
           Q++  +NKMD     Y          +     + +GY    + F+PISG+ G+N++   E
Sbjct: 157 QIVCLINKMDDITVEYCKKRYDSIVSQLKLYLENVGYASKNIFFLPISGFTGENLISTKE 216

Query: 632 LQPK 643
           L PK
Sbjct: 217 LNPK 220



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 31/66 (46%), Positives = 50/66 (75%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           +++ ++NIV IGHVD+GKST +GHL+   G +DKR +EK E++A+ + + S+KYA+ +D 
Sbjct: 12  EKRKNLNIVFIGHVDAGKSTISGHLVSDLGKLDKRQLEKLEQQAKALNRESWKYAFAMDT 71

Query: 211 LKAERE 228
            + ERE
Sbjct: 72  SEEERE 77


>UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneura
           angophorae|Rep: Elongation factor-1 alpha - Exoneura
           angophorae
          Length = 139

 Score =  114 bits (275), Expect = 2e-24
 Identities = 52/80 (65%), Positives = 61/80 (76%)
 Frame = +2

Query: 401 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPA 580
           +  +G+ REHALLAFTLGVKQLIVGVNKMD T+PPY      + +++     KKIGYN A
Sbjct: 60  VDSSGRHREHALLAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKEVSSYIKKIGYNTA 119

Query: 581 AVAFVPISGWHGDNMLELQP 640
           +VAFVPISGWHGDNMLE  P
Sbjct: 120 SVAFVPISGWHGDNMLESSP 139



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 38/102 (37%), Positives = 51/102 (50%)
 Frame = +1

Query: 256 EVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL*ERSNP*ACL 435
           EVR+ ++L  +H  + + RFHQEHDHR+ SG LR    S R+R        E +     L
Sbjct: 25  EVRDGEILRDYHRRARSSRFHQEHDHRDESGGLRRVDSSGRHR--------EHA-----L 71

Query: 436 ARFHPRCQTAHRRSKQNGFH*TTIREPRFEEIKKEVSSYIQE 561
             F    +       +         E RFEEIKKEVSSYI++
Sbjct: 72  LAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKEVSSYIKK 113


>UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 756

 Score =  114 bits (274), Expect = 2e-24
 Identities = 57/123 (46%), Positives = 79/123 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET K   TI+DAPGHRDFI NMI G SQAD AVL++ A  G FE+G+   GQT+EHAL
Sbjct: 419 KFETEKTTFTILDAPGHRDFIPNMIAGASQADFAVLVIDASVGSFESGL--KGQTKEHAL 476

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA ++GV+++I+ VNK+D+    +      +  ++        G+    + F+P SG HG
Sbjct: 477 LARSMGVQRIIIAVNKLDTV--GWSQERFDEISQQVSAFLTAAGFQEQNIKFIPCSGLHG 534

Query: 617 DNM 625
           DN+
Sbjct: 535 DNI 537



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 35/65 (53%), Positives = 45/65 (69%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           K K   N VVIGHVD+GKST  G L+Y    +D+RT++++ KEA+ MGK SF  AWVLD+
Sbjct: 343 KSKNAANFVVIGHVDAGKSTLMGRLLYDLKVVDQRTVDRYRKEAEAMGKSSFALAWVLDQ 402

Query: 211 LKAER 225
              ER
Sbjct: 403 GTEER 407


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score =  113 bits (272), Expect = 4e-24
 Identities = 60/127 (47%), Positives = 81/127 (63%), Gaps = 3/127 (2%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGH+ ++ NMI GT+QA+ AVL+++A  GE+E G  K GQTREHA+L
Sbjct: 275 FETEKRRYTILDAPGHKSYVPNMIEGTAQAEVAVLVISARKGEYETGFEKGGQTREHAML 334

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTF--KKIGYNPAA-VAFVPISGW 610
           + T GV +LIV +NKMD     + S +          TF  K++GYNP     F+PIS +
Sbjct: 335 SKTQGVSKLIVAINKMDDPTVEW-SKERYDECTNGITTFLRKEVGYNPKTDFVFMPISAF 393

Query: 611 HGDNMLE 631
            G N+ E
Sbjct: 394 TGINIKE 400



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 34/63 (53%), Positives = 48/63 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H+N+V IGHVD+GKST  G+++Y  G +DKRT+EK+EK+A+E G+ S+  +W LD  K
Sbjct: 200 KEHVNVVFIGHVDAGKSTLGGNILYMTGMVDKRTMEKYEKDAKEAGRESWYLSWALDSTK 259

Query: 217 AER 225
            ER
Sbjct: 260 EER 262


>UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;
           Eurotiomycetidae|Rep: Contig An11c0160, complete genome
           - Aspergillus niger
          Length = 809

 Score =  113 bits (271), Expect = 6e-24
 Identities = 56/125 (44%), Positives = 79/125 (63%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           + KFET     TI+DAPGHRDF+ NMI G SQAD AVL++ +  G FE+G+   GQT+EH
Sbjct: 471 TNKFETESTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSSIGNFESGL--KGQTKEH 528

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGW 610
           ALL  ++GV+++I+ VNKMDS +  +      +  ++        G+    +AFVP SG 
Sbjct: 529 ALLVRSMGVQRIIIAVNKMDSVQ--WDQGRFEEIEQQVSSFLTTAGFQAKNIAFVPCSGI 586

Query: 611 HGDNM 625
            GDN+
Sbjct: 587 SGDNV 591



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 34/65 (52%), Positives = 46/65 (70%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           + K  +N  VIGHVD+GKST  G L+     +D+RT+EK+ KEA+++GKGSF  AWVLD+
Sbjct: 397 QRKKAMNFAVIGHVDAGKSTLMGRLLADLKAVDQRTLEKYRKEAEKIGKGSFALAWVLDQ 456

Query: 211 LKAER 225
              ER
Sbjct: 457 GSEER 461


>UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Zygosaccharomyces rouxii|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Zygosaccharomyces rouxii (Candida mogii)
          Length = 662

 Score =  113 bits (271), Expect = 6e-24
 Identities = 58/130 (44%), Positives = 78/130 (60%), Gaps = 2/130 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K GQTREHALL
Sbjct: 310 FETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQTREHALL 369

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPISGWHG 616
           A T GV +LIV +NKMD     +      +  +   +  K IGYN    V F+P+SG+ G
Sbjct: 370 AKTQGVNKLIVTINKMDDPTVNWSKERYDQCVKNLSNFLKAIGYNVKEEVVFMPVSGYSG 429

Query: 617 DNM-LELQPK 643
             +   + PK
Sbjct: 430 AGLGTRVDPK 439



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 30/64 (46%), Positives = 49/64 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ GK  +  +WV+D  +
Sbjct: 235 KDHMSIIFMGHVDAGKSTMGGNILYMTGSVDKRTVEKYEREAKDAGKQGWYLSWVMDTNR 294

Query: 217 AERE 228
            ER+
Sbjct: 295 EERD 298


>UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=31; cellular organisms|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Candida albicans (Yeast)
          Length = 715

 Score =  112 bits (270), Expect = 7e-24
 Identities = 58/136 (42%), Positives = 81/136 (59%), Gaps = 1/136 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K GQTREHALL
Sbjct: 365 FETDKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQTREHALL 424

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A T GV ++IV VNKMD +   +     ++   K     K IGY    + ++P+SG+ G 
Sbjct: 425 AKTQGVNKIIVVVNKMDDSTVGWSKERYQECTTKLGAFLKGIGYAKDDIIYMPVSGYTGA 484

Query: 620 NMLE-LQPKCLGSRDG 664
            + + + PK     DG
Sbjct: 485 GLKDRVDPKDCPWYDG 500



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 30/63 (47%), Positives = 48/63 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ G+  +  +WV+D  K
Sbjct: 290 KDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNK 349

Query: 217 AER 225
            ER
Sbjct: 350 EER 352


>UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9;
           Magnoliophyta|Rep: GTP-binding protein - Triticum
           aestivum (Wheat)
          Length = 533

 Score =  112 bits (269), Expect = 1e-23
 Identities = 60/133 (45%), Positives = 77/133 (57%), Gaps = 1/133 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQTREH LL
Sbjct: 165 FETENTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVLL 224

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPISGWHG 616
           A TLGV +L+V +NKMD     +      +   K     +  GYN    V F+PISG  G
Sbjct: 225 AKTLGVAKLVVVINKMDEPTVQWSKERYDEIEGKMIPFLRSSGYNVKKDVQFLPISGLCG 284

Query: 617 DNMLELQPKCLGS 655
            NM     K + S
Sbjct: 285 ANMKTRMDKSICS 297



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/65 (47%), Positives = 48/65 (73%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           +EK HIN+V IGHVD+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D 
Sbjct: 88  EEKRHINLVFIGHVDAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDT 147

Query: 211 LKAER 225
            + ER
Sbjct: 148 NEEER 152


>UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=50; Ascomycota|Rep: Eukaryotic
           peptide chain release factor GTP-binding subunit -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 685

 Score =  111 bits (267), Expect = 2e-23
 Identities = 57/130 (43%), Positives = 79/130 (60%), Gaps = 2/130 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGH+ ++  MI G SQAD  VL+++A  GE+E G  + GQTREHALL
Sbjct: 333 FETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALL 392

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYN-PAAVAFVPISGWHG 616
           A T GV +++V VNKMD     +      +      +  + IGYN    V F+P+SG+ G
Sbjct: 393 AKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMPVSGYSG 452

Query: 617 DNMLE-LQPK 643
            N+ + + PK
Sbjct: 453 ANLKDHVDPK 462



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  +  +WV+D  K
Sbjct: 258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNK 317

Query: 217 AER 225
            ER
Sbjct: 318 EER 320


>UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|Rep:
           H0801D08.2 protein - Oryza sativa (Rice)
          Length = 654

 Score =  111 bits (266), Expect = 2e-23
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 2/125 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN--GQTREHA 433
           F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  N  GQT+EH+
Sbjct: 307 FDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGINGIGQTKEHS 366

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            L  + GV  LIV VNKMDS E  Y        + +     +  GY  +AVA+VPIS   
Sbjct: 367 QLVRSFGVDNLIVVVNKMDSVE--YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPISAME 424

Query: 614 GDNML 628
            +N++
Sbjct: 425 NENLM 429


>UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n=3;
           Eukaryota|Rep: Translation release factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 757

 Score =  110 bits (265), Expect = 3e-23
 Identities = 53/123 (43%), Positives = 77/123 (62%), Gaps = 1/123 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FE+ K   TI+DAPGH+ ++ +MI+G +QAD A+L+++A  GEFE G  + GQTREHA+L
Sbjct: 388 FESEKRRYTILDAPGHKTYVPSMISGAAQADVALLVLSARKGEFETGFEREGQTREHAML 447

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
               G+ +LIV VNKMD T   +      +   K     K +G+NP   + F+P+S   G
Sbjct: 448 IKNNGINKLIVVVNKMDDTTVQWDKGRYDEITTKITPFLKAVGFNPKTDITFIPVSAQIG 507

Query: 617 DNM 625
           +NM
Sbjct: 508 ENM 510



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 32/63 (50%), Positives = 46/63 (73%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K+H+NI+  GHVD+GKST  G L+Y  G +DKRT+EK+E+EA+  G+ ++  +W LD  K
Sbjct: 313 KSHLNIIFTGHVDAGKSTMGGQLLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGK 372

Query: 217 AER 225
            ER
Sbjct: 373 EER 375


>UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces
           cerevisiae YKR084c HBS1; n=5; Saccharomycetales|Rep:
           Similar to sp|P32769 Saccharomyces cerevisiae YKR084c
           HBS1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 600

 Score =  109 bits (261), Expect = 9e-23
 Identities = 56/129 (43%), Positives = 82/129 (63%), Gaps = 1/129 (0%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C+  FET     T IDAPGH+DF+  MI+G SQAD A+L++ + TGEFE+G + +GQT+E
Sbjct: 235 CATNFETETSRFTAIDAPGHKDFVPQMISGVSQADFALLVIDSITGEFESGFTMDGQTKE 294

Query: 428 HALLAFTLGVKQLIVGVNKMDSTE-PPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPIS 604
           H +LA  LG+ +L V VNKMD          D++    ++  T   IG++   + FVPIS
Sbjct: 295 HTILAKNLGIARLCVVVNKMDKENWSERRFEDIKFQMTEF-LTGSDIGFSSDQIDFVPIS 353

Query: 605 GWHGDNMLE 631
           G  G+N+++
Sbjct: 354 GLTGNNVVK 362



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/63 (46%), Positives = 44/63 (69%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H + VVIGHVD+GKST  G L++  G ID +T+    ++++++GKGSF  AW++D+  
Sbjct: 164 KPHKSFVVIGHVDAGKSTLMGRLLFDLGVIDAKTVNNLVRQSEKIGKGSFALAWIMDQTS 223

Query: 217 AER 225
            ER
Sbjct: 224 EER 226


>UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Euplotes|Rep: Eukaryotic release factor 3
           GTPase subunit - Euplotes aediculatus
          Length = 805

 Score =  108 bits (259), Expect = 2e-22
 Identities = 55/129 (42%), Positives = 77/129 (59%), Gaps = 1/129 (0%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           ET     TI DAPGH++++ +MI G + AD A L+++A  GEFEAG  ++GQTREHA LA
Sbjct: 383 ETPTKRYTIFDAPGHKNYVPDMIMGAAMADVAALVISARKGEFEAGFERDGQTREHAQLA 442

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRK-SRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
            +LGV +L+V VNKMD     +             P   ++ GY    + F+PISG +G 
Sbjct: 443 RSLGVSKLVVVVNKMDEETVQWNEARYNDIVSGVTPFLIEQCGYKREDLIFIPISGLNGQ 502

Query: 620 NMLELQPKC 646
           N+ +L P C
Sbjct: 503 NIEKLTPAC 511



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 26/53 (49%), Positives = 41/53 (77%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 207
           ++V IGHVD+GKST  G+L++  G +D+RT EKF++EA+E  + S+  A+V+D
Sbjct: 311 SLVFIGHVDAGKSTICGNLMFMTGMVDERTTEKFKQEAKEKNRDSWWLAYVMD 363


>UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 581

 Score =  108 bits (259), Expect = 2e-22
 Identities = 54/128 (42%), Positives = 81/128 (63%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C+  FET     T IDAPGH+DF+  MI G SQAD A+L+V + TGEFEAG + +GQT+E
Sbjct: 216 CATDFETPTTRFTAIDAPGHKDFVPQMIGGVSQADLALLVVDSITGEFEAGFAMDGQTKE 275

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           H +LA  LG++++ V VNK+D  +      +  K++     T  ++ +    + FVPISG
Sbjct: 276 HTILAKNLGIERICVAVNKLDKEDWNEERFESIKTQLTEYLTSDEVQFAEEQIDFVPISG 335

Query: 608 WHGDNMLE 631
             G+N+++
Sbjct: 336 LSGNNVVK 343



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H + VVIGHVD+GKST  G +++  G +D RT+ +  KEA+  GKGSF  AW++D+  
Sbjct: 145 KPHKSFVVIGHVDAGKSTLMGRILFDYGIVDARTVNRLVKEAENAGKGSFALAWIMDQTA 204

Query: 217 AER 225
            ER
Sbjct: 205 EER 207


>UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 965

 Score =  107 bits (258), Expect = 2e-22
 Identities = 57/122 (46%), Positives = 75/122 (61%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F T     T++DAPGHRDFI NMI+G +QAD A+L+V +  G FEAG   NGQTREHALL
Sbjct: 602 FSTQHRTFTLLDAPGHRDFIPNMISGAAQADSALLVVDSIQGAFEAGFGPNGQTREHALL 661

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGV+QL+V VNK+D+    Y      +   K        G++ A + FVP  G  G+
Sbjct: 662 VRSLGVQQLVVVVNKLDAV--GYSQERYDEIVGKVKPFLMSCGFDAAKLRFVPCGGSVGE 719

Query: 620 NM 625
           N+
Sbjct: 720 NL 721



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +1

Query: 4   VIRD*PKMGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           +I +  K  +E K  +++VV+GHVD+GKST  G ++ + G + +R     E+ +Q++GKG
Sbjct: 515 IIEEYRKREREGKAELSLVVVGHVDAGKSTLMGRMLLELGSLSQREYSTNERASQKIGKG 574

Query: 181 SFKYAWVLDKLKAERE 228
           SF YAW LD  + ERE
Sbjct: 575 SFAYAWALDSSEEERE 590


>UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 957

 Score =  107 bits (258), Expect = 2e-22
 Identities = 55/127 (43%), Positives = 81/127 (63%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           + +F T     TI+DAPGHRDF+ NMI G SQAD AVL++ A TG FE+G+   GQT+EH
Sbjct: 493 TNRFATENTNFTILDAPGHRDFVPNMIAGASQADFAVLVLDATTGNFESGL--RGQTKEH 550

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGW 610
           ALL  ++GV++++V VNKMD+    +   D  + +++        G+    ++FVP SG 
Sbjct: 551 ALLVRSMGVQRIVVAVNKMDAAGWSHDRFD--EIQQQTASFLTTAGFQAKNISFVPCSGL 608

Query: 611 HGDNMLE 631
            GDN+ +
Sbjct: 609 RGDNVAQ 615



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 35/65 (53%), Positives = 47/65 (72%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           + K   N VVIGHVD+GKST  G L+Y+   +D+RTI++++KEA  +GKGSF  AWVLD+
Sbjct: 419 ERKKAANFVVIGHVDAGKSTLMGRLLYELKAVDQRTIDRYQKEADRIGKGSFALAWVLDQ 478

Query: 211 LKAER 225
              ER
Sbjct: 479 GSEER 483


>UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1,
           subunit alpha; n=1; Halorubrum lacusprofundi ATCC
           49239|Rep: Translation elongation factor EF-1, subunit
           alpha - Halorubrum lacusprofundi ATCC 49239
          Length = 540

 Score =  107 bits (258), Expect = 2e-22
 Identities = 57/126 (45%), Positives = 78/126 (61%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           ++F+T  YY TI+D PGHRDF+KNMITG SQAD AVL+VAA     + G++   QTREH 
Sbjct: 196 QEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAA-----DDGVAP--QTREHV 248

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            LA TLG+ ++I+GVNKMD  +  Y      +   +      ++ +      FVPIS + 
Sbjct: 249 FLARTLGINEIIIGVNKMDLVD--YKESSYDQVVEEVNDLLNQVRFATDDTTFVPISAFE 306

Query: 614 GDNMLE 631
           GDN+ E
Sbjct: 307 GDNISE 312



 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 31/65 (47%), Positives = 46/65 (70%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K H N+ +IGHVD GKST  G L+++ G + +  IE+  +EA+E GKG F++A+V+D L
Sbjct: 122 DKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVMDNL 181

Query: 214 KAERE 228
             ERE
Sbjct: 182 AEERE 186


>UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           guanine nucleotide regulatory protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 488

 Score =  107 bits (257), Expect = 3e-22
 Identities = 56/122 (45%), Positives = 74/122 (60%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGHR F+ NMI+  +QAD AVLIV+A  GEFE G  K GQTREH+ L
Sbjct: 134 FETEKRRYTILDAPGHRSFVPNMISAAAQADIAVLIVSARKGEFETGFDKGGQTREHSQL 193

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             T GVK +I+ VNKMD     +      +   K     ++ G++   +  +PISG+ G 
Sbjct: 194 CRTAGVKTVIIAVNKMDEKTVGWEKSRYDEIVNKVKPFLRQCGFSD--IYSIPISGFSGL 251

Query: 620 NM 625
           N+
Sbjct: 252 NL 253



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 29/63 (46%), Positives = 50/63 (79%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K   NI+ IGHVD+GKSTT+G+++++ G I++R I+KFEKEA+E  + S+  A+++D+++
Sbjct: 59  KESANIIFIGHVDAGKSTTSGNILFQSGNIEQRIIDKFEKEAKENQRESWWLAYIMDQIE 118

Query: 217 AER 225
            E+
Sbjct: 119 EEK 121


>UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6;
           Eukaryota|Rep: EF-1 alpha-like protein - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 513

 Score =  107 bits (257), Expect = 3e-22
 Identities = 61/151 (40%), Positives = 85/151 (56%), Gaps = 25/151 (16%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK------- 409
           +++F T+ ++ T+IDAPGH+DFIKNMI+G SQAD A+L+V A  G FEA I K       
Sbjct: 91  TKEFHTTNFHYTVIDAPGHKDFIKNMISGASQADVALLMVPAKKGGFEAAIQKGEGGDAA 150

Query: 410 -NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGY----- 571
             GQTR HA L   LG++Q+IVGVNKMD     Y     ++ ++      K+ G+     
Sbjct: 151 NKGQTRHHAELTKLLGIQQIIVGVNKMDEKSVKYDQARYKEIKKNMLSMLKQSGWKINGK 210

Query: 572 ------------NPAAVAFVPISGWHGDNML 628
                        P  +  +PISGW GDN++
Sbjct: 211 LTKELKEAGKKKGPNLIPVIPISGWCGDNLI 241



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 32/65 (49%), Positives = 48/65 (73%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K H+ +V++GHVD+GKSTTTGHL+++ G +D+R       +A+EM K SF +A+ +DK 
Sbjct: 18  DKPHLGVVIVGHVDAGKSTTTGHLLFELGTMDERAKADLIAKAKEMKKESFAFAFFMDKQ 77

Query: 214 KAERE 228
           K ERE
Sbjct: 78  KEERE 82


>UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p -
           Drosophila melanogaster (Fruit fly)
          Length = 670

 Score =  107 bits (257), Expect = 3e-22
 Identities = 55/123 (44%), Positives = 76/123 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQTREHA+
Sbjct: 319 RIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQTREHAI 378

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V +NK+D+    +      +   K     K  G+  + V+F P SG  G
Sbjct: 379 LVRSLGVNQLGVVINKLDTV--GWSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTG 436

Query: 617 DNM 625
           +N+
Sbjct: 437 ENL 439



 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 214 KAER 225
             ER
Sbjct: 304 GEER 307


>UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep:
           ADR221Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 614

