SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P36241 Cluster: 60S ribosomal protein L19; n=141; Eukar...   171   1e-41
UniRef50_P84098 Cluster: 60S ribosomal protein L19; n=53; Eukary...   150   3e-35
UniRef50_Q95L19 Cluster: Ribosomal protein L19; n=4; Eukaryota|R...   138   7e-32
UniRef50_Q5DEB4 Cluster: Ribosomal protein L19; n=6; Eukaryota|R...   125   7e-28
UniRef50_Q4QJ39 Cluster: 60S ribosomal protein L19, putative; n=...   115   1e-24
UniRef50_UPI0000DA4672 Cluster: PREDICTED: similar to ribosomal ...   109   7e-23
UniRef50_Q014R4 Cluster: Ribosomal protein L19; n=2; Eukaryota|R...   101   2e-20
UniRef50_Q98RT9 Cluster: 60S ribosomal protein L19; n=1; Guillar...    97   2e-19
UniRef50_Q6QI82 Cluster: LRRGT00126; n=3; Rattus norvegicus|Rep:...    93   6e-18
UniRef50_Q9V1V3 Cluster: 50S ribosomal protein L19e; n=6; Archae...    93   6e-18
UniRef50_Q8SRP5 Cluster: 60S RIBOSOMAL PROTEIN L19; n=1; Encepha...    91   3e-17
UniRef50_Q7QT85 Cluster: Ribosomal protein L19; n=1; Giardia lam...    81   2e-14
UniRef50_P54043 Cluster: 50S ribosomal protein L19e; n=12; Eurya...    79   1e-13
UniRef50_Q74N10 Cluster: Ribosomal protein L19; n=3; Archaea|Rep...    75   1e-12
UniRef50_A7Q820 Cluster: Chromosome undetermined scaffold_62, wh...    72   1e-11
UniRef50_UPI0001552F33 Cluster: PREDICTED: hypothetical protein;...    72   1e-11
UniRef50_Q18GG7 Cluster: Ribosomal protein L19.eR; n=5; Archaea|...    71   2e-11
UniRef50_UPI00005A22A8 Cluster: PREDICTED: similar to ribosomal ...    70   4e-11
UniRef50_Q9HPB6 Cluster: 50S ribosomal protein L19e; n=12; Eurya...    69   7e-11
UniRef50_Q6L1A9 Cluster: Large subunit ribosomal protein L19E; n...    62   1e-08
UniRef50_Q673R0 Cluster: Ribosomal protein L19; n=2; environment...    62   1e-08
UniRef50_Q6QI84 Cluster: LRRG00124; n=5; Eukaryota|Rep: LRRG0012...    57   4e-07
UniRef50_Q9YF93 Cluster: 50S ribosomal protein L19e; n=2; Desulf...    52   1e-05
UniRef50_Q7QT86 Cluster: GLP_72_19704_20255; n=1; Giardia lambli...    49   8e-05
UniRef50_A3H8Q7 Cluster: Ribosomal protein L19e; n=1; Caldivirga...    49   1e-04
UniRef50_A0RUF8 Cluster: Ribosomal protein L19E; n=1; Cenarchaeu...    48   2e-04
UniRef50_Q3LVV0 Cluster: Ribosomal protein L19; n=1; Bigelowiell...    48   2e-04
UniRef50_Q8ZVV8 Cluster: Ribosomal protein L19; n=4; Pyrobaculum...    48   2e-04
UniRef50_Q9UX89 Cluster: 50S ribosomal protein L19e; n=4; Sulfol...    46   7e-04
UniRef50_Q680Q9 Cluster: Ribosomal protein L19; n=3; Arabidopsis...    46   0.001
UniRef50_Q55DB5 Cluster: Ribosomal protein L19; n=1; Dictyosteli...    45   0.002
UniRef50_Q6QI83 Cluster: LRRG00125; n=1; Rattus norvegicus|Rep: ...    44   0.003
UniRef50_Q6QI77 Cluster: LRRG00131; n=1; Rattus norvegicus|Rep: ...    42   0.009
UniRef50_A7DRM7 Cluster: Ribosomal protein L19e; n=1; Candidatus...    39   0.11 
UniRef50_A2YPT1 Cluster: Putative uncharacterized protein; n=3; ...    37   0.33 
UniRef50_Q5WFH3 Cluster: Sporulation sigma-E factor processing p...    36   1.0  
UniRef50_Q1VH29 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_UPI0000F208C3 Cluster: PREDICTED: similar to RIKEN cDNA...    35   1.8  
UniRef50_A6TUQ5 Cluster: Signal transduction histidine kinase, L...    34   2.4  
UniRef50_Q4DE93 Cluster: Putative uncharacterized protein; n=3; ...    34   2.4  
UniRef50_Q0TVL0 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_A6RYJ9 Cluster: Predicted protein; n=1; Botryotinia fuc...    34   3.1  
UniRef50_Q2QMF8 Cluster: Spc97/Spc98 family protein, expressed; ...    33   4.1  
UniRef50_A5V4Q1 Cluster: Putative uncharacterized protein precur...    33   5.5  
UniRef50_Q6X9Y8 Cluster: Ribosomal protein L19; n=1; Equus cabal...    33   5.5  
UniRef50_A7RGT3 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.5  
UniRef50_Q5XJ41 Cluster: Zgc:103708; n=1; Danio rerio|Rep: Zgc:1...    33   7.2  
UniRef50_Q8DFA7 Cluster: Flagellar motor protein MotB; n=31; Gam...    33   7.2  
UniRef50_Q0FWV5 Cluster: Parallel beta-helix repeat; n=3; Proteo...    33   7.2  
UniRef50_UPI0000E241F4 Cluster: PREDICTED: hypothetical protein;...    32   9.5  
UniRef50_Q8KN99 Cluster: ORF_14; potential multiple membrane spa...    32   9.5  
UniRef50_A1SD74 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  
UniRef50_A7PFU6 Cluster: Chromosome chr6 scaffold_15, whole geno...    32   9.5  
UniRef50_A2G0K1 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  
UniRef50_A0BXE0 Cluster: Chromosome undetermined scaffold_134, w...    32   9.5  