 Score =  107 bits (257), Expect = 3e-22
 Identities = 51/128 (39%), Positives = 80/128 (62%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C+ +FET+K   T+IDAPGHRDF+ N +TG + AD A++ +   T  FE+G + +GQTRE
Sbjct: 246 CTSEFETAKSTFTVIDAPGHRDFVPNAVTGVNLADVAIVTIDCATDAFESGFNLDGQTRE 305

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           H +LA +LGVK +I+ +NKMD+ E  +     +  R +     + IG+     ++VP SG
Sbjct: 306 HIILARSLGVKHIILAMNKMDTVE--WHEGRFKAIRLELLSFLEDIGFKEPQTSWVPCSG 363

Query: 608 WHGDNMLE 631
             G+ + +
Sbjct: 364 LTGEGVYQ 371



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           ++K H++ VV+GHVD+GKST  G L+Y  G +D + I + ++E++  GKGSF  AWV+D+
Sbjct: 173 EKKPHMSFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRQLKRESELAGKGSFHLAWVMDQ 232

Query: 211 LKAER-EXVSQSILLSE 258
              ER   V+  I  SE
Sbjct: 233 TNEERARGVTVDICTSE 249


>UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;
           n=2; Saccharomyces cerevisiae|Rep: Elongation factor 1
           alpha-like protein - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 611

 Score =  106 bits (254), Expect = 6e-22
 Identities = 52/130 (40%), Positives = 78/130 (60%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C+  F T +   TI+DAPGHRDF+ N I G SQAD A+L V   T  FE+G   +GQT+E
Sbjct: 236 CTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKE 295

Query: 428 HALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
           H LLA +LG+  LI+ +NKMD+ +  +      + + K       IG+    + +VPISG
Sbjct: 296 HMLLASSLGIHNLIIAMNKMDNVD--WSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISG 353

Query: 608 WHGDNMLELQ 637
           + G+ + +++
Sbjct: 354 FSGEGVYKIE 363



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query: 43  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 222
           H++ VV+GHVD+GKST  G L+Y    +++  + K ++E++ MGK SFK+AW++D+   E
Sbjct: 167 HLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEE 226

Query: 223 RE-XVSQSILLS 255
           RE  V+ SI  S
Sbjct: 227 RERGVTVSICTS 238


>UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score =  106 bits (254), Expect = 6e-22
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG  + GQTREHA+L
Sbjct: 311 FETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGFERGGQTREHAVL 370

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKI-GYNPAA-VAFVPISGWH 613
           A T G+  L+V +NKMD     +     ++   K     +++ GYN    V ++P+S + 
Sbjct: 371 ARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKYMPVSAYT 430

Query: 614 GDNM 625
           G N+
Sbjct: 431 GQNV 434



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 35/64 (54%), Positives = 47/64 (73%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 217 AERE 228
            ERE
Sbjct: 296 EERE 299


>UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O22.4
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 615

 Score =  105 bits (253), Expect = 8e-22
 Identities = 60/125 (48%), Positives = 72/125 (57%), Gaps = 3/125 (2%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT--GEFEAGISKNGQTREHA 433
           FET     TI+DAPGH+ ++ NMI+G SQAD  VL+    T  GEFE G  + GQTREH 
Sbjct: 210 FETESTRFTILDAPGHKSYVPNMISGASQADIGVLVSQLITRKGEFETGYERGGQTREHV 269

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGW 610
            LA TLGV +LIV VNKMD     +      +  +K     K  GYN    V F+PISG 
Sbjct: 270 QLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVVFLPISGL 329

Query: 611 HGDNM 625
            G NM
Sbjct: 330 MGKNM 334



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 28/64 (43%), Positives = 46/64 (71%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 118 KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 177

Query: 214 KAER 225
           + ER
Sbjct: 178 EEER 181


>UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Trichomonas vaginalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Trichomonas vaginalis
          Length = 587

 Score =  105 bits (253), Expect = 8e-22
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET++   TI+DAPGHR ++  MI G  QAD AVL+++A  GEFEAG    GQT EH L+
Sbjct: 235 FETAQNKYTILDAPGHRSYVPQMIGGAVQADVAVLVISARNGEFEAGFENGGQTSEHLLI 294

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKY-PHTFKKIGYNPAAVAFVPISGWHG 616
           A T GV+++I+ VNKMD     +      +   K+ P   ++IG+      ++PI+   G
Sbjct: 295 ARTAGVREIIIVVNKMDDPTVKWSKERFDQIVTKFTPFIEREIGFKKDQYTYIPIAALTG 354

Query: 617 DNMLELQPKC 646
            N+ +   +C
Sbjct: 355 FNLKQRSNEC 364



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 33/63 (52%), Positives = 49/63 (77%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H NIV IGHVD+GKST  GH++Y+ G +D+RTIE+++ E+ + G+GS+ ++WV+D  K
Sbjct: 160 KKHFNIVFIGHVDAGKSTLCGHVLYQAGCVDQRTIEQYQAESAKEGRGSWYFSWVMDLSK 219

Query: 217 AER 225
            ER
Sbjct: 220 EER 222


>UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative;
           n=8; Trypanosomatidae|Rep: Eukaryotic release factor 3,
           putative - Leishmania major
          Length = 763

 Score =  105 bits (252), Expect = 1e-21
 Identities = 53/127 (41%), Positives = 80/127 (62%), Gaps = 3/127 (2%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K  VT++DAPGH+ F+ +MI G +QAD  VL++++ TGEFE G  K GQTREHA+L
Sbjct: 399 FETEKRRVTVLDAPGHKAFVPSMIGGATQADICVLVISSRTGEFETGFEKGGQTREHAML 458

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA---VAFVPISGW 610
             T GVKQ+I  +NKMD  E  +      +   +     ++ GY+      + F+P++G 
Sbjct: 459 VRTCGVKQMICVINKMD--EMKWSKERYSEIVGRLKPFLRQNGYDEERAKNLIFMPVAGL 516

Query: 611 HGDNMLE 631
            G+N+++
Sbjct: 517 TGENLIK 523



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/63 (44%), Positives = 44/63 (69%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           + H NIV  GHVD+GKST +GHL+ + G +D+R +EK  +EA+   +  ++YA+V+D  +
Sbjct: 324 RPHFNIVFCGHVDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSE 383

Query: 217 AER 225
            ER
Sbjct: 384 EER 386


>UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 630

 Score =  105 bits (252), Expect = 1e-21
 Identities = 51/125 (40%), Positives = 78/125 (62%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +FET     TI+DAPGH+DF+ NMI G SQAD A+L++ A  G +E G+   GQT+EHA 
Sbjct: 351 RFETESTIFTILDAPGHQDFVPNMIAGASQADFAILVIDATVGAYERGL--KGQTKEHAQ 408

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  ++GV ++IV VNK+D+T   +      +           +G+    ++F+P+SG +G
Sbjct: 409 LIRSIGVSRIIVAVNKLDATN--WSQDRFNEISDGMSGFMSALGFQMKNISFIPLSGLNG 466

Query: 617 DNMLE 631
           DNM++
Sbjct: 467 DNMVK 471



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 34/64 (53%), Positives = 44/64 (68%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K + + VV+GHVD+GKST  G L+     +D RTI K++KEA+ MGKGSF  AWVLD  
Sbjct: 276 KKKNASFVVVGHVDAGKSTMMGRLLLDMNVVDDRTISKYKKEAEAMGKGSFALAWVLDST 335

Query: 214 KAER 225
             ER
Sbjct: 336 SDER 339


>UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 914

 Score =  105 bits (251), Expect = 1e-21
 Identities = 53/124 (42%), Positives = 72/124 (58%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F T     T++DAPGHRDFI  MI+G +QAD A+L++    GEFEAG  + GQTREHA L
Sbjct: 556 FVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGEFEAGFERGGQTREHAWL 615

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGVK++IVGVNKMD     +      +            G+N     F+P++   G 
Sbjct: 616 VRSLGVKEIIVGVNKMDLVS--WSQDRYEEIVESLKPFLLSAGFNSTKTTFLPLAAMEGI 673

Query: 620 NMLE 631
           N+L+
Sbjct: 674 NILD 677



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/64 (40%), Positives = 45/64 (70%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K +++++V+GHVD+GKST  G ++Y  G + ++     E+ ++++GKGSF +AW LD L 
Sbjct: 481 KKNVSLIVVGHVDAGKSTLMGRVLYDIGELSEKEKIANERGSKKLGKGSFAFAWGLDALG 540

Query: 217 AERE 228
            ER+
Sbjct: 541 DERD 544


>UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 654

 Score =  105 bits (251), Expect = 1e-21
 Identities = 51/124 (41%), Positives = 79/124 (63%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K   TI+DAPGH+DFI NMI+G+SQAD  VL++ A T  FEAG+   GQT+EH L+
Sbjct: 316 FETEKTRFTILDAPGHKDFIPNMISGSSQADFPVLVIDASTNSFEAGL--KGQTKEHILI 373

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A ++G++ +IV VNKMD+    +  P      ++      +  +    + F+P++G  G+
Sbjct: 374 ARSMGMQHIIVAVNKMDTVS--WSKPRFDDISKRMKVFLTEASFPEKRITFIPLAGLTGE 431

Query: 620 NMLE 631
           N+++
Sbjct: 432 NVVK 435



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 29/59 (49%), Positives = 41/59 (69%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           N VV+GHVD GKST  G L+Y    +D+R+++K  KEA+ +GK SF  AW++D+   ER
Sbjct: 245 NFVVVGHVDHGKSTLMGRLLYDLKVVDQRSLDKLRKEAETIGKSSFALAWIMDETSEER 303


>UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=1; Sterkiella histriomuscorum|Rep: Eukaryotic
           release factor 3 GTPase subunit - Oxytricha trifallax
           (Sterkiella histriomuscorum)
          Length = 937

 Score =  103 bits (246), Expect = 6e-21
 Identities = 51/122 (41%), Positives = 72/122 (59%), Gaps = 1/122 (0%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           ET K   TI DAPGH++++ NMI G + AD   L+++A  GEFE+G    GQTREH  LA
Sbjct: 493 ETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEFESGFEMEGQTREHIQLA 552

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHGD 619
            +LG+ +++V VNKMD     +      +         +  GY+P   + FVPISG +GD
Sbjct: 553 KSLGISKIVVAVNKMDEPSVKWSKDRYTEIINGLKPFMQGCGYDPEKDIVFVPISGLNGD 612

Query: 620 NM 625
           N+
Sbjct: 613 NL 614



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/59 (45%), Positives = 46/59 (77%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           ++V IGHVD+GKST +G+L+Y  G +D+RTI+K+++EA+E  + S+  A+V+D  + E+
Sbjct: 421 SLVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKEKNRESWWLAYVMDVSEEEK 479


>UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 840

 Score =  103 bits (246), Expect = 6e-21
 Identities = 52/130 (40%), Positives = 79/130 (60%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           +R+FET     TI+DAPGH ++I NMI G SQAD A+L++ A    FE+G+   GQTREH
Sbjct: 503 TRRFETEHTAFTILDAPGHAEYIYNMIAGASQADFAILVIDASIDAFESGL--KGQTREH 560

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGW 610
           +LL  ++GV ++IV VNK+D+    +      + + +         +    +AFVP+SG 
Sbjct: 561 SLLIRSMGVSRIIVAVNKLDTV--AWSQERFSEIKDQMSGFLSTANFQHKNMAFVPVSGL 618

Query: 611 HGDNMLELQP 640
           +GDN++   P
Sbjct: 619 NGDNLVHRSP 628



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/65 (52%), Positives = 44/65 (67%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           K K   + VV+GHVD+GKST  G L+     +D+RTI+K +KEA+  GKGSF  AWVLD+
Sbjct: 429 KPKKSASFVVVGHVDAGKSTMMGRLLLDLKVVDQRTIDKLQKEAKTEGKGSFGLAWVLDQ 488

Query: 211 LKAER 225
              ER
Sbjct: 489 RPEER 493


>UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2;
           Dictyostelium discoideum|Rep: Eukaryotic release factor
           3 - Dictyostelium discoideum (Slime mold)
          Length = 557

 Score =  101 bits (243), Expect = 1e-20
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 1/124 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET+K   TI+DAPGHR ++ NMI G +QAD  +L++++  GEFEAG+ + GQT EHA L
Sbjct: 190 FETTKKRYTILDAPGHRLYVPNMIIGAAQADVGILVISSKKGEFEAGV-EGGQTIEHARL 248

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A  +G+K L+V VNKMD     +      +   K     KK G+NP     FVP SG+  
Sbjct: 249 AKMIGIKYLVVFVNKMDEPTVKWSKARYDEITDKLTVHLKKCGWNPKKDFHFVPGSGYGT 308

Query: 617 DNML 628
            N+L
Sbjct: 309 LNVL 312



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 26/63 (41%), Positives = 44/63 (69%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           + H+NIV +GHVD+GKST +G ++   G +D  T+ K+E+EA+E  +  + YA+++D  +
Sbjct: 115 REHLNIVFLGHVDAGKSTLSGSIMVLTGQVDPHTLAKYEREAKENHREGWIYAYIMDTNE 174

Query: 217 AER 225
            ER
Sbjct: 175 EER 177


>UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Brugia pahangi (Filarial nematode worm)
          Length = 123

 Score =  101 bits (242), Expect = 2e-20
 Identities = 46/51 (90%), Positives = 47/51 (92%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 177
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE +   K
Sbjct: 23  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKERKRWAK 73


>UniRef50_O74774 Cluster: Elongation factor 1 alpha related protein;
           n=1; Schizosaccharomyces pombe|Rep: Elongation factor 1
           alpha related protein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 592

 Score =  100 bits (240), Expect = 3e-20
 Identities = 56/129 (43%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           S  FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE G  +NGQTREH
Sbjct: 247 STTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREH 306

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTF--KKIGYNPAAVAFVPIS 604
           A L   LG+ +++V VNK+D       S D  +  +     F  K +G+  + V FVPIS
Sbjct: 307 AYLLRALGISEIVVSVNKLDLMS---WSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPIS 363

Query: 605 GWHGDNMLE 631
              G N+++
Sbjct: 364 AISGTNLIQ 372



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 217 AER 225
            ER
Sbjct: 235 EER 237


>UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),
           putative; n=3; Trypanosoma|Rep: Elongation factor
           1-alpha (EF-1-alpha), putative - Trypanosoma cruzi
          Length = 664

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 55/131 (41%), Positives = 76/131 (58%), Gaps = 1/131 (0%)
 Frame = +2

Query: 245 YCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 424
           YC   FET    + I+DAPGH+D++ NMI+  +QAD A+L+V A T EFE G++    T+
Sbjct: 318 YC---FETEHRRINILDAPGHKDYVLNMISSATQADAALLVVTAATSEFEVGLAHG--TK 372

Query: 425 EHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGY-NPAAVAFVPI 601
           EH  +  TL V +LIV VNKMD+ +  Y         R+     K+I Y   A V F P+
Sbjct: 373 EHLFILKTLSVGRLIVAVNKMDTVD--YSKERYDYVVRELKFLLKQIRYKEEAVVGFCPV 430

Query: 602 SGWHGDNMLEL 634
           SG  G N+L +
Sbjct: 431 SGMQGTNILHV 441



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 33/63 (52%), Positives = 43/63 (68%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K     V+ GHVD+GKSTT GHL+   G + +  IEK EK A+++  GSFKYAWVLD+ +
Sbjct: 245 KRDCTFVIAGHVDAGKSTTLGHLLLLLGKVSQSEIEKNEKNARQLNSGSFKYAWVLDQSE 304

Query: 217 AER 225
            ER
Sbjct: 305 EER 307


>UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 600

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 48/123 (39%), Positives = 72/123 (58%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           +T    +T +DAPGH+DF+ NMI G +QAD A+L++      FE G    GQT+EHA L 
Sbjct: 252 QTKNKNITFLDAPGHKDFVPNMIQGVTQADYALLVIEGSLQAFERGFEFGGQTKEHAFLV 311

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDN 622
             LGV++LIV +NKMD+    +        + +       IGY+   + FVPIS ++ +N
Sbjct: 312 KQLGVQRLIVLINKMDTVN--WDRNRFEYIKLELTRFLTSIGYSEDNLIFVPISAFYAEN 369

Query: 623 MLE 631
           ++E
Sbjct: 370 IVE 372



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 32/62 (51%), Positives = 47/62 (75%)
 Frame = +1

Query: 43  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 222
           ++N+V++GHVDSGKST  GHL +    ID++   K EKE++ +GK SFK+AWV D+ +AE
Sbjct: 178 NMNLVIVGHVDSGKSTLVGHLCHLKKVIDQKLAHKNEKESKNIGKESFKFAWVNDEFEAE 237

Query: 223 RE 228
           R+
Sbjct: 238 RQ 239


>UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha;
           n=7; Fungi/Metazoa group|Rep: Translation elongation
           factor 1 alpha - Fusarium sp. CBS 100485
          Length = 61

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 42/45 (93%), Positives = 44/45 (97%)
 Frame = +1

Query: 94  TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           TGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAERE
Sbjct: 1   TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERE 45


>UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha;
           n=1; Phellopilus nigrolimitatus|Rep: Translation
           elongation factor 1 alpha - Phellopilus nigrolimitatus
          Length = 134

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 49/74 (66%), Positives = 59/74 (79%), Gaps = 2/74 (2%)
 Frame = +2

Query: 350 DCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE--PPYVSPDL 523
           DCA+LI+A GTGEFEAGISK+GQTREHALLAFTLGV+QLIV VNKMD+T   P  VS  L
Sbjct: 1   DCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTTNGGPRAVSARL 60

Query: 524 RKSRRKYPHTFKKI 565
            K   K+P + +++
Sbjct: 61  SK---KHPTSSRRL 71



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 555 SRRLATTQLLSLSCPFLDGTETTCW-SFNQNALVQGMGRWSVR*GQADGKCLIEALDAI 728
           SRRL TT+ L  S  F  GT TTCW S       +G  +   + G   GK L++A+DAI
Sbjct: 68  SRRLVTTRRLLPSFRFRAGTVTTCWKSLPSMPWYKGWTK-ETKAGVVKGKTLLDAIDAI 125


>UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;
           n=1; Yarrowia lipolytica|Rep: Similar to tr|Q9WTY5 Mus
           musculus ERFS - Yarrowia lipolytica (Candida lipolytica)
          Length = 518

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 50/126 (39%), Positives = 76/126 (60%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           +E+ +Y+  I+DAPGH +F+ NMI G SQAD A++++ +    FE G   +GQT+EHALL
Sbjct: 151 YESREYF--ILDAPGHYNFVPNMIAGASQADVAIVVLDSLADAFERGFFADGQTKEHALL 208

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
              +GV  +I+ VNKMD  +  +      +   +      KIGY+   V FVP SG+ G 
Sbjct: 209 CRAMGVNHVIIAVNKMDQLK--FDQTRFDEISDQMGLFLSKIGYSD--VQFVPCSGFTGA 264

Query: 620 NMLELQ 637
           N+++ Q
Sbjct: 265 NIVKKQ 270



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 29/61 (47%), Positives = 40/61 (65%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +N V +GHVD+GKST  G L++  G +    +EK  K A E+GK SF YAW++D+   ER
Sbjct: 77  LNAVAVGHVDAGKSTLLGRLLHDTGVVSSHQVEKLAKSASEIGKKSFSYAWLMDQTDEER 136

Query: 226 E 228
           E
Sbjct: 137 E 137


>UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 756

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 43/81 (53%), Positives = 58/81 (71%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F T +    + DAPGH++++ NMI G  QAD A LIV+A TGEFE+G  K GQT+EHAL
Sbjct: 400 QFVTKQKRFILADAPGHKNYVPNMIMGACQADLAGLIVSAKTGEFESGFEKGGQTQEHAL 459

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA +LGV  +I+ V KMD+ +
Sbjct: 460 LAKSLGVDHIIIIVTKMDTID 480



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 24/61 (39%), Positives = 43/61 (70%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +N+V IGHVD+GKST  G L+ + G + +  I+K+E+EA +  + S+  A+V+D+ + E+
Sbjct: 329 VNLVFIGHVDAGKSTLCGRLLLELGEVSEADIKKYEQEAVQNNRDSWWLAYVMDQNEEEK 388

Query: 226 E 228
           +
Sbjct: 389 Q 389


>UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA;
           n=1; Encephalitozoon cuniculi|Rep: TRANSLATION
           ELONGATION FACTOR 1-ALPHA - Encephalitozoon cuniculi
          Length = 424

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 48/124 (38%), Positives = 68/124 (54%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FE     V I+DAPGH  F+  MI G ++AD  +L+V+A   EFEAG  K GQTREH  L
Sbjct: 86  FELPHRRVNILDAPGHNQFVFEMINGANRADVGILVVSARINEFEAGFEKGGQTREHIFL 145

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
                V++LIV VNKMD     +      + + K     +++   P    F+P+SG+ G+
Sbjct: 146 LKAGSVQRLIVLVNKMDDPSVEWRKERFDEIKTKVGAFVRRMFPTP---VFIPVSGFTGE 202

Query: 620 NMLE 631
            + E
Sbjct: 203 YIKE 206



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 28/64 (43%), Positives = 42/64 (65%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  INIV +GHVD+GKST  G ++ + G +D RT+EK+ + ++E  + S+  +W LD   
Sbjct: 11  KKVINIVFVGHVDAGKSTICGQILVQMGLVDPRTLEKYRQMSREQNRESWYLSWCLDTNP 70

Query: 217 AERE 228
            ERE
Sbjct: 71  EERE 74


>UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 607

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 54/128 (42%), Positives = 68/128 (53%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET    +T++DAPGHRDF+ NMI G SQAD A+L+V       E      GQ  EH LL
Sbjct: 263 FETEDRKITVLDAPGHRDFVPNMIAGASQADSAILVVDVSNPNIE-----RGQAGEHILL 317

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
             +LGVK LIV +NKMDS E  Y+               K+I +  +AV F+P      D
Sbjct: 318 CRSLGVKHLIVAINKMDSLE--YMQSAYEDVCNTLTEHLKRISW--SAVHFIPTVA--TD 371

Query: 620 NMLELQPK 643
             + L PK
Sbjct: 372 KSVLLNPK 379



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 22/63 (34%), Positives = 43/63 (68%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H+N+V++GHVD+GKST  GH++     ++K+ ++K  ++++  G G    AW++ + +
Sbjct: 188 KKHVNLVIVGHVDAGKSTLIGHVLLLSNFVEKQRMDKIMEDSKATGHGQDYLAWIMAEDE 247

Query: 217 AER 225
           +ER
Sbjct: 248 SER 250


>UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 481

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 49/120 (40%), Positives = 67/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS----KNGQTREHALLAFT 448
           + ++DAPGH+DF+ N I+G SQAD  VL++    G FE G +      GQTREHA LA  
Sbjct: 125 LVVLDAPGHKDFVPNAISGASQADAGVLVIDGAMGGFENGFAATPGHTGQTREHARLARA 184

Query: 449 LGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPH-TFKKIGYNPAAVAFVPISGWHGDNM 625
           LG+  LIV +NKMD  E  Y     R       +     +G++   + FVP+SG  G N+
Sbjct: 185 LGLHSLIVVINKMDCVE--YGEERFRFVVDALQNFLIDDVGFSQEQLTFVPVSGIEGTNI 242



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 42/61 (68%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +++V++GHVD+GKST +G L+Y    +D R + K  ++++  GK SF +AWV+D    ER
Sbjct: 45  VHVVILGHVDAGKSTLSGRLMYALKAVDDRAMHKNVRDSKASGKSSFAWAWVMDCRPEER 104

Query: 226 E 228
           E
Sbjct: 105 E 105


>UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3;
           Endopterygota|Rep: Elongation factor-1 alpha -
           Xiphocentron sp. UMSP000029372-Costa Rica
          Length = 366

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 53/126 (42%), Positives = 69/126 (54%)
 Frame = +1

Query: 256 EVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL*ERSNP*ACL 435
           EVR+ QVL  HH  +  Q  HQEHDH +++G LR A R  R+R +R  +L ER +  A L
Sbjct: 33  EVRDGQVLRDHHRRARPQGLHQEHDHGHVAGGLRRADRGRRHRRVRGGHLQERPDARARL 92

Query: 436 ARFHPRCQTAHRRSKQNGFH*TTIREPRFEEIKKEVSSYIQEDWLQPSCCRFRAHFWMAR 615
           A  H R Q A RR +Q+G     ++       ++      QED LQP     RAH  +AR
Sbjct: 93  AGLHARRQAARRRRQQDGLDGAALQRAALRGDQEGGVVVHQEDRLQPGRRGVRAHLGLAR 152

Query: 616 RQHVGA 633
           RQH GA
Sbjct: 153 RQHAGA 158


>UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Leishmania|Rep: Hsp70 subfamily B suppressor 1 -
           Leishmania major strain Friedlin
          Length = 647

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 1/125 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET    V I+DAPGH+DF+ NMI+  +QAD A+L+V A   EFE G+     T+ H L+
Sbjct: 300 FETEHRRVHILDAPGHKDFVLNMISSATQADAALLVVTATNSEFETGLHHG--TKSHLLV 357

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGY-NPAAVAFVPISGWHG 616
             TLGV  ++V VNKMD+    Y         R+     K+      A + F PISG  G
Sbjct: 358 LKTLGVGSIVVAVNKMDAV--AYSQERYDYVVRELQLLLKQTRIPEEAIIGFCPISGMTG 415

Query: 617 DNMLE 631
            N+ +
Sbjct: 416 VNITQ 420



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/65 (47%), Positives = 42/65 (64%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           KEK     V+ GHVD+GKSTT GHL+   G +  + +E+ EK  +   K SFKYAW+LD+
Sbjct: 223 KEKPDCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKYAWLLDQ 282

Query: 211 LKAER 225
            + ER
Sbjct: 283 CEEER 287


>UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n=1;
           Monosiga brevicollis|Rep: Elongation factor 1 alpha
           short form - Monosiga brevicollis
          Length = 208

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 35/64 (54%), Positives = 51/64 (79%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H++IV+ GHVD+GKSTTTG LI++ GGI +R ++K + EA+ +GKGSF +A+ +D+ K
Sbjct: 5   KQHVSIVICGHVDAGKSTTTGRLIFELGGIPEREMQKLKDEAERLGKGSFAFAFYMDRQK 64

Query: 217 AERE 228
            ERE
Sbjct: 65  EERE 68



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +2

Query: 251 SRKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 346
           +++F T+  + T+IDAPGHRDFIKNMITG SQ
Sbjct: 77  TKEFFTATKHYTVIDAPGHRDFIKNMITGASQ 108


>UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n=3;
           Laurasiatheria|Rep: UPI0000F308E4 UniRef100 entry - Bos
           Taurus
          Length = 428

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 61/137 (44%), Positives = 73/137 (53%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R+F+TS+ YVTI DA  HRD         S       I  AG   FE  I + G+ RE A
Sbjct: 77  RQFKTSRGYVTITDASRHRD---------SHTQDGRRI--AG---FETQIRRAGRPRERA 122

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
           L   TLGVKQL V   K+DS +PP      RKS+    H  KK G+NP      P SGW+
Sbjct: 123 LHTHTLGVKQLSVSATKVDS-QPPCSQKKTRKSKEVSTHV-KKTGFNPDTACVSP-SGWN 179

Query: 614 GDNMLELQPKCLGSRDG 664
           GD+MLE +  C GS DG
Sbjct: 180 GDDMLESRTNC-GSGDG 195



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/64 (53%), Positives = 38/64 (59%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           K KT    ++ GHVD GKS TTGH IYKC GIDK   EK      E GKGSF+     D 
Sbjct: 3   KNKTRCVSIINGHVDLGKSPTTGHRIYKCDGIDKTATEK-RTRLPETGKGSFESISGSDT 61

Query: 211 LKAE 222
           L+AE
Sbjct: 62  LRAE 65


>UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 646

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 47/122 (38%), Positives = 72/122 (59%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F+ +     ++DAPGH++++ NMI G  QAD A LI++A  GEFEAG  + GQT+EHA L
Sbjct: 294 FQLANKRFVLLDAPGHKNYVPNMIAGACQADVAALIISARQGEFEAGF-EGGQTQEHAHL 352

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A  LGV+ +I  V+KMD         D      + P    ++G    ++ +VPI+G+  +
Sbjct: 353 AKALGVQHMICVVSKMDEVNWDKKRYDHIHDSVE-PFLRNQVGIQ--SIEWVPINGFLNE 409

Query: 620 NM 625
           N+
Sbjct: 410 NI 411



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           K+ +E+  +NIV IGHVD+GKST +G ++  CG +D+  I KFE EA+E  + S+  A++
Sbjct: 214 KVDRERDSVNIVFIGHVDAGKSTLSGRILKNCGEVDETEIRKFELEAKEKNRESWVLAYI 273

Query: 202 LDKLKAER 225
           +D  + ER
Sbjct: 274 MDINEEER 281


>UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha;
           n=3; Microsporidia|Rep: Translation elongation factor 1
           alpha - Antonospora locustae (Nosema locustae)
          Length = 478

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 42/126 (33%), Positives = 71/126 (56%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           ++F+  K+   IID PGH+DFIKN +TG +QAD AV +V A   +F A  S     ++H 
Sbjct: 78  KEFKLKKFNANIIDCPGHKDFIKNTVTGAAQADVAVALVPA--SDFAAATSPKATLKDHI 135

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
           +++  +G+K+LI+ VNKMD   P          +++     +++  +   +  +PISG  
Sbjct: 136 MISGVMGIKRLIICVNKMDEFPPEKQKEKFEWIKKEMLFISQRLHPDKDPI-IIPISGLK 194

Query: 614 GDNMLE 631
           G N+ +
Sbjct: 195 GINIAD 200



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M  +K ++N+ +IGHVDSGKSTT G+L Y+ G  D+R + K + EA   GKG+F YA+  
Sbjct: 1   MEGKKPNLNVCIIGHVDSGKSTTMGNLAYQLGVFDQRQLTKLKAEADSHGKGTFAYAYFF 60

Query: 205 DKLKAERE-XVSQSILLSEVR 264
           D   AER+  ++  I L E +
Sbjct: 61  DNTAAERKRGITIDITLKEFK 81


>UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate
           adenylyltransferase subunit 1; n=5; Bacteria|Rep:
           Adenylylsulfate kinase/sulfate adenylyltransferase
           subunit 1 - Desulfitobacterium hafniense (strain Y51)
          Length = 614

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 46/122 (37%), Positives = 74/122 (60%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F+T K    IIDAPGH +F+KNM+TG S+A+ A+L++ A     + GI +N  ++ H  +
Sbjct: 94  FKTGKRDYIIIDAPGHIEFLKNMVTGASRAEAALLVIDA-----KEGIREN--SKRHGHI 146

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A  LG++Q++V VNKMD  +  +        RR++     K+   P  V F+P+S ++GD
Sbjct: 147 AAMLGIRQVVVLVNKMDLVD--FDRQTFETIRREFGEFLHKLNIQP--VNFIPLSAFNGD 202

Query: 620 NM 625
           N+
Sbjct: 203 NI 204



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/77 (33%), Positives = 46/77 (59%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           +  +NIV++GHVD GKST  G L+   G + +  +E  ++  ++  +  F+YA++LD LK
Sbjct: 20  REQMNIVIVGHVDHGKSTVIGRLLADTGSLPEGKLEAVQEYCRKNAR-PFEYAFLLDALK 78

Query: 217 AEREXVSQSILLSEVRN 267
            E+   +Q I +   R+
Sbjct: 79  DEQ---AQGITIDTARS 92


>UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus
           mobilis|Rep: ORFC 179 - Desulfurococcus mobilis
          Length = 179

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 48/78 (61%), Positives = 50/78 (64%)
 Frame = -2

Query: 489 SILFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVPVIMFLMKS 310
           SILF  T++   P V AS ACSRV P   IPASNSP  A T   A SA   PVIMFL KS
Sbjct: 3   SILFIATINWFIPMVLASIACSRVWPSALIPASNSPFLALTTRIAASAWLAPVIMFLTKS 62

Query: 309 LCPGASMMVT*YLLVSNF 256
           L PGASMMV  Y  VSNF
Sbjct: 63  LWPGASMMVKKYFFVSNF 80



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 27/59 (45%), Positives = 33/59 (55%)
 Frame = -3

Query: 227 SRSAFSLSNTQAYLKDPLPISWASFSNFSMVRLSIPPHL*IK*PVVVDLPESTCPMTTM 51
           SRS+F LS++ A LK  LPI   S S    V  S  P      PV+V LP STCP+ T+
Sbjct: 91  SRSSFILSSSHANLKLSLPIFLDSSSIIFTVFSSKYPRRYSMCPVIVLLPWSTCPIITI 149


>UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia
           intestinalis|Rep: GLP_56_7099_8961 - Giardia lamblia
           ATCC 50803
          Length = 620

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 37/73 (50%), Positives = 49/73 (67%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V + D PGHRDF+ ++I   SQ D AVL++ A   EFE G+S +GQTREH  L    GVK
Sbjct: 233 VFLQDCPGHRDFVPSLIRAVSQPDAAVLVLDASPKEFEKGLSDDGQTREHLQLLMIFGVK 292

Query: 461 QLIVGVNKMDSTE 499
            ++V VNK+D T+
Sbjct: 293 HIMVAVNKLDRTD 305



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           K +  IN++V+GHVD+GKST  GHL    G +  R   + +  A    K +F YA++LD 
Sbjct: 139 KSRNTINVLVVGHVDAGKSTIFGHLAVLSGSVSMRERTRTQALADTYNKSTFSYAFLLDT 198

Query: 211 LKAERE 228
              ER+
Sbjct: 199 NDEERQ 204


>UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1;
           Geobacter bemidjiensis Bem|Rep: Sulfate
           adenylyltransferase - Geobacter bemidjiensis Bem
          Length = 408

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 51/116 (43%), Positives = 65/116 (56%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           IID PGHR+FI+NM+TG S A  AVLIV A  G  E       QTR HA L   +G++++
Sbjct: 89  IIDTPGHREFIRNMVTGASYAKAAVLIVDAVEGVME-------QTRRHAWLLSIVGIQEI 141

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            V VNKMD+    Y S             F + G +PAA+  VPIS   GDN+ +L
Sbjct: 142 CVAVNKMDAV--AYSSDAFAALSVAVESLFTEFGLSPAAI--VPISARVGDNVAKL 193



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K+   I + GHVD GKST  G L+Y  G +     ++  + + E G+G  ++A+VLD  +
Sbjct: 6   KSAFPIAITGHVDHGKSTLIGRLLYDTGTLQSGRYQEMLQSSLETGRGD-EFAFVLDAFE 64

Query: 217 AER 225
            ER
Sbjct: 65  EER 67


>UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA;
           n=2; Apansporoblastina|Rep: TRANSLATION ELONGATION
           FACTOR 1 ALPHA - Encephalitozoon cuniculi
          Length = 505

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 37/75 (49%), Positives = 52/75 (69%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T K+ + I+D PGH+DF+KNM+TG SQAD AV+IV A    FE+ +   G  + H +++ 
Sbjct: 121 TEKFNINILDCPGHKDFVKNMVTGASQADVAVVIVPA--SGFESCVGVGGMLKTHIMISG 178

Query: 446 TLGVKQLIVGVNKMD 490
            LG ++LIV VNKMD
Sbjct: 179 ILGCEKLIVCVNKMD 193



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/64 (53%), Positives = 43/64 (67%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N   IGHVDSGKSTT G L Y+ G +DKR +EK+EKEA    K +F  A++ DK  
Sbjct: 44  KPRLNACFIGHVDSGKSTTVGMLSYQLGAVDKREMEKYEKEAALNNKETFYLAYLTDKTD 103

Query: 217 AERE 228
           AER+
Sbjct: 104 AERK 107


>UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 806

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 427 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 486

Query: 220 ERE 228
           ERE
Sbjct: 487 ERE 489



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/74 (31%), Positives = 40/74 (54%)
 Frame = +2

Query: 413 GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAF 592
           GQT+EHA L  + GV+QLIV VNKMD+    Y        + +     +   +  ++V +
Sbjct: 502 GQTKEHAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIKVQLGSFLRACNFKDSSVTW 559

Query: 593 VPISGWHGDNMLEL 634
           +P+S     N++++
Sbjct: 560 IPLSAVENQNLIKI 573


>UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=1895; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 437

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 38/83 (45%), Positives = 57/83 (68%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K + + +D PGH D+IKNMITG +Q D A+++VAA  G+         QTREH L
Sbjct: 105 EYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP-------QTREHLL 157

Query: 437 LAFTLGVKQLIVGVNKMDSTEPP 505
           LA  +GV+ ++V VNK+D+ + P
Sbjct: 158 LARQVGVQHIVVFVNKVDTIDDP 180



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 180
           + K H+NI  IGHVD GK+T T  +   +   GG +       +K  +E  +G
Sbjct: 44  RSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARG 96


>UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 432

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 42/124 (33%), Positives = 75/124 (60%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FE + +   I+D  GH++F+KN+I+G S+A   VLIVAA   E +    +  Q ++  +L
Sbjct: 80  FEMNNHNYEIVDIIGHKNFVKNIISGQSKAH-VVLIVAALQQERDEYDFQFEQIKQQLIL 138

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A +LGVKQ+IV +NK++     +   +    + +  +   +I +NP ++ ++P+SG  GD
Sbjct: 139 AQSLGVKQIIVALNKIEIVN--FSENEFTLMKNQIDNYLHEIKFNPESIFYIPVSGVKGD 196

Query: 620 NMLE 631
           N++E
Sbjct: 197 NLVE 200



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M K+K  INI+V+G  +SG+STT GH +YK      + ++ F   +Q   +    +   L
Sbjct: 1   MFKKKEIINIIVLGSTNSGRSTTVGHFLYKLSKECPQLLQYFNTTSQITEEKDIDFTIPL 60

Query: 205 DKLKAEREXVSQ 240
             L+ E E  S+
Sbjct: 61  KNLQFELERNSE 72


>UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep:
           SUP35 homolog - Pichia pastoris (Yeast)
          Length = 315

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 33/63 (52%), Positives = 48/63 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K HI+I+ +GHVD+GKST  G+L+Y  G +DKRTI+K+EKEA++ G+  +  +WV+D  K
Sbjct: 238 KDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMDTNK 297

Query: 217 AER 225
            ER
Sbjct: 298 EER 300


>UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12;
           Rhizobiales|Rep: NodQ bifunctional enzyme -
           Bradyrhizobium japonicum
          Length = 638

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 48/123 (39%), Positives = 66/123 (53%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F T+   + +IDAPGH +F++NMITG SQAD AVLI+ A  G          QTR H  
Sbjct: 91  RFRTNSRDIVLIDAPGHAEFLRNMITGASQADGAVLIIDALEG-------VRDQTRRHGY 143

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L   LGVKQ+ + VNKMD  +  + +   +    +       +G  P AV  +PIS   G
Sbjct: 144 LLHLLGVKQVAIVVNKMDRVD--FSADRFQAISDEISAHLNGLGVTPTAV--IPISARDG 199

Query: 617 DNM 625
           D +
Sbjct: 200 DGV 202



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/67 (32%), Positives = 40/67 (59%)
 Frame = +1

Query: 28  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 207
           G  +  + IV++GHVD GKST  G L+++ G +    +E  +  +   G   F+++++LD
Sbjct: 15  GTTRPQVRIVIVGHVDHGKSTLVGRLLHETGSLPDGKLEMLKAVSARRGM-PFEWSFLLD 73

Query: 208 KLKAERE 228
            L+ ER+
Sbjct: 74  ALQTERD 80


>UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 41/113 (36%), Positives = 64/113 (56%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D+PGH+DF   +I G +QAD A+L+V      FE  I K+G  RE   L   + +K++
Sbjct: 256 LLDSPGHQDFAPYLIAGAAQADYAILVVDTTKNAFENSI-KSGMLREKLQLISAMLIKEI 314

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNM 625
           +V +NKMD  +      D+ K   K   +  K+GYN   + F+PIS + G N+
Sbjct: 315 VVALNKMDQIDWDQKQFDVAKDYIKV--SAAKLGYNQKQIKFIPISAFQGLNI 365



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 25/60 (41%), Positives = 39/60 (65%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           +IV++GHVD+GKST TG L+     +D + + K +K+A+ +GK S   A+  D  K E+E
Sbjct: 176 SIVILGHVDTGKSTLTGRLLQVFKALDDKELRKNQKDAKNLGKESSALAYATDMTKEEKE 235


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 43/122 (35%), Positives = 73/122 (59%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F+T +    IIDAPGH +F+KNM+TG ++A+ A+L++ A     + G+ +N  ++ H  L
Sbjct: 92  FKTQERKYIIIDAPGHIEFLKNMVTGAARAEVALLVIDA-----KEGVKEN--SKRHGYL 144

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
              LG+KQ++V +NKMD  +  Y      +   +Y     +I  +  A +F+PISG+ G+
Sbjct: 145 LSMLGIKQVVVLINKMDLVD--YSKERYEEILAEYKAFLSEI--DVEAESFIPISGFKGE 200

Query: 620 NM 625
           N+
Sbjct: 201 NV 202



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/77 (36%), Positives = 49/77 (63%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +++++NIV++GHVD GKST  G L+   G + +  +E+ ++  ++  K  F+YA++LD L
Sbjct: 17  QQSNMNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKETCRKNAK-PFEYAFLLDAL 75

Query: 214 KAEREXVSQSILLSEVR 264
           K E+   SQ I +   R
Sbjct: 76  KDEQ---SQGITIDSAR 89


>UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain
           protein; n=1; Geobacter sulfurreducens|Rep: Elongation
           factor Tu GTP binding domain protein - Geobacter
           sulfurreducens
          Length = 516

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 1/123 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F TS+    IIDAPGH+ F+KNMITG + AD A+L+V    G  E       QT+ HA +
Sbjct: 78  FSTSRRRYVIIDAPGHKQFLKNMITGAASADAAILLVDGTEGVRE-------QTKRHAHV 130

Query: 440 AFTLGVKQLIVGVNKMDSTE-PPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
              LG++Q++V VNK+D  +       ++    R + H+   +   PA V  +PIS   G
Sbjct: 131 LSLLGIRQVVVAVNKLDMIDYDRQRFQEVENDIRAFLHSLHIV---PAHV--IPISAREG 185

Query: 617 DNM 625
           +NM
Sbjct: 186 ENM 188



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 40/67 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M + +T + IV++GHVD GKST  G L Y  G I +   ++     +  G+  F++A+++
Sbjct: 1   MSQSET-LKIVIVGHVDHGKSTLIGRLFYDTGSIPEARRQEIAATCKAQGR-PFEFAYLM 58

Query: 205 DKLKAER 225
           D L+ ER
Sbjct: 59  DALEEER 65


>UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;
           n=2; Proteobacteria|Rep: Putative ATP sulfurylase large
           subunit - Chromatium vinosum (Allochromatium vinosum)
          Length = 434

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 45/126 (35%), Positives = 64/126 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T      I DAPGH  + +NM+T  S A  A+++V A  G          QTR H+
Sbjct: 85  RYFSTGTRKYIIADAPGHEQYTRNMVTAASTAHLAIILVDARRG-------VQTQTRRHS 137

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            LA  +G+  L+V VNKMD  +  Y      + R +Y     ++G     V F+P+S  H
Sbjct: 138 YLAHLVGLPHLVVAVNKMDLVD--YDQAVFERIRAEYLDFAARLGIED--VRFIPLSALH 193

Query: 614 GDNMLE 631
           GDN++E
Sbjct: 194 GDNVVE 199



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 20/61 (32%), Positives = 28/61 (45%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +  +  G VD GKST  G L+Y    I   T+      +Q  G      + + D L+AER
Sbjct: 15  LRFLTCGSVDDGKSTLIGRLLYDTKAILADTLHAIAATSQRRGLSELDLSLLTDGLQAER 74

Query: 226 E 228
           E
Sbjct: 75  E 75


>UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella
           nidulans|Rep: Elongation factor Tu - Emericella nidulans
           (Aspergillus nidulans)
          Length = 461