>UniRef50_P36241 Cluster: 60S ribosomal protein L19; n=141;
           Eukaryota|Rep: 60S ribosomal protein L19 - Drosophila
           melanogaster (Fruit fly)
          Length = 203

 Score =  171 bits (416), Expect = 1e-41
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 1   MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRKGRHCGFGKR+GTA
Sbjct: 61  YRVRKNTEARRKGRHCGFGKRKGTA 85



 Score =  121 bits (292), Expect = 1e-26
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 82  KGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 142 IHKKKAEKQRSKMLADQAEARRQKVREAR 170


>UniRef50_P84098 Cluster: 60S ribosomal protein L19; n=53;
           Eukaryota|Rep: 60S ribosomal protein L19 - Homo sapiens
           (Human)
          Length = 196

 Score =  150 bits (363), Expect = 3e-35
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 3e-25
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>UniRef50_Q95L19 Cluster: Ribosomal protein L19; n=4; Eukaryota|Rep:
           Ribosomal protein L19 - Sus scrofa (Pig)
          Length = 153

 Score =  138 bits (335), Expect = 7e-32
 Identities = 63/77 (81%), Positives = 69/77 (89%)
 Frame = +1

Query: 25  RLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTE 204
           RLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSRAR RKNT 
Sbjct: 1   RLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTL 60

Query: 205 ARRKGRHCGFGKRRGTA 255
           ARRKGRH G GKR+GTA
Sbjct: 61  ARRKGRHMGIGKRKGTA 77



 Score =  102 bits (244), Expect = 8e-21
 Identities = 48/90 (53%), Positives = 60/90 (66%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 64  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 123

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEA 482
           FKNKR+LME+IH+ KA+KAR K+L+DQAEA
Sbjct: 124 FKNKRILMEHIHKLKADKARKKLLADQAEA 153


>UniRef50_Q5DEB4 Cluster: Ribosomal protein L19; n=6; Eukaryota|Rep:
           Ribosomal protein L19 - Schistosoma japonicum (Blood
           fluke)
          Length = 287