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/100 (38%), Positives = 60/100 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F T   +   +D PGH D+IKNMITG +  D A+++VAA  G+         QTREH L
Sbjct: 109 EFSTDNRHYAHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQMP-------QTREHLL 161

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTF 556
           LA  +GV++++V VNK+D+ + P +   +    R+  +T+
Sbjct: 162 LARQVGVQKIVVFVNKVDAVDDPEMLELVELEMRELLNTY 201



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           + K H+NI  IGHVD GK+T T
Sbjct: 48  RTKPHVNIGTIGHVDHGKTTLT 69


>UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Sulfate adenylyltransferase, large subunit -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 564

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 42/129 (32%), Positives = 71/129 (55%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KF T K    IIDAPGH++F+KNM++G + A+ A+L++ A  G  E       Q++ HA 
Sbjct: 77  KFSTPKRDYLIIDAPGHKEFLKNMVSGAANAEAALLVIDAAEGVQE-------QSKRHAY 129

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           +   LG++++ V VNKMD  E  +     ++ + +      K+   P    ++P+SG+ G
Sbjct: 130 ILSLLGIQKVYVIVNKMDMIE--FSEKKFKEIKYEISTFLSKLNVYPQ--KYIPVSGFLG 185

Query: 617 DNMLELQPK 643
           +N+     K
Sbjct: 186 ENIARKSDK 194



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/61 (40%), Positives = 42/61 (68%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           + IVV+GHVD GKST  G L+Y    + +  IE+ ++ ++E G+  F+YA++LD L+ E+
Sbjct: 7   LKIVVVGHVDHGKSTIIGRLLYDTKSVPEAAIERVKRISKEKGR-PFEYAYLLDALEEEQ 65

Query: 226 E 228
           +
Sbjct: 66  K 66


>UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1;
           Tetrahymena thermophila SB210|Rep: Elongation factor
           1-alpha - Tetrahymena thermophila SB210
          Length = 356

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K H+++ V G VDSGKSTT GHL++K G +++R I++ +  A++ GK SF +A+V+D+ K
Sbjct: 4   KQHLSVAVFGDVDSGKSTTCGHLVFKLGEVNQRKIDELKALAEKEGKSSFGFAYVMDRTK 63

Query: 217 AER 225
           AER
Sbjct: 64  AER 66


>UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=29; Burkholderiaceae|Rep: Sulfate
           adenylyltransferase, large subunit - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 438

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 1/126 (0%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK-NGQTREH 430
           R F T+K    I D PGH  + +NM+TG S A  A++++ A     E G++    QT+ H
Sbjct: 84  RYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILIDATRVTIENGVADLLPQTKRH 143

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGW 610
           + +   L ++ +IV +NKMD  +  Y      + R  Y    K++G     V FVP+S  
Sbjct: 144 SAIVKLLALQHVIVAINKMDLVD--YSEARFNEIRDAYVTLAKQLGLTD--VRFVPVSAL 199

Query: 611 HGDNML 628
            GDN++
Sbjct: 200 KGDNIV 205


>UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=2; Geobacter|Rep:
           Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit - Geobacter sp.
           FRC-32
          Length = 619

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 44/120 (36%), Positives = 69/120 (57%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFT 448
           +++Y+ IIDAPGH++F+KNMI+G ++A+ AVLI+ A  G  E       Q++ H  +   
Sbjct: 111 NRHYI-IIDAPGHKEFLKNMISGAARAEAAVLIIDAAEGVAE-------QSKRHGYMLSL 162

Query: 449 LGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNML 628
           LG++Q+ V VNKMD     +          +Y    K++G  P    FVP S  +GDN++
Sbjct: 163 LGIRQIAVVVNKMDLVN--HDQKVFEAIVTEYSAFLKELGVTPR--QFVPASARNGDNVV 218



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           + +V +GHVD GKST  G +      +    +EK     ++ GK +F+YA++ D    E+
Sbjct: 36  LQVVFVGHVDHGKSTLLGRIYADTDSLPVGQLEKVRAICEQQGK-TFEYAFLFDAFLEEQ 94

Query: 226 E 228
           E
Sbjct: 95  E 95


>UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=2;
           Aurantimonadaceae|Rep: Binfunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Fulvimarina pelagi HTCC2506
          Length = 578

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 40/129 (31%), Positives = 67/129 (51%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F +      I D PGH  + +NM TG SQA+ AV++V A  G          QTR H+
Sbjct: 131 RYFSSENRAFIIADTPGHEQYTRNMATGASQAELAVILVDARKGILP-------QTRRHS 183

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   +G+K +++ +NKMD  +  +        +R Y     ++G+    V++VP+S  +
Sbjct: 184 FITSLVGIKSVVIAINKMDLVD--FAEERFDAIKRDYEAILPQLGFTD--VSYVPLSAKN 239

Query: 614 GDNMLELQP 640
           GDN+++  P
Sbjct: 240 GDNIVKRSP 248



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 219
           +  +  G VD GKST  G L+Y+   +    +E  EK++++ G   G   +A ++D L A
Sbjct: 59  LRFITCGSVDDGKSTLIGRLLYETNAVFDDQMEALEKDSKKFGTTGGDLDFALLVDGLSA 118

Query: 220 ERE 228
           ERE
Sbjct: 119 ERE 121


>UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1;
           n=38; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Salmonella typhimurium
          Length = 479

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 43/124 (34%), Positives = 62/124 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T +    I D PGH  + +NM TG S  D A+L++ A  G  +       QTR H+
Sbjct: 100 RYFSTERRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLD-------QTRRHS 152

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            ++  LG+K L+V +NKMD  +  Y      + R  Y  TF +       + FVP+S   
Sbjct: 153 FISTLLGIKHLVVAINKMDLVD--YREETFARIREDY-LTFAEQLPGDLDIRFVPLSALE 209

Query: 614 GDNM 625
           GDN+
Sbjct: 210 GDNV 213



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 204
           + K+ +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 205 DKLKAERE 228
           D L+AERE
Sbjct: 83  DGLQAERE 90


>UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: elongation
           factor-1alpha - Entamoeba histolytica HM-1:IMSS
          Length = 544

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 32/63 (50%), Positives = 43/63 (68%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           +T + ++  GHVDSGKSTT GH++ + GG+    IEK +KE  E GK SF+YAWV+D   
Sbjct: 130 QTPLTVIFCGHVDSGKSTTVGHILQELGGVTHSQIEKNKKECGEKGKKSFEYAWVMDTDD 189

Query: 217 AER 225
            ER
Sbjct: 190 EER 192



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 34/131 (25%), Positives = 65/131 (49%), Gaps = 1/131 (0%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE-HA 433
           +F+ +   + I+DAPGH DF+   I   ++AD AV++V       +   +  G   +  +
Sbjct: 204 EFQYNHKNIRILDAPGHTDFLMKTIDAMNEADVAVVVVDVDKHNLKC--TYEGTFLDIVS 261

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            LA++  V ++IV +NKMDS +  +     +          K+   +   + ++PISG  
Sbjct: 262 TLAYST-VSKIIVAINKMDSVK--WSESKYKSVVSVAEELLKEYNLDNINIRYIPISGLS 318

Query: 614 GDNMLELQPKC 646
           G+N+++    C
Sbjct: 319 GENLIKPTTSC 329


>UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE
           SUBUNIT 1; n=1; Wolinella succinogenes|Rep: GTPASE,
           SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 - Wolinella
           succinogenes
          Length = 459

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 44/128 (34%), Positives = 72/128 (56%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F++      IIDAPGH +F++NM++G S+A  AVL++ A       G+++N  ++ H LL
Sbjct: 79  FKSQAREYVIIDAPGHIEFLRNMLSGASRAVAAVLVIDA-----IEGVAEN--SKRHGLL 131

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
              LG+ Q++V +NK+D+    Y        + +Y    K +G  P   AFVPIS   G 
Sbjct: 132 LSLLGISQVVVVINKLDAL--GYDKNAFLAIQAEYEAYLKTLGITPK--AFVPISAREGK 187

Query: 620 NMLELQPK 643
           N+++  P+
Sbjct: 188 NLIQKAPE 195



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/68 (32%), Positives = 37/68 (54%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M      +NIV+ GHVD GKST  G L+   G + +  +E   +   +  +  F+Y+ +L
Sbjct: 1   MSAHLERMNIVITGHVDHGKSTLVGRLLADTGSLPQGKLESVRESCAKNAR-PFEYSMLL 59

Query: 205 DKLKAERE 228
           D L+ E++
Sbjct: 60  DALEDEQK 67


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 37/81 (45%), Positives = 55/81 (67%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET K + + ID PGH D+IKNMITGTSQ D ++L+V+A  G          QT+EH L
Sbjct: 178 EYETEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDGLMP-------QTKEHVL 230

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           L+  +G++++IV +NK+D  E
Sbjct: 231 LSRQIGIEKMIVYLNKIDMCE 251



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK---RTIEKFEKEAQEMGKG 180
           ++K H+NI  IGHVD GK+T T  +   C  +++   ++ E+ +K  +E  +G
Sbjct: 117 RKKPHMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRG 169


>UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase
           subunit 1; n=2; Clostridium|Rep: GTPase, sulfate
           adenylate transferase subunit 1 - Clostridium
           acetobutylicum
          Length = 522

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 44/129 (34%), Positives = 69/129 (53%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +F T K    IIDAPGH++F+KNMI+G + A+ A+L+V A  G  E       Q++ H  
Sbjct: 77  QFFTKKRDYVIIDAPGHKEFLKNMISGAASAEAAILVVDAKEGIQE-------QSKRHGY 129

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           +   LG+K++ V VNKMD  +  Y      +   ++      +   P   A++PIS + G
Sbjct: 130 ILSLLGIKKVYVAVNKMDLVD--YSEERYNEIVTQFNSFLANLNIYPE--AYIPISAFLG 185

Query: 617 DNMLELQPK 643
           DN+ +   K
Sbjct: 186 DNVAKKSEK 194



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 26/63 (41%), Positives = 40/63 (63%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           + ++N+V +GHVD GKST  G L+Y    +    IEK +K + E GK  F+YA++LD  +
Sbjct: 4   RENLNVVFVGHVDHGKSTLIGRLLYDTNSLPDGAIEKVKKISAEEGK-KFEYAFLLDAFE 62

Query: 217 AER 225
            E+
Sbjct: 63  EEQ 65


>UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor TU, putative -
           Leishmania major
          Length = 466

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 45/134 (33%), Positives = 71/134 (52%), Gaps = 4/134 (2%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++E+ K +   ID PGH DF+KNMITG +Q D  +++VAA  G          QTREH L
Sbjct: 80  EYESEKRHYGHIDCPGHMDFVKNMITGAAQMDGGIIVVAATDGVMP-------QTREHLL 132

Query: 437 LAFTLGVKQLIVGVNKMDSTEP---PYVSPDLRKSRRKYPHTFKKIG-YNPAAVAFVPIS 604
           +   +G+  L+  +NK+D T+      V  ++R+   KY    ++      +A+  V   
Sbjct: 133 ICSQIGLPALVGFINKVDMTDEDTCDLVDMEVREQLEKYKFPAEETPIVRGSALKAVEGD 192

Query: 605 GWHGDNMLELQPKC 646
             + +N+LEL  KC
Sbjct: 193 AKYEENILELVRKC 206


>UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1;
           n=26; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Shigella flexneri
          Length = 475

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 43/124 (34%), Positives = 61/124 (49%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    I D PGH  + +NM TG S  + A+L++ A  G  +       QTR H+
Sbjct: 100 RYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLD-------QTRRHS 152

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            ++  LG+K L+V +NKMD  +  Y      + R  Y  TF         + FVP+S   
Sbjct: 153 FISTLLGIKHLVVAINKMDLVD--YSEETFTRIREDY-LTFAGQLPGNLDIRFVPLSALE 209

Query: 614 GDNM 625
           GDN+
Sbjct: 210 GDNV 213



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 204
           + K+ +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 205 DKLKAERE 228
           D L+AERE
Sbjct: 83  DGLQAERE 90


>UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia
           sp.|Rep: Tuf1 - uncultured Pseudonocardia sp
          Length = 230

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/81 (43%), Positives = 50/81 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +++T K +   +D PGH D++KNMITG +Q D A+L+VAA  G          QTREH L
Sbjct: 7   EYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMP-------QTREHVL 59

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV  ++V +NK D  +
Sbjct: 60  LARQVGVPYIVVALNKADMVD 80


>UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 558

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 42/125 (33%), Positives = 62/125 (49%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T +    I D PGH  + +NM TG S AD A+L+V A  G          QTR H+
Sbjct: 92  RYFATERRKFIIADTPGHEQYTRNMATGASTADVAILLVDAAKGLLP-------QTRRHS 144

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   LG++ +++ VNKMD     +     R   R Y     ++G     VA +P++  H
Sbjct: 145 AICALLGIRSVVLAVNKMDRV--AWDEATFRTIERDYRVLATRLGLE--QVACIPVAALH 200

Query: 614 GDNML 628
           GDN++
Sbjct: 201 GDNVV 205



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 219
           + ++  G VD GKST  G L+Y  G I    +   E+ +   G    S   A ++D L+A
Sbjct: 20  LRLLTCGSVDDGKSTLIGRLLYDAGAIPDDQLAAVERASARYGTTGDSPDLALLVDGLEA 79

Query: 220 ERE 228
           ERE
Sbjct: 80  ERE 82


>UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large
           subunit; n=9; Burkholderiales|Rep: Sulfate
           adenylyltransferase, large subunit - Acidovorax sp.
           (strain JS42)
          Length = 462

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 46/130 (35%), Positives = 68/130 (52%), Gaps = 1/130 (0%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AGISKNGQTREH 430
           R F T      I DAPGH  + +NM+T  SQAD AV++V A   +++   ++   QTR H
Sbjct: 92  RYFATEARKFIIGDAPGHEQYTRNMVTAASQADAAVVLVDATKLDWQNPQLTLLPQTRRH 151

Query: 431 ALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGW 610
           +LL   L V  L+  VNK+D+   P ++   R  R       +  G + A V  VP+S  
Sbjct: 152 SLLVHLLRVHSLVFAVNKLDAVADPQLA--YRHIRAALEQFARHAGIDVAGV--VPVSAL 207

Query: 611 HGDNMLELQP 640
            G N++E +P
Sbjct: 208 KGWNVVEAKP 217


>UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2;
           Cryptosporidium|Rep: HBS1 eRFS. GTpase - Cryptosporidium
           parvum Iowa II
          Length = 530

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 31/58 (53%), Positives = 40/58 (68%)
 Frame = +1

Query: 55  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           VV+GHVDSGKST  GHL    G I +  + K++KE++ +GKGSF YAW+ D    ERE
Sbjct: 85  VVLGHVDSGKSTLMGHLFVSLGLISEGVMRKYKKESEIIGKGSFAYAWIFDDCDDERE 142



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 1/120 (0%)
 Frame = +2

Query: 272 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 451
           K  VTI+DAPGH +FI N  + +  +D  +++V   +G F++G  K GQT EH + +   
Sbjct: 158 KKLVTILDAPGHSEFIPNSFSISMFSD-NIIVVIDSSG-FDSGFQK-GQTIEHIIYSLLA 214

Query: 452 GVKQLIVGVNKMDSTE-PPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNML 628
            V  +I  VNK+D       V  ++  +   Y +       N + + F+PIS +HG N+L
Sbjct: 215 DVSNIIFAVNKLDLCNWDEQVYSNIVNTISNYINLELADIKNDSNIIFLPISAYHGVNIL 274


>UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1;
           n=7; Rhizobiaceae|Rep: Sulfate adenylyltransferase
           subunit 1 - Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 498

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 43/127 (33%), Positives = 64/127 (50%), Gaps = 2/127 (1%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    + D PGH  + +NM TG S AD AVL+V A  G  E       QTR HA
Sbjct: 105 RYFATDKRSFIVADTPGHEQYTRNMATGASTADLAVLLVDARVGLLE-------QTRRHA 157

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA--VAFVPISG 607
            +A  +G++Q ++ VNK+D T       D      +  H F+++  +     V  +P+S 
Sbjct: 158 TIATLMGIRQFVLAVNKIDLTNYDRARFD------QISHEFRELALSLGVRQVTAIPVSA 211

Query: 608 WHGDNML 628
             G+N++
Sbjct: 212 LKGENVV 218



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +1

Query: 7   IRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA--QEMGKG 180
           +++  ++ ++   + ++  G VD GKST  G L++    + +      ++++  ++   G
Sbjct: 20  VQETARVVRDTRPLRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAASLQRDSSGKQNDLG 79

Query: 181 SFKYAWVLDKLKAERE 228
              +A +LD L+AERE
Sbjct: 80  LPDFALLLDGLQAERE 95


>UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu),
           mitochondrial protein 2; n=5; Chromadorea|Rep: Tu
           elongation factor (Ef-tu), mitochondrial protein 2 -
           Caenorhabditis elegans
          Length = 439

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 36/69 (52%), Positives = 44/69 (63%)
 Frame = +2

Query: 293 DAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 472
           D PGH DFIKNMI GTSQ D AVL++AA  G  E       QT+EH +LA  +GVK + +
Sbjct: 114 DCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------QTKEHLILAKQVGVKNMAI 166

Query: 473 GVNKMDSTE 499
            +NK D  E
Sbjct: 167 FINKADLVE 175


>UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Rhodopirellula baltica
          Length = 647

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 40/126 (31%), Positives = 63/126 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T+K    I D PGH  + +NM TG S AD A++++ A  G          QTR H+
Sbjct: 97  RYFSTAKRKFIIADTPGHEQYTRNMATGASSADLAIILIDARHGVLT-------QTRRHS 149

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   LG++ ++V VNKMD     Y      +    Y     ++  +   + F+PIS  +
Sbjct: 150 FIVSLLGIRHVVVAVNKMDIDGVDYSEDRFNEICDDYRSFATRL--DLPDLHFIPISALN 207

Query: 614 GDNMLE 631
           GDN+++
Sbjct: 208 GDNLVD 213



 Score = 39.9 bits (89), Expect = 0.062
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYA 195
           K  ++K  +  +  G VD GKST  G L+Y    + +  + K + ++   G   G F  +
Sbjct: 17  KQHEQKQLLRFITCGSVDDGKSTLIGRLLYDSKLVYEDELAKVQSDSVRQGSVAGGFDPS 76

Query: 196 WVLDKLKAERE 228
             +D LK ERE
Sbjct: 77  LFMDGLKEERE 87


>UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium
           tetraurelia|Rep: Elongation factor Tu - Paramecium
           tetraurelia
          Length = 471

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 39/102 (38%), Positives = 59/102 (57%), Gaps = 4/102 (3%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +++T   +   +D PGH D++KNMITG ++ D A+L+VAA  G          QTREH L
Sbjct: 88  EYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDAAILVVAATDGCM-------AQTREHVL 140

Query: 437 LAFTLGVKQLIVGVNKMDSTEPP----YVSPDLRKSRRKYPH 550
           L   +GV+ +IV VNK+D  + P     V  ++R+   KY +
Sbjct: 141 LCRQVGVETIIVFVNKIDLAKDPEIHELVEMEIRELLSKYEY 182



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +1

Query: 22 KMGKEKTHINIVVIGHVDSGKSTTT 96
          K  ++K H+N+  IGH+D GK+T T
Sbjct: 24 KFVRDKPHLNVGTIGHIDHGKTTLT 48


>UniRef50_P18905 Cluster: Elongation factor Tu; n=2;
           Coleochaetales|Rep: Elongation factor Tu - Coleochaete
           orbicularis
          Length = 415

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 37/95 (38%), Positives = 57/95 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+  + + +D PGH ++I NMITG SQ D A+L+V+A  G          QT+EH L
Sbjct: 72  EYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILVVSAVDGPM-------AQTKEHIL 124

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRK 541
           LA  LG+  ++V +NK D  +   V P L ++ R+
Sbjct: 125 LAKLLGISSILVFINKEDELDDQEVLPMLIQNMRQ 159


>UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Rep:
           Elongation factor Tu - Drosophila melanogaster (Fruit
           fly)
          Length = 456

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 36/81 (44%), Positives = 50/81 (61%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C   + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTRE
Sbjct: 111 CHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTRE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H LLA  +G++++IV +NK D
Sbjct: 164 HLLLAKQVGIQRIIVFINKAD 184


>UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella
           britovi|Rep: Mitochondrial EF-Tu2 - Trichinella britovi
          Length = 428

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/80 (42%), Positives = 49/80 (61%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           +ET K   +  D PGH+DFIKNMI G +Q D A+L+V A  G          QTREH +L
Sbjct: 86  YETKKRKYSHTDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMP-------QTREHVML 138

Query: 440 AFTLGVKQLIVGVNKMDSTE 499
           A  +GV++++V +NK +  +
Sbjct: 139 AKQVGVQRIVVFINKAEMVD 158


>UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase large
           subunit; n=1; Streptomyces avermitilis|Rep: Putative
           sulfate adenylyltransferase large subunit - Streptomyces
           avermitilis
          Length = 487

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 45/126 (35%), Positives = 64/126 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T++    + D PGH  + +NM+TG S AD AV++V A  G  E       QTR HA
Sbjct: 92  RYFATARRRFILADTPGHVQYTRNMVTGASTADLAVVLVDARNGVIE-------QTRRHA 144

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +A  L V  +++ VNKMD  E  Y          K+     ++G  P   A +PIS   
Sbjct: 145 AVAALLRVPHVVLAVNKMDLVE--YKESVFAAIAEKFTAYASELGV-PEITA-IPISALA 200

Query: 614 GDNMLE 631
           GDN+++
Sbjct: 201 GDNVVD 206



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           T +     G VD GKST  G L++    +    +E  E+ ++  G+ +   A + D L+A
Sbjct: 20  TLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVEQVSRSRGQDAPDLALLTDGLRA 79

Query: 220 ERE 228
           ERE
Sbjct: 80  ERE 82


>UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=6; Bacteria|Rep: Sulfate adenylyltransferase,
           large subunit - Plesiocystis pacifica SIR-1
          Length = 653

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 41/126 (32%), Positives = 65/126 (51%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    I D PGH  + +NM TG S AD A++++ A  G  +       Q+R HA
Sbjct: 121 RYFATKKRKFIIADTPGHVQYTRNMATGASTADAAIILIDARLGVLQ-------QSRRHA 173

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +A  +G+  L+V VNKMD  +  +     +    ++     K+G++   V F P+S   
Sbjct: 174 TIANLIGIPHLLVAVNKMDLVD--FDQGAYQAIVDEFRAFTAKLGFD--KVEFFPVSALE 229

Query: 614 GDNMLE 631
           GDN+++
Sbjct: 230 GDNVVQ 235



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/66 (36%), Positives = 36/66 (54%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 210
           + ++ +  V IG VD GKST  G L+Y+ GG+ +  +        E G+ S  +A + D 
Sbjct: 47  ERRSLLRFVTIGSVDDGKSTLIGRLLYETGGVFEDQLAAVTSTDGE-GEASINFANLTDG 105

Query: 211 LKAERE 228
           L AERE
Sbjct: 106 LVAERE 111


>UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=73; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 452

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 114 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 166

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 167 LARQIGVEHVVVYVNKADAVQ 187



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=138; root|Rep: Bifunctional
           enzyme cysN/cysC [Includes: Sulfate adenylyltransferase
           subunit 1 (EC 2.7.7.4) (Sulfate adenylate transferase)
           (SAT) (ATP- sulfurylase large subunit); Adenylyl-sulfate
           kinase (EC 2.7.1.25) (APS kinase) (ATP
           adenosine-5'-phosphosulfate 3'-phosphotransferase)] -
           Xylella fastidiosa
          Length = 623

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 42/124 (33%), Positives = 59/124 (47%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F+T K    + D PGH  + +NM TG S AD AV++V A  G          QTR H+
Sbjct: 89  RYFDTEKRKFIVADCPGHAQYTRNMATGASTADAAVVLVDARKGLLT-------QTRRHS 141

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   LG++ +++ VNKMD     Y           Y     K+G N   V  +P+S   
Sbjct: 142 YIVALLGIRHVVLAVNKMDLV--GYDQETFEAIASDYLALAAKLGIN--QVQCIPLSALE 197

Query: 614 GDNM 625
           GDN+
Sbjct: 198 GDNL 201



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG-KGS-FKYA 195
           K  + K  +  +  G VD GKST  GHL+Y    + +  +     ++Q  G +G    YA
Sbjct: 9   KQQEIKPLLRFITCGSVDDGKSTLIGHLLYDSQCLAEDQLADLMVDSQRYGTQGEHIDYA 68

Query: 196 WVLDKLKAERE 228
            +LD L AERE
Sbjct: 69  LLLDGLAAERE 79


>UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1;
           n=20; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Yersinia pestis
          Length = 478

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 42/124 (33%), Positives = 61/124 (49%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    I D PGH  + +NM TG S  D A+L++ A  G  +       QTR H+
Sbjct: 103 RYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLD-------QTRRHS 155

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +A  LG++ L+V VNKMD     +      + +  Y  +F +       + FVP+S   
Sbjct: 156 FIATLLGIRHLVVAVNKMDLV--GFQESVFTQFKDDY-LSFAEQLPTDLDIKFVPLSALD 212

Query: 614 GDNM 625
           GDN+
Sbjct: 213 GDNV 216



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 204
           + KT +  +  G VD GKST  G L++    I +  +     +++ +G    K   A ++
Sbjct: 26  QHKTMLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGEKLDLALLV 85

Query: 205 DKLKAERE 228
           D L+AERE
Sbjct: 86  DGLQAERE 93


>UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular
           organisms|Rep: Elongation factor Tu - Treponema pallidum
          Length = 395

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 33/83 (39%), Positives = 51/83 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++++ + +   ID PGH D++KNMITG +Q D  +L+V+A  G          QT+EH L
Sbjct: 69  EYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMP-------QTKEHLL 121

Query: 437 LAFTLGVKQLIVGVNKMDSTEPP 505
           LA  +GV  +IV +NK+D  + P
Sbjct: 122 LARQVGVPSIIVFLNKVDLVDDP 144



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG---GIDKRTIEKFEKEAQEMGKG 180
           K  + K H+N+  IGHVD GK+T +  +   C    G  +   ++ +   +E  +G
Sbjct: 5   KFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKKFGDKQLKYDEIDNAPEEKARG 60


>UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondrial
           precursor, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu, mitochondrial
           precursor, putative - Tetrahymena thermophila SB210
          Length = 375

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 34/85 (40%), Positives = 49/85 (57%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET   +   +D PGH D++KNMITG ++ D  +L+ +A  G          QTREH L
Sbjct: 90  EYETETRHYGHVDCPGHIDYVKNMITGAAKMDAGILVCSATDGVMP-------QTREHIL 142

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYV 511
           L   +GVK +IV VNK D  + P +
Sbjct: 143 LCRQVGVKTIIVFVNKCDMAKDPEI 167



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIE 144
           K  + K H+N+  IGH+D GK+T T  +   C   DK+  E
Sbjct: 26  KFQRNKPHLNVGTIGHIDHGKTTLTAAITKICA--DKKLAE 64


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 37/80 (46%), Positives = 51/80 (63%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 437 LAFTLGV--KQLIVGVNKMD 490
           LA  +GV    ++V +NK+D
Sbjct: 160 LARQVGVPLDNIVVFMNKVD 179



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 202 LDKLKAER 225
           L+   A+R
Sbjct: 106 LEYETAKR 113


>UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate
           adenylate transferase subunit 1; n=1; Brevibacterium
           linens BL2|Rep: COG2895: GTPases - Sulfate adenylate
           transferase subunit 1 - Brevibacterium linens BL2
          Length = 448

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 40/126 (31%), Positives = 63/126 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    + D PGH  + +NM+TG + AD  V+++ A TG  E       QTR H 
Sbjct: 89  RYFATDKRSFILADCPGHVQYTRNMVTGATTADAVVVLIDARTGATE-------QTRRHL 141

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   LG++ +I+ +NK+D  +  Y      K   +      +IG + A +  +P+S   
Sbjct: 142 TVVHRLGIRHVILAINKIDLLD--YDQAAYAKVEAEIEALTAEIGLDSAHL--IPVSALA 197

Query: 614 GDNMLE 631
           GDN+ E
Sbjct: 198 GDNVAE 203



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG--KGSFKYAWVLDK 210
           KT +     G VD GKST  G L++    I    +E   + ++E G   G F +A + D 
Sbjct: 14  KTLLRFATAGSVDDGKSTLVGRLLHDAKAILADQLEAVTRTSEERGFVGGEFDFALLTDG 73

Query: 211 LKAERE 228
           L+AERE
Sbjct: 74  LRAERE 79


>UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Mycobacterium tuberculosis
          Length = 614

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 45/125 (36%), Positives = 61/125 (48%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    I D PGH  + +NM+TG S A   +++V A  G  E       Q+R HA
Sbjct: 75  RYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLE-------QSRRHA 127

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            LA  LG++ L++ VNKMD         D   + R   H F     +   V  +PIS  H
Sbjct: 128 FLASLLGIRHLVLAVNKMDLLGWDQEKFD---AIRDEFHAF-AARLDVQDVTSIPISALH 183

Query: 614 GDNML 628
           GDN++
Sbjct: 184 GDNVV 188



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/63 (33%), Positives = 31/63 (49%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           T + +   G VD GKST  G L+Y    + +      E+ +++ G      A V D L+A
Sbjct: 3   TLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRA 62

Query: 220 ERE 228
           ERE
Sbjct: 63  ERE 65


>UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2;
           Cystobacterineae|Rep: CysN/CysC bifunctional enzyme -
           Stigmatella aurantiaca DW4/3-1
          Length = 574

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 41/126 (32%), Positives = 60/126 (47%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T +  V + D PGH  + +NM TG S AD AV++  A  G          QTR HA
Sbjct: 120 RYFSTPRRKVIVADTPGHIQYTRNMATGASTADAAVILADARLGVLP-------QTRRHA 172

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +A  LG+  L V VNKMD  +  +      +  R+     + +G+    +   P+S   
Sbjct: 173 YIASLLGIPYLAVAVNKMDMVD--FDRAVFERIGRELADFARPLGF--TQIRLFPVSARQ 228

Query: 614 GDNMLE 631
           GDN+ +
Sbjct: 229 GDNITQ 234



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGI 126
           +K  + +VV+G VD GKST  G L+Y+C G+
Sbjct: 20  DKELLRLVVVGSVDDGKSTLIGRLLYECDGL 50


>UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1;
           n=8; Bacteroidetes|Rep: Sulfate adenylyltransferase
           subunit 1 - Algoriphagus sp. PR1
          Length = 418

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/122 (27%), Positives = 60/122 (49%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F T K    + D PGH ++ +NM+TG S +  A++++ A  G  E       QT  H  +
Sbjct: 80  FNTDKTNFIVADTPGHVEYTRNMVTGASTSQVAIILIDARKGVIE-------QTYRHFFI 132

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGD 619
           A  L +  ++V +NKMD  +  Y      K +  +    +K  ++   + F+P+S   G+
Sbjct: 133 ANLLRISHVVVAINKMDLVD--YEEDVYLKIKADFDELVEKSDFSEDQITFIPVSALKGE 190

Query: 620 NM 625
           N+
Sbjct: 191 NI 192



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           M + +  I I   G VD GKST  G L+Y    +    IE  E+ +++ G     ++   
Sbjct: 1   MSENRKLIKIATAGSVDDGKSTLIGRLLYDTKSLTTDKIEAIERSSKQRGYDYLDFSLAT 60

Query: 205 DKLKAERE 228
           D L AERE
Sbjct: 61  DGLVAERE 68


>UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1;
           n=17; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Bacteroides thetaiotaomicron
          Length = 485

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 41/126 (32%), Positives = 63/126 (50%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T+     I D PGH  + +NMITG S A+ A+++V A TG          QTR H 
Sbjct: 92  RYFSTNGRKFIIADTPGHEQYTRNMITGGSTANLAIILVDARTGVIT-------QTRRHT 144

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            L   LG+K +++ VNKMD  +  +      +   +Y    + +G     V  +P+S   
Sbjct: 145 FLVSLLGIKHVVLAVNKMDLVD--FSEERFDEIVSEYKKFVEPLGI--PDVNCIPLSALD 200

Query: 614 GDNMLE 631
           GDN+++
Sbjct: 201 GDNVVD 206



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS--FKYAWVL 204
           ++K  + ++  G VD GKST  G L++    + +  ++  E++++ +G       YA +L
Sbjct: 15  EQKDLLRLLTAGSVDDGKSTLIGRLLFDSKKLYEDQLDALERDSKRVGNAGEHIDYALLL 74

Query: 205 DKLKAERE 228
           D LKAERE
Sbjct: 75  DGLKAERE 82


>UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /
           adenylylsulfate kinase; n=1; Gluconobacter oxydans|Rep:
           Sulfate adenylyltransferase subunit 1 / adenylylsulfate
           kinase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 626

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/68 (48%), Positives = 45/68 (66%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I+DAPGHR F++NMITG + A+ AVL+V A  G  E       QTR HA+L   +G++ +
Sbjct: 99  IVDAPGHRQFLRNMITGAADAEAAVLVVDAKEGAQE-------QTRRHAMLLRLIGIRHV 151

Query: 467 IVGVNKMD 490
           IV +NK D
Sbjct: 152 IVLLNKSD 159



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/59 (32%), Positives = 37/59 (62%)
 Frame = +1

Query: 52  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           IV++GHVD GKST  G L+Y    +    + +  + +++ G  + +++++LD L+ ER+
Sbjct: 21  IVIVGHVDHGKSTLIGRLLYDTDSLQDGKLAQIVESSRKRGL-AVEWSFLLDSLQIERD 78


>UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes
           ludwigii|Rep: SUP35 homolog - Saccharomycodes ludwigii
          Length = 305

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 26/50 (52%), Positives = 40/50 (80%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSF 186
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  F
Sbjct: 256 KDHMSLLFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRFCF 305


>UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subunit
           subfamily, putative; n=5; cellular organisms|Rep:
           Sulfate adenylyltransferase, large subunit subfamily,
           putative - Salinibacter ruber (strain DSM 13855)
          Length = 639

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 42/125 (33%), Positives = 58/125 (46%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T +    I D PGH  + +NM+TG S A+ AV ++ A  G  E       QTR H 
Sbjct: 83  RYFSTPERKFIIADTPGHEQYTRNMVTGASTAELAVELIDARNGVLE-------QTRRHG 135

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   L +  +IV VNKMD     Y     R+   +Y      +      + FVPIS   
Sbjct: 136 FITSLLQIPHVIVAVNKMDLV--GYSEARFREIVAEYEDFADNLDVQD--ITFVPISALK 191

Query: 614 GDNML 628
           GDN++
Sbjct: 192 GDNVV 196



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +     G VD GKST  G L+Y    I +  +E+ E+  Q   +   + A + D L+AER
Sbjct: 14  LRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQRDDE-ELELALLTDGLRAER 72

Query: 226 E 228
           E
Sbjct: 73  E 73


>UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large
           subunit; n=13; Proteobacteria|Rep: Sulfate
           adenylyltransferase, large subunit - Polynucleobacter
           sp. QLW-P1DMWA-1
          Length = 447

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AGISKNGQTREH 430
           R F T K    + DAPGH  + +N++TG SQ+D AV++V A   +      +   QT+ H
Sbjct: 83  RYFSTPKRKFIVADAPGHEQYTRNLVTGASQSDVAVILVDATRVDLSTTPATLLAQTKRH 142

Query: 431 ALLAFTLGVKQLIVGVNKMD 490
           A +   LG++ ++  +NKMD
Sbjct: 143 AAIVHLLGLRHVVFAINKMD 162


>UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=1;
           Limnobacter sp. MED105|Rep: Bifunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Limnobacter sp. MED105
          Length = 575

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 40/126 (31%), Positives = 60/126 (47%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F+T      + D PGH  + +NM+TG S A  AVL++ A  G          QTR HA
Sbjct: 92  RYFQTDARKFIVADTPGHEQYTRNMVTGASTAHLAVLLIDARKGVLT-------QTRRHA 144

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            L   +G++ L++ VNKMD  +  +      +    +    K +     AV  +P+S   
Sbjct: 145 FLTQLVGIRHLVLAVNKMDLVD--FKQEVYDRIVADFAGYAKALSIE--AVQAIPLSAIG 200

Query: 614 GDNMLE 631
           GDN+ E
Sbjct: 201 GDNLRE 206



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 219
           +  +  G VD GKST  G ++++   + +  +     E++  G    +  YA ++D L A
Sbjct: 20  LRFITCGSVDDGKSTLIGRMLWESQQLFEDQVAALRNESKRYGTQGDNIDYALLVDGLSA 79

Query: 220 ERE 228
           ERE
Sbjct: 80  ERE 82


>UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacopta
           punctatissima|Rep: Elongation factor 1-alpha - Megacopta
           punctatissima
          Length = 187

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/41 (68%), Positives = 31/41 (75%)
 Frame = +2

Query: 557 KKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           KKIGYNPA+VAFVPISGWHGDNMLE   K    +   +ERK
Sbjct: 46  KKIGYNPASVAFVPISGWHGDNMLEPSDKMPWFKGWAIERK 86



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/48 (43%), Positives = 26/48 (54%)
 Frame = +1

Query: 511 EPRFEEIKKEVSSYIQEDWLQPSCCRFRAHFWMARRQHVGASTKMPWF 654
           + RFEEIKKEVSSYI++    P+   F           +  S KMPWF
Sbjct: 31  QSRFEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSDKMPWF 78



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 14/15 (93%), Positives = 15/15 (100%)
 Frame = +3

Query: 684 GQADGKCLIEALDAI 728
           G+ADGKCLIEALDAI
Sbjct: 88  GKADGKCLIEALDAI 102


>UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Acidobacteria bacterium Ellin345|Rep:
           Sulfate adenylyltransferase, large subunit -
           Acidobacteria bacterium (strain Ellin345)
          Length = 543

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 2/128 (1%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T+K    I D PGH  + +NM TG S +D A++++ A  G          Q+R H 
Sbjct: 99  RYFSTAKRKFIIADTPGHEQYTRNMATGASTSDLAIVLIDARKGVLV-------QSRRHL 151

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKI--GYNPAAVAFVPISG 607
            +A  LG+ +++  +NKMD  +    SP++  +   +    K++  G    ++  +PIS 
Sbjct: 152 YIAALLGIPRVVATINKMDLVD---FSPEVFAA---HSLELKRLGDGLGIPSLVTIPISA 205

Query: 608 WHGDNMLE 631
             GDN++E
Sbjct: 206 LDGDNVVE 213



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 20/64 (31%), Positives = 30/64 (46%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  + I   G VD GKST  G L+Y    + +  +    +    +G     +A + D L+
Sbjct: 26  KDILRISTAGSVDDGKSTLIGRLLYDSRNVYEDHVRSVTRHDVSLGTSVVDFAQLTDGLR 85

Query: 217 AERE 228
           AERE
Sbjct: 86  AERE 89


>UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit CysN;
           n=7; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit CysN - Campylobacter jejuni
          Length = 472

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (1%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F ++K    I D PGH  + +NM TG S AD A++++ A  G  +       QT+ H+
Sbjct: 90  RFFTSNKRKFIIADTPGHEQYTRNMATGASTADIAIILIDARKGVLK-------QTKRHS 142

Query: 434 LLAFTLGVKQLIVGVNKMD--STEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISG 607
            +   LG+K  I+ +NKMD  S E    +   +   +  P+  + I        F+PI  
Sbjct: 143 YIVSLLGIKNFIIAINKMDLVSYEEKIFNNICKDYEKIIPYLQEDI-----QTHFIPICA 197

Query: 608 WHGDNMLE 631
            +G+N+ +
Sbjct: 198 LNGENITQ 205



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 204
           + K     +  G VD GKST  G L+Y    +    +   EK++++MG    K  +A ++
Sbjct: 13  ENKELCRFITCGSVDDGKSTLIGRLLYDTKALFSDQLSTLEKDSKKMGNAGDKLDFALLV 72

Query: 205 DKLKAERE 228
           D L +ERE
Sbjct: 73  DGLASERE 80


>UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; uncultured bacterium
           BAC10-10|Rep: Selenocysteine-specific translation
           elongation factor - uncultured bacterium BAC10-10
          Length = 634

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           ++ + + I+D PGH DF+KNM+ G    D A+LIVAA  G          QT EH  +  
Sbjct: 59  SASFLLGIVDVPGHEDFVKNMVAGVGSIDLALLIVAADDGWMP-------QTEEHLQILT 111

Query: 446 TLGVKQLIVGVNKMD-STEPPYVSPDLRKSRRKYP 547
             GV+  +V + K D +T+P   +  +R+  R  P
Sbjct: 112 YFGVRHAVVALTKADLTTDPAAAAVAVRERLRDTP 146


>UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14;
           Actinomycetales|Rep: CysN/CysC bifunctional enzyme -
           Rhodococcus sp. (strain RHA1)
          Length = 627

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 41/125 (32%), Positives = 62/125 (49%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T      + D PGH  + +NM TG S A  AVL+V A      AG+ +  QTR HA
Sbjct: 76  RFFSTPTRSFVLADTPGHERYTRNMFTGASNAHVAVLLVDA-----RAGVLR--QTRRHA 128

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +A  LGV  L+  VNK+D  +  +     ++   +     +++G     V  +P+S   
Sbjct: 129 RIADLLGVPHLVAVVNKIDLVD--FDETRFKEVESELGLLAQRLGGRDLTV--IPVSATR 184

Query: 614 GDNML 628
           GDN++
Sbjct: 185 GDNVV 189


>UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n=1;
           Methanopyrus kandleri|Rep: GTPase-translation elongation
           factor - Methanopyrus kandleri
          Length = 459

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 31/93 (33%), Positives = 50/93 (53%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FE   Y VT++DAPGH D I+ ++ G    D A+L+VAA  G          QT EH ++
Sbjct: 52  FELGDYTVTLVDAPGHADLIRTVVAGAEIIDAAILVVAADEG-------PQVQTGEHLVV 104

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRR 538
              LG+ + ++ +NK+D  +   V   + + +R
Sbjct: 105 LNHLGIDRGVIALNKVDLVDEKTVERRIEEIKR 137


>UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase
           subunit 1; n=5; Actinomycetales|Rep: GTPases-Sulfate
           adenylate transferase subunit 1 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 433

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 41/126 (32%), Positives = 59/126 (46%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T K    + D PGH  + +N +TG S +   VL+V A  G  E       QTR H 
Sbjct: 89  RYFATDKRTFILADTPGHVQYTRNTVTGVSTSQVVVLLVDARHGVVE-------QTRRHL 141

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            ++  LGV+ +I+ VNK+D  +  Y     R   +++      +      V  VPIS   
Sbjct: 142 SVSALLGVRTVILAVNKIDLVD--YSEEVFRNIEKEFVGLASALDVTDTHV--VPISALK 197

Query: 614 GDNMLE 631
           GDN+ E
Sbjct: 198 GDNVAE 203



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = +1

Query: 22  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 201
           K+   +T + +   G VD GKST  G L++    +    +   E+ + + G      + +
Sbjct: 12  KIASRET-LRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEGLDLSLL 70

Query: 202 LDKLKAERE 228
           +D L+AERE
Sbjct: 71  VDGLRAERE 79


>UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular
           organisms|Rep: Elongation factor Tu - Plasmodium
           falciparum
          Length = 410

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET   +   ID PGH D+IKNMI G +Q D A+L+++   G          QT EH L
Sbjct: 69  EYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILVISIIDGIMP-------QTYEHLL 121

Query: 437 LAFTLGVKQLIVGVNKMD 490
           L   +G+K +I+ +NK D
Sbjct: 122 LIKQIGIKNIIIFLNKED 139



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTGHLIY 111
           + K HIN+  IGHVD GK+T T  + Y
Sbjct: 8   RNKQHINLGTIGHVDHGKTTLTTAISY 34


>UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2885 UniRef100 entry -
           Xenopus tropicalis
          Length = 315