 Score =  125 bits (302), Expect = 7e-28
 Identities = 57/85 (67%), Positives = 68/85 (80%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS+L+ QKRLA++V  CGKKK+WLDPNE   I N NSR+ IRK+ KD L+I+KPV VHSR
Sbjct: 1   MSNLRTQKRLASAVFGCGKKKIWLDPNETTTIQNANSRKMIRKLYKDNLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           +R RKN  ARRKGRH G GKR+GTA
Sbjct: 61  SRCRKNLIARRKGRHTGTGKRKGTA 85



 Score =  100 bits (240), Expect = 2e-20
 Identities = 49/101 (48%), Positives = 64/101 (63%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   +ARMPQK LW                A KID+HLYH LY + KGN FKNKRVL+++
Sbjct: 82  KGTADARMPQKVLWMRRMRVLRRLLKRYREAHKIDKHLYHLLYQQCKGNQFKNKRVLIDH 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRR 545
           IH+KKAE+ R K LSDQAEA R + +E+R   ++ L  R++
Sbjct: 142 IHKKKAERLRAKQLSDQAEAMRQRKRESRVNRQHRLEERKK 182


>UniRef50_Q4QJ39 Cluster: 60S ribosomal protein L19, putative; n=16;
           cellular organisms|Rep: 60S ribosomal protein L19,
           putative - Leishmania major
          Length = 267

 Score =  115 bits (276), Expect = 1e-24
 Identities = 52/84 (61%), Positives = 66/84 (78%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M SLKLQ RLA+S++ CG+ +VWLDPNE  EI N NSR+++RK+IKDG +I+KPV VHSR
Sbjct: 21  MVSLKLQARLASSILGCGRARVWLDPNEAVEIQNANSRKSVRKLIKDGFIIRKPVKVHSR 80

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
           AR RK  EA+  GRH G G+R G+
Sbjct: 81  ARWRKMKEAKDMGRHNGVGRREGS 104



 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 40/88 (45%), Positives = 55/88 (62%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           ARMP KELW                 KKIDRH+Y  LYM+AKGNVF+NKR L+E+IH+ K
Sbjct: 107 ARMPSKELWMRRLRILRRLLRKYRADKKIDRHVYRDLYMRAKGNVFRNKRNLVEHIHKIK 166

Query: 438 AEKARTKMLSDQAEARRNKVKEARSAAR 521
            EK + + L++Q  A+  + ++ R+ AR
Sbjct: 167 NEKKKERQLAEQLAAKHLRDEQNRNKAR 194


>UniRef50_UPI0000DA4672 Cluster: PREDICTED: similar to ribosomal
           protein L19; n=2; Rattus norvegicus|Rep: PREDICTED:
           similar to ribosomal protein L19 - Rattus norvegicus
          Length = 303

 Score =  109 bits (261), Expect = 7e-23
 Identities = 56/85 (65%), Positives = 64/85 (75%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L LQKRLA+SV+ CGKKKV LDPNE N+IAN NS Q IRK+I+DGL+I KPV VHS+
Sbjct: 1   MSMLSLQKRLASSVLHCGKKKVQLDPNETNKIANANSCQLIRKLIEDGLIIWKPVTVHSQ 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           A   KNT    KGRH   GK +GTA
Sbjct: 61  AHCEKNT---LKGRHMVIGKGKGTA 82



 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 42/123 (34%), Positives = 66/123 (53%)
 Frame = +3

Query: 201 RGT*KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKA 380
           + T KG  + +   K   N  +P++  W                +KKID H+ HSLY++ 
Sbjct: 65  KNTLKGRHMVIGKGKGTANIWVPERVTWMRRMSILHRLLRRYCESKKIDCHMCHSLYLRV 124

Query: 381 KGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRP 560
           K NVFKN+ +LME IH+ KA+KA  K+L+DQ + + +K K+A+      +P R+     P
Sbjct: 125 KRNVFKNQWILMEQIHKPKADKACKKLLADQGDVQSSKSKDAQKLREEQVPTRQHKFQFP 184

Query: 561 SLE 569
            L+
Sbjct: 185 FLK 187


>UniRef50_Q014R4 Cluster: Ribosomal protein L19; n=2; Eukaryota|Rep:
           Ribosomal protein L19 - Ostreococcus tauri
          Length = 213