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/71 (42%), Positives = 41/71 (57%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGTSQ D  +L+VAA  G+         QTREH L
Sbjct: 38  EYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQMP-------QTREHLL 90

Query: 437 LAFTLGVKQLI 469
           LA    +  L+
Sbjct: 91  LAKQANIHTLV 101


>UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_14, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 247

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/46 (58%), Positives = 34/46 (73%)
 Frame = +2

Query: 392 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRK 529
           +AGISK+GQTREHALLA  LGV+Q+I   NKM++T P Y    + K
Sbjct: 90  QAGISKDGQTREHALLALILGVRQMICCCNKMEATTPKYSKASMIK 135


>UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha,
           putative; n=3; Theileria|Rep: Translation elongation
           factor 1-alpha, putative - Theileria annulata
          Length = 577

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 1/118 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V +ID PGH D I+N++ G   A+ A++IV   + +            EH LL + LG++
Sbjct: 188 VNVIDTPGHHDLIQNLVMGAVFANSAIIIV--DSNDVLKSDFFGVYFSEHMLLLYLLGIR 245

Query: 461 QLIVGVNKMDSTE-PPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLE 631
            +I+ VNK+D  E    +   + +  RK    ++K       + F+P+SG  GDN+++
Sbjct: 246 YIIICVNKIDRFEYSETMYNKVVEIIRKLVVVYEK----SVKLIFLPVSGLRGDNLID 299



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKR 135
           +N+VV+G VD+GKST  GH +     +DK+
Sbjct: 98  LNVVVLGAVDAGKSTLLGHFLTLTNCVDKK 127


>UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Thermosinus carboxydivorans
           Nor1|Rep: Selenocysteine-specific translation elongation
           factor - Thermosinus carboxydivorans Nor1
          Length = 623

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 28/75 (37%), Positives = 42/75 (56%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D PGH  F+KNM+ GT   D A+L+VAA  G          QTREH  +    G+ Q 
Sbjct: 58  VVDVPGHERFLKNMLAGTGGIDMAMLVVAADEGVMP-------QTREHLAMLHLYGISQG 110

Query: 467 IVGVNKMDSTEPPYV 511
           +V +NK+D  +  ++
Sbjct: 111 VVVLNKIDKVDAEWL 125


>UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=2; Arthrobacter|Rep: Sulfate
           adenylyltransferase, large subunit - Arthrobacter sp.
           (strain FB24)
          Length = 477

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 39/129 (30%), Positives = 58/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T +    + D PGH  + KN +TG S AD  V+++ A  G  E       QTR H 
Sbjct: 103 RYFATDRRSFILADCPGHVQYTKNTVTGASTADAVVVLIDARKGVLE-------QTRRHL 155

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVA---FVPIS 604
            +   L V  +IV VNK+D  +  +     R          +++G     +     VP+S
Sbjct: 156 SVLQLLRVAHVIVAVNKIDLVD--FSEDVFRGIEADVQKVGRELGLGADGITDLLVVPVS 213

Query: 605 GWHGDNMLE 631
              GDN++E
Sbjct: 214 ALDGDNVVE 222


>UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_28, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 154

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 31/74 (41%), Positives = 44/74 (59%)
 Frame = -1

Query: 430 MLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPR 251
           MLTGLT+L +T               ISLRG+ DHVLDE+++SRSIND  +  +  +LPR
Sbjct: 75  MLTGLTILGNTKSMIR---------TISLRGTSDHVLDEVTMSRSINDSAVTFSGLKLPR 125

Query: 250 AISIVIPXHAQPLV 209
           ++ I     + PL+
Sbjct: 126 SMPIPNVYQSSPLI 139


>UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|Rep:
           Elongation factor 1A - Echinostelium minutum
          Length = 237

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 22/25 (88%), Positives = 23/25 (92%)
 Frame = +2

Query: 557 KKIGYNPAAVAFVPISGWHGDNMLE 631
           KKIGYNP  +AFVPISGWHGDNMLE
Sbjct: 1   KKIGYNPEKIAFVPISGWHGDNMLE 25


>UniRef50_A6CK31 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. SG-1|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. SG-1
          Length = 630

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           ET    ++++D PGH  FIK MI G +  D  +L+VAA  G          QT+EH  + 
Sbjct: 52  ETEDMDISVVDVPGHEKFIKQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLEIL 104

Query: 443 FTLGVKQLIVGVNKMDSTE 499
             LGV   IV ++KMD  +
Sbjct: 105 SFLGVDHGIVVLSKMDKVD 123


>UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Babesia bovis|Rep: Elongation
           factor Tu GTP binding domain containing protein -
           Babesia bovis
          Length = 601

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/117 (27%), Positives = 56/117 (47%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  ID PGH D I N++ G S A  A+++V       E    K G   +H  + + LGV+
Sbjct: 204 IDFIDTPGHHDLIANLVKGASFARAAIVVVDILDFLKE---DKYGYFEQHLFILWALGVR 260

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLE 631
           + I+ VNK+D  E   +  +     ++    F        ++  +P SG +G N+++
Sbjct: 261 EFIICVNKVDRLEDVQMYKEAESRVKELTKPFT----GSTSITIIPTSGLNGINLVK 313



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +1

Query: 40  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 147
           T +N+VV G VD GKST  GHL+   G +D R + +
Sbjct: 113 TSLNVVVCGRVDVGKSTLLGHLLTLLGAVDSRLLRE 148


>UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB403C UniRef100
           entry - Canis familiaris
          Length = 300

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 29/60 (48%), Positives = 38/60 (63%)
 Frame = +2

Query: 452 GVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLE 631
           G+KQLIVG  K+D TE  Y     ++  R+  +  KKIGY+P  VAF  IS W+GD+M E
Sbjct: 1   GMKQLIVGGGKVDFTESSYSQKRDKEPVRESTY-IKKIGYHPDTVAFASISIWNGDDMPE 59


>UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. NRRL B-14911|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. NRRL B-14911
          Length = 618

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/84 (33%), Positives = 45/84 (53%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           +E     V++ID PGH  FI+ MI G +  D  +L+VAA  G          QT+EH  +
Sbjct: 42  YEDEDLEVSVIDVPGHERFIRQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLQI 94

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYV 511
              LG+++ IV ++K D  +  ++
Sbjct: 95  LGFLGIEKGIVVISKADRVDEEFI 118


>UniRef50_A3SGF9 Cluster: Translation elongation factor,
           selenocysteine-specific; n=2; Sulfitobacter|Rep:
           Translation elongation factor, selenocysteine-specific -
           Sulfitobacter sp. EE-36
          Length = 623

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 31/68 (45%), Positives = 42/68 (61%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           +IDAPGH DFI+ M++G S A  A+L+V+A       GI+   QTREH  +A  L V   
Sbjct: 57  LIDAPGHEDFIRTMVSGASGAQGAMLVVSA-----VEGIA--AQTREHVQIARLLQVPVA 109

Query: 467 IVGVNKMD 490
           +V V K+D
Sbjct: 110 VVAVTKVD 117


>UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Rubrobacter xylanophilus DSM
           9941|Rep: Selenocysteine-specific translation elongation
           factor - Rubrobacter xylanophilus (strain DSM 9941 /
           NBRC 16129)
          Length = 612

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 34/117 (29%), Positives = 60/117 (51%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           +++D PGH  F+KNM+ G++  D  +L++AA  G          QTREH  +   LGV++
Sbjct: 61  SLVDVPGHERFVKNMVAGSTGVDAFLLVIAADDGVMP-------QTREHLDVLRVLGVER 113

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +V + K+D+ +    +     +R +     ++ G        VP+SG  G+ + EL
Sbjct: 114 GVVALTKIDAVD----AETAELARLEAEEFLEESG---VRAPIVPVSGVTGEGVDEL 163


>UniRef50_A1FN34 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Pseudomonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Pseudomonas putida W619
          Length = 640

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 1/133 (0%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH  FI NM+ G    D  +L+VAA  G          QTREH  +   LG+   +
Sbjct: 57  IDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMP-------QTREHLAIIELLGIPLAL 109

Query: 470 VGVNKMDSTEPPYVSP-DLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKC 646
           V ++K D   P  V+   ++ ++   P  +       A  A  P+S   G+ +  L+   
Sbjct: 110 VAISKCDRVAPVRVAEVQVQIAQLLAPGPY-------AGAAQFPLSSVTGEGVEALRHAL 162

Query: 647 LGSRDGQVERKVR 685
           L + +G  +R VR
Sbjct: 163 LAAGEGLKQRSVR 175


>UniRef50_Q46497 Cluster: Selenocysteine-specific elongation factor;
           n=4; Desulfovibrionales|Rep: Selenocysteine-specific
           elongation factor - Desulfovibrio baculatus
           (Desulfomicrobium baculatus)
          Length = 634

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/82 (34%), Positives = 44/82 (53%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T +  + IID PGH  F+KNM++G +  D  +L++AA  G          QTREH  +  
Sbjct: 50  TPEVRLGIIDVPGHERFVKNMVSGAAGIDFVLLVIAADEGIMP-------QTREHLEICS 102

Query: 446 TLGVKQLIVGVNKMDSTEPPYV 511
            LG++  +V + K D  E  ++
Sbjct: 103 LLGIRAGLVALTKTDMVEEDWL 124


>UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Proteobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Geobacter sulfurreducens
          Length = 636

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I+D PGH  F++ M+ G    D  +L++AA  G          QTREH  +   LGVK+ 
Sbjct: 58  IVDVPGHERFVRTMVAGVGGMDLVMLVIAADEGVMP-------QTREHLEICQLLGVKKG 110

Query: 467 IVGVNKMDSTEPPYV 511
           +V + K D  +P ++
Sbjct: 111 LVALTKSDMVDPDWL 125


>UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Selenocysteine-specific translation
           elongation factor - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 641

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/77 (35%), Positives = 41/77 (53%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           ++IID PGH  FIKNM+ G S  D  +L++AA  G          QT+EH  +   LG+K
Sbjct: 55  LSIIDVPGHEKFIKNMVAGASGIDVVMLVIAADEGVMP-------QTKEHIEICSLLGIK 107

Query: 461 QLIVGVNKMDSTEPPYV 511
              + + K D  +  ++
Sbjct: 108 HGFIVLTKTDIVDKEWL 124


>UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:
           NEQ270 - Nanoarchaeum equitans
          Length = 396

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/70 (40%), Positives = 39/70 (55%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           ++++DAPGH   I  M++G +  D AVL+VAA  G          QT EH   A  +G+K
Sbjct: 79  ISLVDAPGHESLIMVMLSGAALVDAAVLVVAANEGIMP-------QTIEHLKAAEIMGIK 131

Query: 461 QLIVGVNKMD 490
             IV  NK+D
Sbjct: 132 HFIVAQNKID 141


>UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2080|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2080
          Length = 641

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/70 (42%), Positives = 38/70 (54%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGHR FI  MI+G S  D  +L+VAA  G          QT EH  +   LGV+ + 
Sbjct: 56  IDVPGHRKFINTMISGISGVDMGLLVVAADDGPMP-------QTLEHIDVLEILGVESVC 108

Query: 470 VGVNKMDSTE 499
           V +NK+D  E
Sbjct: 109 VVINKIDRVE 118


>UniRef50_Q3E0L1 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=1; Chloroflexus aurantiacus J-10-fl|Rep:
           Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain - Chloroflexus aurantiacus J-10-fl
          Length = 622

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 38/118 (32%), Positives = 60/118 (50%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V++ID PGH  FIKNM+ G    D  +L++AA     EA +    QTREH  +   L ++
Sbjct: 60  VSLIDVPGHERFIKNMLAGVGGIDAVLLVIAAD----EAVMP---QTREHLAIIDLLAIR 112

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
             IV ++K+D  +  ++   +R+  R+        G   A+   VP+S   G  + EL
Sbjct: 113 HGIVVLSKVDLVDADWLEL-VREEVRE-----ALAGSTLASAPIVPVSARTGAGLAEL 164


>UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1;
           Plasmodium vivax|Rep: Elongation factor, putative -
           Plasmodium vivax
          Length = 833

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/61 (39%), Positives = 40/61 (65%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +NI+V+GH+D+GKST  G L+Y    + ++T++K+E   +     S KY ++LD+   ER
Sbjct: 118 LNILVLGHIDAGKSTLIGALLYNLSYVSEQTVKKYEHVRE-----SSKYTFILDEEDDER 172

Query: 226 E 228
           E
Sbjct: 173 E 173



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V I D PGH + + N+ T +  AD A+L+V A          KN +T  +  +   +G+ 
Sbjct: 257 VNIFDTPGHNELVTNLHTWSFFADTAILVVDAN----NIYSKKNDETYRNVSILKAVGIS 312

Query: 461 QLIVGVNKMDSTE-PPYVSPDLRKS 532
            +IV VNK+D  +  P V  D+ K+
Sbjct: 313 NVIVAVNKLDLFDYDPEVFADICKT 337


>UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein
           translation Elongation Factor; n=1; Syntrophus
           aciditrophicus SB|Rep: Selenocysteine-specific protein
           translation Elongation Factor - Syntrophus
           aciditrophicus (strain SB)
          Length = 636

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 33/116 (28%), Positives = 57/116 (49%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D PGH  F+KNM+ G +  D  ++++AA  G          QTREH  +   L +++ 
Sbjct: 58  VVDVPGHERFVKNMVAGAAGIDMVLMVIAADEGVMP-------QTREHLQICSLLNIRKG 110

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
           +V + K+D      V  D  +  R+    F K  +  +A   +P+S   G+ + EL
Sbjct: 111 LVALTKID-----LVDRDWMELIREDITDFLKGSFLESA-PVIPVSSQTGEGLTEL 160


>UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation factor
           SelB; n=2; Helicobacteraceae|Rep:
           Selenocysteine-specific elongation factor SelB -
           Helicobacter hepaticus
          Length = 632

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/75 (37%), Positives = 37/75 (49%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V  ID PGH   +KNMI G    D  +L++AA  G          Q+ EH L+A  LG+ 
Sbjct: 59  VAFIDVPGHNKLVKNMIAGAFGIDVLLLVIAANEGIMP-------QSIEHLLIADMLGIS 111

Query: 461 QLIVGVNKMDSTEPP 505
             I  + K+D  E P
Sbjct: 112 SCICVITKIDKLENP 126


>UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophomonas wolfei subsp.
           wolfei str. Goettingen|Rep: Selenocysteine-specific
           translation elongation factor - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 631

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/81 (34%), Positives = 41/81 (50%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFT 448
           S +   I+D PGH  FI++M+ G    D  V ++AA  G          QTREH  +   
Sbjct: 52  SGHKAAIVDVPGHERFIRHMLAGAFGIDMVVFVIAADEGIMP-------QTREHLDIIEL 104

Query: 449 LGVKQLIVGVNKMDSTEPPYV 511
           LGVKQ +V + K D  +  ++
Sbjct: 105 LGVKQGVVAITKKDLVDEEWL 125


>UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 637

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/90 (32%), Positives = 44/90 (48%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I+D PGH  FI NM+ G    D  +L++AA  G          QTREH  +   LG+++ 
Sbjct: 58  IVDVPGHEKFINNMVAGVVGMDLVLLVIAADEGIMP-------QTREHMDILNLLGIEKS 110

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTF 556
           I+ +NK D  +  ++       R +   TF
Sbjct: 111 IIVLNKCDLVDEEWLEMMEEDVREELSGTF 140


>UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophobacter fumaroxidans
           MPOB|Rep: Selenocysteine-specific translation elongation
           factor - Syntrophobacter fumaroxidans (strain DSM 10017
           / MPOB)
          Length = 642

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/73 (36%), Positives = 39/73 (53%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I+D PGH  F+K+M+ G +  D   L++AA  G          QTREH  +   L VKQ 
Sbjct: 58  IVDVPGHERFVKHMVAGATGIDLVALVIAADEGVMP-------QTREHMEICELLRVKQG 110

Query: 467 IVGVNKMDSTEPP 505
           +V + K+D  + P
Sbjct: 111 LVVLTKIDLVDDP 123


>UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=4; Vibrionaceae|Rep:
           Hypothetical selenocysteine-specific translation
           elongation factor - Photobacterium profundum 3TCK
          Length = 616

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/78 (29%), Positives = 41/78 (52%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH  +++NM+ G    +  +L+VAA  G           T  H  +A  +G++
Sbjct: 64  IGVIDVPGHERYLRNMVAGVWHLNALILVVAADEGWMP-------MTTSHVQVAHAMGIE 116

Query: 461 QLIVGVNKMDSTEPPYVS 514
           ++I+ +NK D   P  +S
Sbjct: 117 EIILCINKRDKVSPERLS 134


>UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=3;
           Clostridiales|Rep: Small GTP-binding protein
           domain:Sulfate adenylyltransferase, large subunit -
           Clostridium phytofermentans ISDg
          Length = 563

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 32/124 (25%), Positives = 54/124 (43%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R F T      + D PGH ++ +NM  G S A   ++++ A  G          QT+ H+
Sbjct: 76  RYFTTKNRSFIVADTPGHEEYTRNMAVGASFAQLTIILIDAKQGVLL-------QTKRHS 128

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
            +   +G+   +  VNKMD  +  Y      + +R      K +  +   V  +P+S   
Sbjct: 129 RICSFMGIHHFVFAVNKMDLVD--YSEERFLEIKRNILELAKDLSLH--NVKIIPVSATL 184

Query: 614 GDNM 625
           GDN+
Sbjct: 185 GDNV 188



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIY--KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 219
           +  +  G VD GKST  GH++Y  K    D+      + +    G G   Y+ +LD L+A
Sbjct: 5   LKFITCGSVDDGKSTLIGHILYDSKLLYTDQENALMLDSKVGSRG-GEIDYSLLLDGLEA 63

Query: 220 ERE 228
           ERE
Sbjct: 64  ERE 66


>UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation factor;
           n=8; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Clostridium perfringens
          Length = 635

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 29/68 (42%), Positives = 38/68 (55%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           IID PGH  FIKNM+ G +  D  +LI+A      + GI    QT+EH  +   L VK+ 
Sbjct: 58  IIDVPGHEKFIKNMLAGATSLDVVLLIIA-----LDEGIMP--QTKEHLEILELLEVKKC 110

Query: 467 IVGVNKMD 490
           IV + K D
Sbjct: 111 IVALTKRD 118


>UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 304

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/62 (40%), Positives = 37/62 (59%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ET+K +   +D PGH D+ KNMITG +Q D ++ +V A  G          +T+EH L
Sbjct: 215 EYETAKRHYAHVDCPGHADYEKNMITGAAQMDVSIQVVFAPNGPMP-------RTKEHIL 267

Query: 437 LA 442
           LA
Sbjct: 268 LA 269


>UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Hyphomonas neptunium ATCC
           15444|Rep: Selenocysteine-specific translation
           elongation factor - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 623

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/74 (39%), Positives = 43/74 (58%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + ++DAPGH++FI+ M+ G + A  A L+V+A  G  EA      QT EH  +  TLG+ 
Sbjct: 55  IDLVDAPGHQNFIRAMVGGAAGARSAALVVSAAEG-VEA------QTLEHIAVIETLGIH 107

Query: 461 QLIVGVNKMDSTEP 502
             IV ++K D   P
Sbjct: 108 AGIVVLSKADLVAP 121


>UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation
           elongation factor; n=13; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor -
           Campylobacter curvus 525.92
          Length = 605

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  ID PGH   +K MI+G    D  +L+VAA  G          QT+EH  +   LGV 
Sbjct: 54  IAFIDVPGHESLVKTMISGAFGFDACLLVVAANEGIMP-------QTKEHINILSLLGVN 106

Query: 461 QLIVGVNKMD 490
            +IV + K D
Sbjct: 107 SIIVAITKSD 116


>UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 629

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/71 (38%), Positives = 39/71 (54%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +  ++D PGH  FI+NM++G + A   +L V AG G          QTREH  L   LG+
Sbjct: 55  WADLVDVPGHEKFIRNMLSGAAGAGGVLLTVDAGKGIMP-------QTREHLALCALLGM 107

Query: 458 KQLIVGVNKMD 490
           ++ IV + K D
Sbjct: 108 ERGIVALTKAD 118


>UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit
           gamma; n=48; Archaea|Rep: Translation initiation factor
           2 subunit gamma - Methanosarcina acetivorans
          Length = 443

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C  K E  +  V+ +DAPGH   +  M++G +  D AVL++AA             QT+E
Sbjct: 108 CGEKTEEHRI-VSFVDAPGHETLMATMLSGAAIMDGAVLVIAANEE------CPQPQTKE 160

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H +    +G+K +++  NK+D
Sbjct: 161 HLMALDIIGIKNIVIVQNKID 181


>UniRef50_A6G2B2 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Plesiocystis pacifica
           SIR-1|Rep: Translation elongation factor,
           selenocysteine-specific - Plesiocystis pacifica SIR-1
          Length = 696

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 1/128 (0%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           K   +  ++ I+D PGH   ++ M+ G    D  +L+++A     E G+    QTREH  
Sbjct: 64  KKRAAPLHLGIVDVPGHEALVRTMVAGAGGMDAVLLVISA-----EDGVMP--QTREHLH 116

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVA-FVPISGWH 613
           +   LG++  +V + K+D  +                   +++   P A A  VP+S   
Sbjct: 117 VCELLGLRHAVVALTKIDRLDGESEDDKEELLELAREDIREQLAATPFAEAPIVPVSAHS 176

Query: 614 GDNMLELQ 637
           G+ + EL+
Sbjct: 177 GEGLEELR 184


>UniRef50_A0KL71 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Aeromonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 627

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/74 (33%), Positives = 38/74 (51%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH  +I+NM+ G    D  +L++AA  G           T +H  L   +GV 
Sbjct: 57  IGVIDVPGHERYIRNMVAGLWSLDLVLLVIAADEGWMP-------MTGDHLRLLKAMGVP 109

Query: 461 QLIVGVNKMDSTEP 502
           +L+V +NK D   P
Sbjct: 110 RLLVCINKCDLVTP 123


>UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative;
           n=6; Plasmodium|Rep: Elongation factor Tu family,
           putative - Plasmodium yoelii yoelii
          Length = 597

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/61 (37%), Positives = 39/61 (63%)
 Frame = +1

Query: 46  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 225
           +NI+V+GH+D+GKST  G L+Y    ++ + ++K+E   +     S KY ++LD+   ER
Sbjct: 107 LNILVLGHIDAGKSTLIGALLYNLNYVNDQMLKKYENIRE-----SSKYTYILDEEGDER 161

Query: 226 E 228
           E
Sbjct: 162 E 162



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V I D PGH + + N+ T +  ADCA+L+V A          KN +T  +  +   +G+ 
Sbjct: 226 VNIFDTPGHNELVNNLHTCSFFADCAILVVDAN----NVYNKKNDETYRNVCILKYVGIS 281

Query: 461 QLIVGVNKMD 490
            +I+ +NK+D
Sbjct: 282 NIIIVINKID 291


>UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation factor;
           n=1; Symbiobacterium thermophilum|Rep:
           Selenocysteine-specific elongation factor -
           Symbiobacterium thermophilum
          Length = 629

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/75 (33%), Positives = 39/75 (52%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           +ID PGH  F++NM+ G +  D  +L+VAA  G          QTREH  +   L + + 
Sbjct: 58  VIDVPGHEKFVRNMLAGITGIDLVILVVAADEGVMP-------QTREHLDILRLLEISKG 110

Query: 467 IVGVNKMDSTEPPYV 511
           +V + K+D  +   V
Sbjct: 111 LVAITKIDLVDEEMV 125


>UniRef50_Q47F25 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Dechloromonas aromatica
           RCB|Rep: Translation elongation factor,
           selenocysteine-specific - Dechloromonas aromatica
           (strain RCB)
          Length = 627

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH   I NM+ G +  D A+L++AA  G          QTREH  +   LG+K+  
Sbjct: 51  IDVPGHEKLIHNMLAGATGIDFALLVIAADDGPMP-------QTREHLEIIELLGIKRGA 103

Query: 470 VGVNKMDS 493
           V + K+D+
Sbjct: 104 VALTKIDN 111


>UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_131, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 355

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 415
           FE      TI+DA GH++++ NMI+G SQ D  +L++ A   +FE G  ++G
Sbjct: 73  FEPETTRFTILDAWGHKNYVPNMISGASQVDIGMLVIYAQKVKFETGGERSG 124


>UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation elongation
           factor, GTPase - Methanopyrus kandleri
          Length = 358

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/70 (40%), Positives = 40/70 (57%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V+ +D PGHRD+I+NM+     AD A+L+VAA  G           T +HAL+    G +
Sbjct: 63  VSFVDVPGHRDYIRNMLASAWSADYAILVVAADEGPCPG-------TIDHALVVSFYGAR 115

Query: 461 QLIVGVNKMD 490
            L V V+K+D
Sbjct: 116 VLPV-VSKVD 124


>UniRef50_A0YGX4 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; marine gamma
           proteobacterium HTCC2143|Rep: Translation elongation
           factor, selenocysteine-specific - marine gamma
           proteobacterium HTCC2143
          Length = 627

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +2

Query: 245 YCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 424
           Y  +K +  +  +  ID PGH  FI +MI G    D A+L+VAA  G          QT 
Sbjct: 42  YAFKKLDDGQV-IGFIDVPGHTRFINSMIAGVGGIDMAMLVVAADDGVMP-------QTT 93

Query: 425 EHALLAFTLGVKQLIVGVNKMDSTE 499
           EH  +   LG +Q +V + K+D  +
Sbjct: 94  EHLDVLRLLGQQQFVVVITKIDRVD 118


>UniRef50_Q46455 Cluster: Selenocysteine-specific elongation factor;
           n=5; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Moorella thermoacetica (Clostridium
           thermoaceticum)
          Length = 634

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/75 (33%), Positives = 39/75 (52%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D PGH  FI+ M+ G    D  +L+VAA  G          QTREH  +   L +K+ 
Sbjct: 58  LVDVPGHERFIRQMLAGVGGMDLVMLVVAADEGVMP-------QTREHLAIIDLLQIKKG 110

Query: 467 IVGVNKMDSTEPPYV 511
           I+ + K+D  E  ++
Sbjct: 111 IIVITKIDLVEADWL 125


>UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfitobacterium
           hafniense|Rep: Selenocysteine-specific translation
           elongation factor - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 634

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/77 (32%), Positives = 39/77 (50%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V+IID PGH  F+K M+ G +  D  +L++AA  G          QTREH  +   L V 
Sbjct: 56  VSIIDVPGHEKFVKTMVAGVTGIDLVMLVIAADEGIMP-------QTREHLDILNLLNVT 108

Query: 461 QLIVGVNKMDSTEPPYV 511
             ++ + K D  +  ++
Sbjct: 109 TGVIALTKTDLVDDEWL 125


>UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding;
           n=1; Metallosphaera sedula DSM 5348|Rep: Protein
           synthesis factor, GTP-binding - Metallosphaera sedula
           DSM 5348
          Length = 415

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 26/70 (37%), Positives = 39/70 (55%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V+ +DAPGH   +  M++GT+  D A+L+VAA             QTREH +     G+ 
Sbjct: 89  VSFVDAPGHEVLMATMLSGTAILDGAILVVAANEP------FPQPQTREHFVALGIAGIN 142

Query: 461 QLIVGVNKMD 490
           +LI+  NK+D
Sbjct: 143 KLIIVQNKVD 152


>UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14696,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 395

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 31/79 (39%), Positives = 43/79 (54%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E+ +YY T  D P H D+IK         D  +L+VAA  G+         QTREH LLA
Sbjct: 76  ESRRYYHT--DCPAHADYIK--------MDGCILVVAATGGQMP-------QTREHLLLA 118

Query: 443 FTLGVKQLIVGVNKMDSTE 499
             +GV+ ++V +NK D+ E
Sbjct: 119 RQIGVEHVVVFINKADAVE 137


>UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation
           factor; n=4; Alphaproteobacteria|Rep: SelB
           selenocysteine-specific elongation factor - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 666

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 27/71 (38%), Positives = 37/71 (52%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           +D PGH  FI  M+ G    D A+L+VAA     + GI    QT EH  +   LGV + +
Sbjct: 56  VDVPGHERFIHTMLAGAGGIDYAMLVVAA-----DDGIKP--QTLEHLAILDLLGVSRGL 108

Query: 470 VGVNKMDSTEP 502
           V + K D  +P
Sbjct: 109 VAITKADLADP 119


>UniRef50_Q1NKM4 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=3; Deltaproteobacteria|Rep: Translation
           elongation factor, selenocysteine-specific:Small GTP-
           binding protein domain - delta proteobacterium MLMS-1
          Length = 639

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           I+D PGH  F++NM+ G +  D    +VAA  G          QTREH  +   LG+++ 
Sbjct: 58  IVDVPGHERFVRNMVAGAAGIDLVAFVVAADEGIMP-------QTREHFEICRLLGIQRG 110

Query: 467 IVGVNKMD 490
           ++ + K D
Sbjct: 111 LIVITKRD 118


>UniRef50_Q1ETS8 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=6; Clostridiales|Rep: Translation elongation
           factor, selenocysteine-specific:Small GTP- binding
           protein domain - Clostridium oremlandii OhILAs
          Length = 631

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           IID PGH  FI+NM+ G S  D  +L+VAA  G          QT+EH  +   L +++ 
Sbjct: 58  IIDVPGHEKFIRNMLAGVSGMDIVLLVVAADEGVMP-------QTKEHLDILSLLKIEKG 110

Query: 467 IVGVNKMDSTEPPYV 511
           I+ + K    +  +V
Sbjct: 111 IIVITKASLVDDEWV 125


>UniRef50_O36041 Cluster: Eukaryotic translation initiation factor 2
           subunit gamma; n=1; Spironucleus vortens|Rep: Eukaryotic
           translation initiation factor 2 subunit gamma -
           Spironucleus vortens
          Length = 210

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +++IID PGH D++  M++G +  D  +L+++A     E    +  QTREH       G 
Sbjct: 80  HISIIDCPGHHDYMTTMLSGVAAMDGTLLLISA-----EQRCPQE-QTREHFQAIQATGQ 133

Query: 458 KQLIVGVNKMD 490
           K++I+  NK+D
Sbjct: 134 KKIIIAQNKID 144


>UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromonas
           sp. CNPT3|Rep: Selenocysteine synthase - Psychromonas
           sp. CNPT3
          Length = 523

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + I+D PGH  +I+NM++G +  +  +L+++A  G           T +H  +A  LG  
Sbjct: 62  IGIVDVPGHERYIRNMVSGIANLNAVILVISATEGWMP-------MTTDHVQIAQALGQT 114

Query: 461 QLIVGVNKMD 490
            +I+ +NK D
Sbjct: 115 NIIICINKSD 124


>UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation
           elongation factor precursor; n=5; Cystobacterineae|Rep:
           Selenocysteine-specific translation elongation factor
           precursor - Anaeromyxobacter sp. Fw109-5
          Length = 649

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 38/131 (29%), Positives = 57/131 (43%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D PGH  F++ M  G    D  VL++AA  G          QTREH  +   LGV + 
Sbjct: 58  VVDVPGHERFVRAMAAGAGGIDLVVLVIAADEGVMP-------QTREHLDICRLLGVPRG 110

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKC 646
           +V V K D    P +  D      +      + G      A VP+S   G+ + EL+   
Sbjct: 111 LVAVTKSDLL--PELGTDWLPLLEQDVREVTR-GTFLEGAAIVPVSAATGEGLDELRAG- 166

Query: 647 LGSRDGQVERK 679
           LG    +V+ +
Sbjct: 167 LGRLAAEVQER 177


>UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2143|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2143
          Length = 642

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/70 (35%), Positives = 36/70 (51%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V  ID PGH+ FI NM+TG +  D A+L++AA  G          QT EH      +G+ 
Sbjct: 52  VGFIDVPGHQKFIANMLTGIAALDLALLVIAADDGPMP-------QTYEHLAALNLMGLT 104

Query: 461 QLIVGVNKMD 490
           +  + + K D
Sbjct: 105 RAAIVITKTD 114


>UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_58, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 177

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           ++ET+K +   +D PGH D++KNMITG +Q D ++ +V
Sbjct: 111 EYETAKRHCDHVDCPGHADYVKNMITGAAQMDGSIQVV 148


>UniRef50_Q30SC0 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Translation elongation
           factor, selenocysteine-specific - Thiomicrospira
           denitrificans (strain ATCC 33889 / DSM 1351)
          Length = 611

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/70 (35%), Positives = 34/70 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  ID PGH   +KNMI G    DC +++V+   G          QT EH  +   LGVK
Sbjct: 55  IAFIDVPGHEKLVKNMIAGAFSFDCVLIVVSVIDG-------IKPQTIEHLEILNLLGVK 107

Query: 461 QLIVGVNKMD 490
             ++ V K D
Sbjct: 108 NAVLVVTKKD 117


>UniRef50_Q57918 Cluster: Selenocysteine-specific elongation factor;
           n=7; Methanococcales|Rep: Selenocysteine-specific
           elongation factor - Methanococcus jannaschii
          Length = 469

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/77 (33%), Positives = 41/77 (53%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           F   +Y +T++DAPGH + I+  I   +  D A+L+V A  G          QT EH L+
Sbjct: 58  FTLDRYRITLVDAPGHSELIRTAIGAGNIIDAALLVVDAKEG-------PKTQTGEHLLV 110

Query: 440 AFTLGVKQLIVGVNKMD 490
              L +  ++V +NK+D
Sbjct: 111 LDLLNIPTIVV-INKID 126


>UniRef50_P43927 Cluster: Selenocysteine-specific elongation factor;
           n=21; Pasteurellaceae|Rep: Selenocysteine-specific
           elongation factor - Haemophilus influenzae
          Length = 619

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH  F+ NM+ G      A+LIVAA     + G++   QT+EH  +   L   ++I
Sbjct: 55  IDVPGHEKFLSNMLAGLGGVHYAMLIVAA-----DEGVAV--QTKEHLAILRQLQFHEII 107

Query: 470 VGVNKMDSTEPPYVSPDLRKSRRKY 544
           V + K D T    +   ++  ++ Y
Sbjct: 108 VVITKADRTNSAQIESLIQTIKQDY 132


>UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5;
           Helicobacteraceae|Rep: Translation initiation factor
           IF-2 - Helicobacter pylori (Campylobacter pylori)
          Length = 944

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 7/130 (5%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E +  +V+ ID PGH  F +    G    D AV+++AA  G  +  I    +  EHA  A
Sbjct: 488 EKNDKWVSFIDTPGHEAFSQMRNRGAQVTDIAVIVIAADDGVKQQTI----EALEHAKAA 543

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNP----AAVAFVPISGW 610
                  +I  +NKMD    P V+PD  K+         ++GYNP        F+P+S  
Sbjct: 544 NV----PVIFAMNKMDK---PNVNPDKLKAE------CAELGYNPVDWGGEHEFIPVSAK 590

Query: 611 HG---DNMLE 631
            G   DN+LE
Sbjct: 591 TGDGIDNLLE 600


>UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Treponema denticola|Rep:
           Selenocysteine-specific translation elongation factor -
           Treponema denticola
          Length = 590

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V I+D PGH  FI+NM+ GT   D A+LIVAA  G  +        + +H  +   + ++
Sbjct: 55  VGIVDVPGHERFIRNMVAGTWGLDAALLIVAADDGWMQ-------MSSDHLRVLKAMKIE 107

Query: 461 QLIVGVNKMDSTE 499
            +++ + K D  E
Sbjct: 108 SILLVITKSDLAE 120


>UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 655

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V ++D PGH  +++ M+ G +  D AVL+V+A  G          QTREH  +   LGV 
Sbjct: 64  VGLVDVPGHSHYLRAMVQGATGIDVAVLVVSAVEGVMP-------QTREHVHVLELLGVT 116

Query: 461 QLIVGVNKMD 490
            ++V +   D
Sbjct: 117 HMVVALTMCD 126


>UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep:
           CG12413-PA - Drosophila melanogaster (Fruit fly)
          Length = 696

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 43/137 (31%), Positives = 62/137 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQP 640
            +IV +NK+D  E      ++ KS+R+       +  +   V  +PIS   G N LEL  
Sbjct: 264 PIIVALNKIDKPE-----ANIEKSKRELAQMGLALEEHGGDVQVIPISALKGTN-LELLA 317

Query: 641 KCLGSRDGQVERKVRPS 691
           + + ++   +  K  P+
Sbjct: 318 EAVSTQATLMGLKADPT 334


>UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1;
           n=3; Caenorhabditis|Rep: Putative uncharacterized
           protein selb-1 - Caenorhabditis elegans
          Length = 500

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           + +ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      
Sbjct: 74  LALIDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPN 126

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRR 538
           ++I+ +NK D  E   +S   +K R+
Sbjct: 127 RVIIVLNKCDLAEKSKISESAKKVRK 152


>UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 446

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 36/123 (29%), Positives = 51/123 (41%), Gaps = 1/123 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL- 436
           F  S    T+I+ PG   +I  M  G +  + AV +++ G  E      K   T E  L 
Sbjct: 80  FTISNKKYTLINIPGQYQYINQMQLGIAYGEIAVFVLS-GVKEKYVQDFKGQSTLELQLR 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L   LG K +I  +N MD  E  Y           +     K   NP  ++FVPIS    
Sbjct: 139 LWMALGKKHIICAINDMDLVE--YQQDCYEYVVNDFSQRLAKFEINPKQISFVPISLIDA 196

Query: 617 DNM 625
           +N+
Sbjct: 197 ENI 199



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/59 (23%), Positives = 32/59 (54%)
 Frame = +1

Query: 52  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           +V++G    GKST  G ++ +   +    + + ++  Q       +YA+++D+L+ ER+
Sbjct: 10  VVLLGAHGQGKSTVAGLIVNELNYVSPYALVRIDEHPQVQENPHLRYAFLMDRLRTERK 68


>UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex
           aeolicus|Rep: Elongation factor SelB - Aquifex aeolicus
          Length = 582

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/71 (38%), Positives = 34/71 (47%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           IID PGH  FIKN I G   A   +L+V    G          QT EH  +A + G+K  
Sbjct: 59  IIDVPGHERFIKNAIAGICSASGLILVVDPNEGIMP-------QTIEHLRVAKSFGIKHG 111

Query: 467 IVGVNKMDSTE 499
           I  + KMD  +
Sbjct: 112 IAVLTKMDKVD 122


>UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfuromonas acetoxidans DSM
           684|Rep: Selenocysteine-specific translation elongation
           factor - Desulfuromonas acetoxidans DSM 684
          Length = 642

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 26/90 (28%), Positives = 41/90 (45%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 466
           ++D PGH  FI NM+ G    D  +L++    G          QT EH  +   L +++ 
Sbjct: 63  VVDVPGHERFISNMLAGIGGIDLVLLVIDVMEGMMP-------QTHEHLEILELLQIRRG 115

Query: 467 IVGVNKMDSTEPPYVSPDLRKSRRKYPHTF 556
           I+ +NK D  E  ++     + R K   TF
Sbjct: 116 IIVLNKCDLAEEDWIELVEEEIREKVRGTF 145


>UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 563

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 33/111 (29%), Positives = 51/111 (45%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           T++D PGH   IK ++ G S  D  +L+V A     + G+    QT E  L+   +   +
Sbjct: 77  TLVDCPGHASLIKTVLGGASIIDLMILVVDA-----QKGVQT--QTAE-CLVVGEITTDR 128

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LIV VNK+D+         + K + K    F K  +     A +P+S   G
Sbjct: 129 LIVAVNKIDAFAEEVREEKVAKMQAKLASVFAKTKFK--GCAMLPVSARPG 177


>UniRef50_P14081 Cluster: Selenocysteine-specific elongation factor;
           n=33; Enterobacteriaceae|Rep: Selenocysteine-specific
           elongation factor - Escherichia coli (strain K12)
          Length = 614

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/70 (35%), Positives = 32/70 (45%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILQLTGNPMLT 108

Query: 470 VGVNKMDSTE 499
           V + K D  +
Sbjct: 109 VALTKADRVD 118


>UniRef50_A3Q882 Cluster: Selenocysteine-specific translation
           elongation factor; n=6; Mycobacterium|Rep:
           Selenocysteine-specific translation elongation factor -
           Mycobacterium sp. (strain JLS)
          Length = 570

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  +D PGH  F+ NM+ G       + +VAA  G          Q+ EH      LGV+
Sbjct: 53  MAFVDVPGHERFVANMLAGVGPVPAVMFVVAATEGWMP-------QSEEHLAALDALGVR 105

Query: 461 QLIVGVNKMDSTEP 502
             ++ V K D T+P
Sbjct: 106 HALLIVTKADLTDP 119


>UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Acidobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Acidobacteria bacterium (strain Ellin345)
          Length = 628

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/73 (34%), Positives = 38/73 (52%)
 Frame = +2

Query: 272 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 451
           K  +  +D PGH  FI+NM+ G    D  +LI++A     E  I    QTREH  +   L
Sbjct: 57  KLRIGFVDVPGHERFIRNMLAGVGGIDLVMLIISA-----EESIKP--QTREHFDICRML 109

Query: 452 GVKQLIVGVNKMD 490
           G+++ +  + K D
Sbjct: 110 GIERGLTVLTKSD 122


>UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Selenocysteine-specific translation
           elongation factor - Herpetosiphon aurantiacus ATCC 23779
          Length = 627

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/77 (28%), Positives = 40/77 (51%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V ++D PGH   IKNM+ G +  D  + +VAA  G          Q+ EH  +   LG++
Sbjct: 55  VNLVDVPGHERLIKNMLAGVTGFDGVLFVVAADEG-------MQPQSHEHLQILNQLGIE 107

Query: 461 QLIVGVNKMDSTEPPYV 511
             ++ ++K+D  +  ++
Sbjct: 108 HGLIIISKIDLVDAEWL 124


>UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Translation
           initiation factor IF-2 - Caminibacter mediatlanticus
           TB-2
          Length = 827

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 31/85 (36%), Positives = 40/85 (47%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T ID PGH  F +    G    D A+++VAA  G          QTRE    A    V 
Sbjct: 375 ITFIDTPGHEAFTEMRARGAQVTDIAIIVVAADDGVMP-------QTREAIAHAQAANV- 426

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSR 535
             I+ VNK+D    P  +PDL KS+
Sbjct: 427 PFIIAVNKIDK---PDANPDLVKSQ 448


>UniRef50_Q7Q5R3 Cluster: ENSANGP00000020583; n=3; Diptera|Rep:
           ENSANGP00000020583 - Anopheles gambiae str. PEST
          Length = 522

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 36/122 (29%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = +2

Query: 272 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 451
           K   T +D PGH   I+ +I G    D  +L++ A     E GI    QT E  LL   L
Sbjct: 72  KLQYTFVDCPGHASLIRTIIGGAQIIDMMLLVIDA-----EKGIQP--QTAE-CLLIGEL 123

Query: 452 GVKQLIVGVNKMDS-TEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNML 628
             +++IV +NK+D+  +P   +  L + R+       K+ ++ + +  V IS   G+N+ 
Sbjct: 124 TCRKMIVVLNKVDALQDPAQRTKTLDRLRKGIAGVLSKMSFDASPI--VAISASTGENVS 181

Query: 629 EL 634
            L
Sbjct: 182 AL 183


>UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=104;
           Gammaproteobacteria|Rep: Translation initiation factor
           IF-2 - Idiomarina loihiensis
          Length = 896

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 38/124 (30%), Positives = 50/124 (40%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           ET    VT +D PGH  F      G    D  +L+VAA  G          QT+E    A
Sbjct: 441 ETGHGMVTFLDTPGHAAFTSMRARGAGATDVVILVVAADDGVMP-------QTKEAVQHA 493

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDN 622
              GV  L+V +NKMD        PD  K+         +       V F+P+S   G+ 
Sbjct: 494 KAAGV-PLVVAINKMDKEG---ADPDRVKNELSQLEVIPEDW--GGDVQFIPLSAHTGEG 547