 Score =  101 bits (241), Expect = 2e-20
 Identities = 49/84 (58%), Positives = 56/84 (66%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR+P K LW                AKKID+H+YHS+Y+K KGNVFKNKRVLME IH+ K
Sbjct: 107 ARLPTKVLWLRRHRVLRRLLSKYRDAKKIDKHMYHSMYLKCKGNVFKNKRVLMEAIHKSK 166

Query: 438 AEKARTKMLSDQAEARRNKVKEAR 509
           AEKAR K L+DQ EARR K K  R
Sbjct: 167 AEKAREKSLADQFEARRAKNKAVR 190



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 40/104 (38%), Positives = 54/104 (51%), Gaps = 20/104 (19%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPV----- 165
           M SLKLQKRLAAS++ CG +K+W+DPNE+     T+ +   R   ++G            
Sbjct: 1   MVSLKLQKRLAASILNCGVRKIWMDPNEVRHAWLTSGKTTERPQAREGRTGDPKTYEGTF 60

Query: 166 ---------------AVHSRARVRKNTEARRKGRHCGFGKRRGT 252
                           +HSRAR  +   A+R GRH G+GKRRGT
Sbjct: 61  PTLRGFHAARAYFNFQIHSRARTAREQAAKRLGRHTGYGKRRGT 104


>UniRef50_Q98RT9 Cluster: 60S ribosomal protein L19; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L19 - Guillardia theta
           (Cryptomonas phi)
          Length = 190

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 41/84 (48%), Positives = 60/84 (71%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSS+K+ K +A+ ++ CGK+K+W+DPNE   I  T+SR +IRK+I+DG ++KK    HSR
Sbjct: 1   MSSVKMHKTIASKLLNCGKRKIWIDPNETKNILFTDSRNSIRKLIRDGFILKKKDKNHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
            R+R   E  + GRH G GKR+G+
Sbjct: 61  NRIRSRKEEIKLGRHEGLGKRKGS 84



 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +3

Query: 255 NARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRK 434
           N+R   K +W                + K++RHLY SLY+K+KGNVFKNK++L E+IH+ 
Sbjct: 86  NSRYSIKLIWIIRIRVMRNLLKRLRNSSKLNRHLYRSLYLKSKGNVFKNKKILTEFIHKA 145

Query: 435 KAEKARTKMLSDQAEARRNKVK 500
           K E+ R +   D+ +  R K K
Sbjct: 146 KNEQKRKEEFLDKFKLMREKKK 167


>UniRef50_Q6QI82 Cluster: LRRGT00126; n=3; Rattus norvegicus|Rep:
           LRRGT00126 - Rattus norvegicus (Rat)
          Length = 632

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 48/111 (43%), Positives = 66/111 (59%)
 Frame = +3

Query: 177 PRPCPQKHRGT*KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHL 356
           P    +KH G  +G +     E+   NARM +K  W                +KKIDR +
Sbjct: 515 PGSLREKHLGLMEGQAYGHREEEGTANARMSEKLTWMRRMRILHRLLRRYRESKKIDRRM 574

Query: 357 YHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           YHSL +K KGNVFKNK  L+++IH+ KA++A  K+L+DQ EARR+K K+AR
Sbjct: 575 YHSLDLKVKGNVFKNKWSLVDHIHKLKADRAPKKLLADQTEARRSKTKKAR 625



 Score = 32.3 bits (70), Expect = 9.5
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 142 GLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTA 255
           GL+I+KPV VHS   +R+      +G+  G  +  GTA
Sbjct: 503 GLIIRKPVTVHSPGSLREKHLGLMEGQAYGHREEEGTA 540


>UniRef50_Q9V1V3 Cluster: 50S ribosomal protein L19e; n=6;
           Archaea|Rep: 50S ribosomal protein L19e - Pyrococcus
           abyssi
          Length = 151

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 36/83 (43%), Positives = 63/83 (75%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M +LK+Q+R+AA +++CG+ ++W+DP  ++++A+  +R++IR++IK+G++ KKPV   SR
Sbjct: 1   MKTLKMQRRVAAELLKCGENRIWIDPERVDDVASAITREDIRRLIKEGVIKKKPVKGQSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRG 249
            R R   E ++KGRH G G R+G
Sbjct: 61  YRARIRHEQKKKGRHRGPGSRKG 83



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/65 (36%), Positives = 30/65 (46%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           ARM +KELW                 KKIDR  Y  LY++AKG  FK+K  L  ++    
Sbjct: 87  ARMGKKELWIKTIRALRKELRKLKEQKKIDRRTYRMLYIRAKGGQFKSKHQLYMFLEEHN 146

Query: 438 AEKAR 452
             K R
Sbjct: 147 LLKKR 151


>UniRef50_Q8SRP5 Cluster: 60S RIBOSOMAL PROTEIN L19; n=1;
           Encephalitozoon cuniculi|Rep: 60S RIBOSOMAL PROTEIN L19
           - Encephalitozoon cuniculi
          Length = 171

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 41/85 (48%), Positives = 59/85 (69%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS+ +  +RLA+ ++ CGKKK+WLD NEI  +   ++R+ I+++IKD ++I K     SR
Sbjct: 1   MSNEERVRRLASDILNCGKKKLWLDNNEIERLNGASTREQIKQLIKDNVIIMKQDKHTSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            R RK  EA++KGRH G GKR GTA
Sbjct: 61  GRCRKRLEAKKKGRHMGTGKRFGTA 85



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 NARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRK 434
           NARMPQK++W                  +I +  +   Y +AKG++FK++  + + I ++
Sbjct: 86  NARMPQKKIWMKKIRAMRAMLKEMRANGEITKEDFRVFYKQAKGHLFKHRFHMKDCIIKR 145

Query: 435 KAEKARTKMLSDQAEA 482
           KA++ R K L++QA+A
Sbjct: 146 KADEQRAKELAEQAKA 161


>UniRef50_Q7QT85 Cluster: Ribosomal protein L19; n=1; Giardia
           lamblia ATCC 50803|Rep: Ribosomal protein L19 - Giardia
           lamblia ATCC 50803
          Length = 196

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 38/84 (45%), Positives = 55/84 (65%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M++L+LQKRLAA V++CGK++V  +P     I   +SR+ IR +I+  ++ K  +   SR
Sbjct: 1   MANLRLQKRLAADVLKCGKRRVRFNPAHEKYIEQASSREAIRSLIESKIIAKLDIKGSSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGT 252
            R+R    A+R GRH G GKRRGT
Sbjct: 61  GRIRARHAAKRLGRHSGHGKRRGT 84



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 36/82 (43%), Positives = 47/82 (57%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           ARMP K LW                 +KIDRHLY +LY KAKGN+FKNKRVL+E+I   +
Sbjct: 87  ARMPSKTLWIQRQRVLRRLLSRYRDDEKIDRHLYETLYAKAKGNMFKNKRVLLEHIVGMQ 146

Query: 438 AEKARTKMLSDQAEARRNKVKE 503
            E+   K   ++ E RR K ++
Sbjct: 147 KEQELEKKKKEELEQRRKKAEQ 168


>UniRef50_P54043 Cluster: 50S ribosomal protein L19e; n=12;
           Euryarchaeota|Rep: 50S ribosomal protein L19e -
           Methanococcus jannaschii
          Length = 151

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 34/82 (41%), Positives = 56/82 (68%)
 Frame = +1

Query: 10  LKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARV 189
           + +Q+R+AA +++CG ++VW+DP +++ +    S+ +IR +IK+G++ KK     S ARV
Sbjct: 6   VSVQRRMAAEILKCGIERVWIDPTQLDRVKMAMSKDDIRALIKEGVIKKKQKKGISSARV 65

Query: 190 RKNTEARRKGRHCGFGKRRGTA 255
           +K  E R+KGR  G G RRG A
Sbjct: 66  KKLKEQRKKGRRRGPGSRRGAA 87



 Score = 37.9 bits (84), Expect = 0.19
 Identities = 20/63 (31%), Positives = 27/63 (42%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKK 437
           AR P KE W                + KIDR +Y  LY  AKG  F+++  L  Y+   +
Sbjct: 89  ARTPPKERWMATIRALRKTLKQLRDSGKIDRKVYRKLYRMAKGGAFRSRSHLFLYMREHE 148

Query: 438 AEK 446
             K
Sbjct: 149 LLK 151


>UniRef50_Q74N10 Cluster: Ribosomal protein L19; n=3; Archaea|Rep:
           Ribosomal protein L19 - Nanoarchaeum equitans
          Length = 147

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 31/77 (40%), Positives = 52/77 (67%)
 Frame = +1

Query: 19  QKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKN 198
           Q+R+AA +++ G  +VW+DPN + E+A   ++ +IR++IK G++ K P+   SR R R+ 
Sbjct: 6   QRRMAAEILKVGLDRVWIDPNHLKEVAEALTKDDIRELIKRGIIKKLPIEGQSRKRAREL 65

Query: 199 TEARRKGRHCGFGKRRG 249
            E ++KGR  G G R+G
Sbjct: 66  HEKKKKGRRRGPGSRKG 82



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 19/59 (32%), Positives = 25/59 (42%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRK 434
           AR   K  W                 K ID   Y  LY K KGN+FK++  L+ Y+ +K
Sbjct: 86  ARADPKRQWINKVRAQRKLLKELKEKKIIDNKTYWDLYKKVKGNLFKSRSHLLLYLKQK 144


>UniRef50_A7Q820 Cluster: Chromosome undetermined scaffold_62, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_62, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 430

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 27/57 (47%), Positives = 43/57 (75%)
 Frame = +1

Query: 25  RLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRK 195
           +  A +++CG+ KVW+DPNE+NEI+  N RQNI K++KD  +I+KP  +HS++  R+
Sbjct: 19  KYTAIILKCGRGKVWIDPNEVNEISMVNFRQNISKLVKDDFIIRKPTKIHSQSVHRR 75


>UniRef50_UPI0001552F33 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 183

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 42/96 (43%), Positives = 56/96 (58%)
 Frame = +1

Query: 13  KLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 192
           +L  R  +  +RCGK+KVWLDP+E +EI N +S Q IRK+ +DGL+I+K           
Sbjct: 39  ELPMRFVSGFLRCGKRKVWLDPSETSEIDNASSCQQIRKLSEDGLIIQKSA--------- 89

Query: 193 KNTEARRKGRHCGFGKRRGTAMRVCHRRNYGYKDKG 300
             T ARR+G H G  KR+GT     +R  Y  K KG
Sbjct: 90  --TLARRRGWHMGIRKRKGTIDYHLYRSLY-LKVKG 122



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 2/57 (3%)
 Frame = +3

Query: 342 IDRHLYHSLYMKAKGNVFK--NKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEA 506
           ID HLY SLY+K KGNV K  +KR+  E+I + KA+ A+ K+LSDQAEARR K KEA
Sbjct: 108 IDYHLYRSLYLKVKGNVLKTIDKRIFKEHIRKLKADSAQQKLLSDQAEARRCKTKEA 164


>UniRef50_Q18GG7 Cluster: Ribosomal protein L19.eR; n=5;
           Archaea|Rep: Ribosomal protein L19.eR - Haloquadratum
           walsbyi (strain DSM 16790)
          Length = 153

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/83 (37%), Positives = 50/83 (60%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           M+ LK Q+R+AA V+  GK ++W DP+E  EIA   +R++IR+++  G++  +    +S+
Sbjct: 1   MTDLKAQRRMAADVLSVGKSRIWFDPDEQGEIAEAITREDIRELVDQGIIRAEDAKSNSK 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRG 249
            R R   E R  G   G G R+G
Sbjct: 61  GRARSRAEKRAYGHRKGPGSRKG 83


>UniRef50_UPI00005A22A8 Cluster: PREDICTED: similar to ribosomal
           protein L19; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L19 - Canis familiaris
          Length = 169

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 37/97 (38%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
 Frame = +3

Query: 330 TAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           +A K+  H+ HSLY KAKG VFKNK +L+E+ ++ KA+K   K+L+ QAEARR+K +EA 
Sbjct: 58