Query: 623 MLEL 634
           + EL
Sbjct: 548 IDEL 551


>UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation factor
           EF; n=11; Yersinia|Rep: Selenocysteine-specific
           elongation factor EF - Yersinia pseudotuberculosis
          Length = 657

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 25/70 (35%), Positives = 32/70 (45%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLANMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILRLSGRPALT 108

Query: 470 VGVNKMDSTE 499
           V + K D  +
Sbjct: 109 VALTKADRVD 118


>UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Shewanella pealeana ATCC
           700345|Rep: Selenocysteine-specific translation
           elongation factor - Shewanella pealeana ATCC 700345
          Length = 635

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 25/73 (34%), Positives = 35/73 (47%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  +D PGH  FI  M+ G S A  A+LI+A   G          QT EH  +   L ++
Sbjct: 53  LAFVDVPGHSKFINTMLAGVSCAKHALLIIACDDGVMP-------QTYEHLAILQLLNLE 105

Query: 461 QLIVGVNKMDSTE 499
            LIV + K D  +
Sbjct: 106 HLIVVLTKQDKVD 118


>UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b gamma
           subunit, putative; n=4; Leishmania|Rep: Translation
           initiation factor eif-2b gamma subunit, putative -
           Leishmania major
          Length = 601

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 26/75 (34%), Positives = 37/75 (49%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T K + + +D PGH   +  M+ G +  D A+L++AA             QT EH   A 
Sbjct: 129 TLKRHFSFVDCPGHDVLMATMLNGAAIMDAALLLIAANES------FPQPQTLEHLAAAE 182

Query: 446 TLGVKQLIVGVNKMD 490
            +GV  LIV  NK+D
Sbjct: 183 MIGVLSLIVLQNKVD 197


>UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation factor,
           putative; n=3; Leishmania|Rep: Selenocysteine-specific
           elongation factor, putative - Leishmania major
          Length = 678

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 3/117 (2%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 433
           R  E +K   T++D PGH   I+ ++ G    D  VL+V A  G          QT E  
Sbjct: 68  RAAELTKVQCTLVDCPGHASLIRTVVGGAQIIDAMVLVVDATKG-------IQVQTAECL 120

Query: 434 LLAFTLGVKQLIVGVNKMDSTE---PPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFV 595
           +L   L  K L+V +NK+D+ +   P      L   +RK    F++  +   A+  V
Sbjct: 121 VLGEVL-AKPLVVVLNKIDAIQGVSPAGKEAALAALKRKLQQVFRRTRWPTVAIVEV 176


>UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibberella
           fujikuroi|Rep: Elongation factor 1-alpha - Gibberella
           fujikuroi var. intermedia
          Length = 87

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 1/66 (1%)
 Frame = +3

Query: 99  SLDLQMWWY*QTYHREVREGGPGNG*RILQICLGIGQTKG*A*XGITIDIAL-GSSKLAS 275
           SLDL + WY Q  HREVREG P +  R+     G   +   +   ++  I L GSS+L +
Sbjct: 17  SLDLPVRWYRQANHREVREGKPLSSVRVPSSTPGFLTSSRPSVSVVSPSILLSGSSRLLA 76

Query: 276 TMLPSL 293
           TM PSL
Sbjct: 77  TMSPSL 82


>UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=225;
           Proteobacteria|Rep: Translation initiation factor IF-2 -
           Bordetella bronchiseptica (Alcaligenes bronchisepticus)
          Length = 997

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 29/79 (36%), Positives = 36/79 (45%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           ET +  VT +D PGH  F      G    D  +L+VAA  G          QTRE A+  
Sbjct: 543 ETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMP-------QTRE-AIHH 594

Query: 443 FTLGVKQLIVGVNKMDSTE 499
              G   L+V VNK+D  E
Sbjct: 595 AKAGGVPLVVAVNKIDKPE 613


>UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3;
           Coelomata|Rep: Elongation factor-1 alpha - Anduzedoras
           oxyrhynchus
          Length = 257

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +2

Query: 584 VAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           VAFVPISGWHGDNMLE        +  ++ERK
Sbjct: 1   VAFVPISGWHGDNMLEPSSNMGWFKGWKIERK 32


>UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5;
           Epsilonproteobacteria|Rep: Translation initiation factor
           IF-2 - Nitratiruptor sp. (strain SB155-2)
          Length = 843

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T ID PGH  F +    G    D A+++VAA  G          QT E    A T  V 
Sbjct: 393 ITFIDTPGHEAFTEMRARGAQATDIAIIVVAADDG-------VKPQTVEAVNHAKTADV- 444

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSR 535
            +IV +NK+D    P  +PDL KS+
Sbjct: 445 PMIVAINKIDK---PEANPDLVKSQ 466


>UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila
           melanogaster|Rep: CG9841-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 511

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 35/118 (29%), Positives = 52/118 (44%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQ 637
           LIV +NK+D       +  L K R +   T +   +    V    +S   G ++ EL+
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAELR 178


>UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gamma
           subunit, putative; n=5; Thermoproteaceae|Rep:
           Translation initiation factor aIF-2 gamma subunit,
           putative - Pyrobaculum aerophilum
          Length = 411

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           ++++D PGH   +  M++G +  D A+L+V A         +   QT EH  +   +GV+
Sbjct: 85  ISLLDVPGHEVLVATMVSGAAVVDGALLVVDASQP------APQPQTVEHFAVLDIIGVR 138

Query: 461 QLIVGVNKMD 490
            ++V  NK+D
Sbjct: 139 HMVVAQNKID 148


>UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 581

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 32/111 (28%), Positives = 52/111 (46%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           T++D PGH   IK +I G S  D   L++     +   GI    QT E  L+   L +++
Sbjct: 97  TLVDCPGHASLIKTIIGGASIIDIMFLVI-----DINKGIQT--QTAE-CLVIGELLMQK 148

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           +IV +NK+D       +  + K   +    F K  +  A+V  +PI+   G
Sbjct: 149 MIVVLNKIDMIPEDKRAETISKKMEQLRKVFSKTKFG-ASVPMIPIAASQG 198


>UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Initiation factor 2 -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 874

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 38/118 (32%), Positives = 53/118 (44%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F +    GT   D  +++VAA  G          QT E   LA    V 
Sbjct: 425 ITFLDTPGHAAFSQMRQRGTDVTDIIIIVVAADDG-------VKPQTEEVIKLAKESKV- 476

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +IV VNKMD    P  +PD+ K++         I +    + F+PIS   G  + EL
Sbjct: 477 PVIVAVNKMDK---PTANPDMVKAQMA-ERGLNPIDWG-GDIEFIPISAKSGMGIDEL 529


>UniRef50_A6DB59 Cluster: Putative selenocysteine-specific
           elongation factor; n=1; Caminibacter mediatlanticus
           TB-2|Rep: Putative selenocysteine-specific elongation
           factor - Caminibacter mediatlanticus TB-2
          Length = 607

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 29/77 (37%), Positives = 36/77 (46%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V  ID PGH   +KNMI+G    D    + A  T E   GI    QT EH  +   L VK
Sbjct: 55  VAFIDVPGHEKLVKNMISGAFGFDAT--LFAIDTNE---GIMP--QTIEHLEVLDILKVK 107

Query: 461 QLIVGVNKMDSTEPPYV 511
            +IV + K D   P  +
Sbjct: 108 NIIVALTKKDLATPELI 124


>UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=12;
           Campylobacterales|Rep: Translation initiation factor
           IF-2 - Helicobacter hepaticus
          Length = 882

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 7/124 (5%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           ++ ID PGH  F +    G    D A++++AA  G  +  I    +   HA  A      
Sbjct: 432 ISFIDTPGHEAFTQMRSRGAQVTDIAIIVIAADDGVKQQTI----EALNHAKAANV---- 483

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNP----AAVAFVPISGWHGD--- 619
           Q+I+ +NKMD       +PD  K+         +IG+ P        F+PIS  +GD   
Sbjct: 484 QIIIAMNKMDKEN---ANPDKLKAE------CAEIGFTPNEWGGEYEFIPISAKNGDGVE 534

Query: 620 NMLE 631
           N+LE
Sbjct: 535 NLLE 538


>UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translation
           factor; n=2; Vibrionaceae|Rep:
           Selenocysteinyl-tRNA-specific translation factor -
           Vibrio angustum S14
          Length = 640

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 25/69 (36%), Positives = 32/69 (46%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           ID PGH  F+ NM+ G   A  A+LIVA   G          Q+ EH  +   L +  L 
Sbjct: 61  IDVPGHEKFLSNMLAGVGTAHHAMLIVAGDEGMM-------AQSYEHLAILRLLAMDSLT 113

Query: 470 VGVNKMDST 496
           V + K D T
Sbjct: 114 VVITKSDLT 122


>UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Shewanella|Rep:
           Selenocysteine-specific translation elongation factor -
           Shewanella sp. (strain MR-4)
          Length = 673

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 24/70 (34%), Positives = 33/70 (47%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  ID PGH  FI NM+ G S    A+L++A   G          QTREH  +   L + 
Sbjct: 53  LAFIDVPGHEKFINNMLVGVSHVRHALLVLACDDGVMP-------QTREHLQILALLPLN 105

Query: 461 QLIVGVNKMD 490
            L + + K D
Sbjct: 106 SLTLVLTKRD 115


>UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr10 scaffold_76, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 112

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 376
           FE      TI+DA GH++ + NMI+  SQAD  +L+++A
Sbjct: 65  FEPEMTRFTILDASGHKNHVPNMISSASQADMGMLVISA 103


>UniRef50_P72689 Cluster: Translation initiation factor IF-2; n=8;
           Cyanobacteria|Rep: Translation initiation factor IF-2 -
           Synechocystis sp. (strain PCC 6803)
          Length = 1001

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 35/116 (30%), Positives = 52/116 (44%), Gaps = 1/116 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +  +D PGH  F      G    D A+L+VAA  G          QT+E    A   GV 
Sbjct: 548 IVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDG-------VQPQTKEAISHAKAAGV- 599

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNM 625
            LIV +NK+D    P  +PD +++   +     ++ G        VP+S  +GDN+
Sbjct: 600 PLIVAINKVDK---PEANPDRIKQELSELGLLAEEWG---GDTIMVPVSALNGDNL 649


>UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation
           factor Tu GTP binding domain containing 1; n=2;
           Apocrita|Rep: PREDICTED: similar to elongation factor Tu
           GTP binding domain containing 1 - Apis mellifera
          Length = 1065

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 22/78 (28%), Positives = 43/78 (55%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           K+   ++ + +ID+PGH DF   + T     D A++++     +   G+    QTR    
Sbjct: 80  KYNCQEFAINLIDSPGHVDFASEVSTAVRLCDGAIIVI-----DVVEGVCP--QTRSALS 132

Query: 437 LAFTLGVKQLIVGVNKMD 490
           +++T G+K ++V +NK+D
Sbjct: 133 ISYTEGLKPILV-LNKID 149


>UniRef50_A6DKQ3 Cluster: Translation initiation factor IF-2; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Translation
           initiation factor IF-2 - Lentisphaera araneosa HTCC2155
          Length = 683

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 30/80 (37%), Positives = 37/80 (46%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G    D  +LIVAA  G        N QT+E AL       +
Sbjct: 235 VTFLDTPGHSAFSAMRQRGADVTDICILIVAADDG-------VNAQTKE-ALKIIMDSER 286

Query: 461 QLIVGVNKMDSTEPPYVSPD 520
            LI+ +NKMD    P  +PD
Sbjct: 287 PLIIAINKMDL---PTANPD 303


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 27/73 (36%), Positives = 37/73 (50%)
 Frame = +2

Query: 272 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 451
           KY + IID PGH DF   +    S  D  +L+V A  G          QTR     AF+ 
Sbjct: 71  KYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEGPMP-------QTRFVTQKAFSY 123

Query: 452 GVKQLIVGVNKMD 490
           G+K ++V +NK+D
Sbjct: 124 GIKPIVV-INKID 135


>UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=152;
           Proteobacteria|Rep: Translation initiation factor IF-2 -
           Psychrobacter arcticum
          Length = 908

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 29/86 (33%), Positives = 40/86 (46%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           +T++  +T +D PGH  F      G    D  VL+VAA  G     + +  +  +HA  A
Sbjct: 454 KTARGVITFLDTPGHAAFSAMRSRGAQATDIVVLVVAADDGM----MPQTEEAIDHARAA 509

Query: 443 FTLGVKQLIVGVNKMDSTEPPYVSPD 520
            T     LIV +NKMD    P   PD
Sbjct: 510 GT----PLIVAINKMDK---PSADPD 528


>UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2;
           Mycoplasmataceae|Rep: Translation initiation factor IF-2
           - Mycoplasma penetrans
          Length = 620

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 27/79 (34%), Positives = 36/79 (45%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E  K+ +T  D PGH  F K    G    D  VL+VAA  G       +  +  +HAL A
Sbjct: 171 EWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGL----KPQTEEAIDHALFA 226

Query: 443 FTLGVKQLIVGVNKMDSTE 499
                  +IV +NKMD  +
Sbjct: 227 ----KAPIIVFINKMDKKD 241


>UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3;
           Anaplasma|Rep: Translation initiation factor IF-2 -
           Anaplasma marginale (strain St. Maries)
          Length = 832

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 36/123 (29%), Positives = 55/123 (44%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      GT+  D  VL+VAA  G          QT E      T GV 
Sbjct: 382 ITFLDTPGHEAFSDMRARGTNVTDIVVLVVAADDGVMP-------QTVESINHVKTAGV- 433

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQP 640
            ++V VNK+D ++       +     ++    +K+G     V  VP+S   G+N+ +L+ 
Sbjct: 434 SMVVAVNKIDRSDANV--DKITNDLLQHGVVPEKLG---GDVMIVPVSAKTGENLDKLKS 488

Query: 641 KCL 649
             L
Sbjct: 489 SIL 491


>UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation factor
           gamma SU; n=2; Eukaryota|Rep: Eukaryotic translation
           initiation factor gamma SU - Guillardia theta
           (Cryptomonas phi)
          Length = 491

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C RK +  K+ ++++D PGH   +  M+ G S  + A+L++AA             QT E
Sbjct: 146 CHRKLKLIKH-ISLVDCPGHEILMNTMLNGASVMNAAILVIAADEE------CPQPQTFE 198

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H        +  LI+  NK+D
Sbjct: 199 HLAALNLCELSNLIIIQNKID 219


>UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 702

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 42/129 (32%), Positives = 53/129 (41%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G   AD  VL+VAA  G  E       QT +    A    V 
Sbjct: 206 VTFLDTPGHAAFASMRARGAKGADIVVLVVAADDGVKE-------QTAQSIKFAKDANV- 257

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPH--TFKKIGYNPAAVAFVPISGWHGDNMLEL 634
           QL+V VNK+D    P   P +R  R    H    +++G     V  V +S     N+  L
Sbjct: 258 QLVVAVNKIDK---PNADP-MRAMRSLLEHDVVVEQLG---GDVQCVEVSALQSRNLPSL 310

Query: 635 QPKCLGSRD 661
           Q   L   D
Sbjct: 311 QDALLLQAD 319


>UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1;
           Blastopirellula marina DSM 3645|Rep: Small GTP-binding
           protein domain - Blastopirellula marina DSM 3645
          Length = 687

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 31/75 (41%), Positives = 40/75 (53%)
 Frame = +2

Query: 290 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 469
           IDAPG+ DFI   I+    AD AV+++ A      AGI+ N  TR     A   G+ ++I
Sbjct: 66  IDAPGYPDFIGQTISAIRGADTAVIVIDA-----HAGIAVN--TRRVFAEAQRAGLGRII 118

Query: 470 VGVNKMDSTEPPYVS 514
           V VNKMD     Y S
Sbjct: 119 V-VNKMDLENVDYPS 132


>UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2;
           Actinomycetales|Rep: Small GTP-binding protein -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 701

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 397
           V +ID PG+ DF+  +  G   ADCA+ ++AA  G  +A
Sbjct: 91  VNLIDTPGYADFVGELRAGLRAADCALFVIAANDGVDDA 129


>UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3;
           Desulfovibrionaceae|Rep: Translation initiation factor
           IF-2 - Desulfovibrio vulgaris (strain Hildenborough /
           ATCC 29579 / NCIMB8303)
          Length = 1079

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 28/75 (37%), Positives = 34/75 (45%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 445
           T K  +  +D PGH  F      G    D  VL+VAA  G  E       QTRE    + 
Sbjct: 624 TKKGEIVFLDTPGHEAFTAMRARGAQITDLVVLVVAADDGVME-------QTREAVNHSK 676

Query: 446 TLGVKQLIVGVNKMD 490
             GV  ++V VNKMD
Sbjct: 677 AAGV-PIMVAVNKMD 690


>UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation
           elongation factor; n=3; Actinomycetales|Rep:
           Selenocysteine-specific translation elongation factor -
           Salinispora tropica CNB-440
          Length = 604

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 20/78 (25%), Positives = 35/78 (44%)
 Frame = +2

Query: 269 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFT 448
           +++    +D PGH+ F+ NM+ G       + +VAA  G          Q+ EH      
Sbjct: 50  NEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEG-------WRRQSAEHLAALQA 102

Query: 449 LGVKQLIVGVNKMDSTEP 502
           L V+  ++ V + D  +P
Sbjct: 103 LDVRHGVLAVTRCDLADP 120


>UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyces
           cerevisiae|Rep: Superkiller protein 7 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 747

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 43  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG-KGSFKYAWVLDKLKA 219
           ++  + +G  ++GKST  GHL+Y    I   ++ + +K++  +    S  +  +LD  K 
Sbjct: 267 NLTCLFLGDTNAGKSTLLGHLLYDLNEISMSSMRELQKKSSNLDPSSSNSFKVILDNTKT 326

Query: 220 ERE 228
           ERE
Sbjct: 327 ERE 329


>UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2;
           Mycoplasma|Rep: Translation initiation factor IF-2 -
           Mycoplasma mycoides subsp. mycoides SC
          Length = 620

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T ID PGH  F +    G +  D  VLIVAA  G     + +  +  +HA LA      
Sbjct: 171 ITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGV----MPQTEEAIDHAKLANV---- 222

Query: 461 QLIVGVNKMDSTE--PPYVSPDLRK 529
            +IV +NK+D  E  P  V  +L K
Sbjct: 223 PIIVFINKIDKPEADPNRVKTELMK 247


>UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4;
           Deinococci|Rep: Translation initiation factor IF-2 -
           Deinococcus radiodurans
          Length = 597

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           +TSK  +  ID PGH  F      G + AD A++++AA         S   QTRE    A
Sbjct: 143 KTSKGKIVFIDTPGHEAFTTIRARGANVADIAIIVIAADD-------SLMPQTREAIAHA 195

Query: 443 FTLGVKQLIVGVNKMD--STEPPYVSPDL 523
               V  LI  +NK+D    +P  V  DL
Sbjct: 196 QAAKVPMLI-AINKVDLPQADPEKVKTDL 223


>UniRef50_P46199 Cluster: Translation initiation factor IF-2,
           mitochondrial precursor (IF-2Mt) (IF2(mt)) (IF-2(Mt));
           n=28; Euteleostomi|Rep: Translation initiation factor
           IF-2, mitochondrial precursor (IF-2Mt) (IF2(mt))
           (IF-2(Mt)) - Homo sapiens (Human)
          Length = 727

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=2; Photobacterium
           profundum|Rep: Hypothetical selenocysteine-specific
           translation elongation factor - Photobacterium profundum
           (Photobacterium sp. (strain SS9))
          Length = 574

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           V +ID PGH  FI+NM+ G    D  + +VAA  G
Sbjct: 18  VGVIDVPGHERFIRNMVAGVWSLDMVLFVVAADEG 52


>UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Translation
           initiation factor IF-2 - Mariprofundus ferrooxydans PV-1
          Length = 1045

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 29/70 (41%), Positives = 32/70 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           V  ID PGH  F      G    D AVL+VAA  G     I    +   HA  A   GV 
Sbjct: 597 VVFIDTPGHEAFTSLRARGAGMTDVAVLVVAADDGVMPQTI----EALNHAKAA---GV- 648

Query: 461 QLIVGVNKMD 490
            +IV VNKMD
Sbjct: 649 PMIVAVNKMD 658


>UniRef50_A7I3V0 Cluster: Translation initiation factor IF-2; n=1;
           Campylobacter hominis ATCC BAA-381|Rep: Translation
           initiation factor IF-2 - Campylobacter hominis (strain
           ATCC BAA-381 / LMG 19568 / NCTC 13146 /CH001A)
          Length = 914

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T ID PGH  F      G    D  +++VAA  G          QT+E A+        
Sbjct: 464 ITFIDTPGHEAFTSMRARGAEVTDIVIIVVAADDG-------VKPQTKE-AINHAKAAKV 515

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKS 532
            +I+ +NKMD    P  +PD+ KS
Sbjct: 516 PIIIAINKMDK---PTANPDMVKS 536


>UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2;
           Oenococcus oeni|Rep: Translation initiation factor 2 -
           Oenococcus oeni ATCC BAA-1163
          Length = 829

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F +    G +  D  +L+VAA  G     I    +   HA  A T    
Sbjct: 380 ITFLDTPGHEAFTEMRARGANVTDITILVVAADDGIMPQTI----EAIHHAQAAKT---- 431

Query: 461 QLIVGVNKMDSTEPPYVSP-DLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +IV +NK+D    P V P ++     KY    ++ G +   V     +G + D +LE+
Sbjct: 432 PIIVAINKIDI---PGVDPNNVINELMKYDLVPEEYGGSTIEVPISAKTGQNVDKLLEM 487


>UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;
           Actinomycetales|Rep: Elongation factor G-like protein -
           Mycobacterium tuberculosis
          Length = 714

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           V ++D PG+ DF+  +  G   ADCA+ ++AA  G
Sbjct: 90  VNLVDTPGYADFVGELRAGLRAADCALFVIAANEG 124


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 727,652,548
Number of Sequences: 1657284
Number of extensions: 14964404
Number of successful extensions: 44077
Number of sequences better than 10.0: 471
Number of HSP's better than 10.0 without gapping: 41334
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43839
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 58853922985
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -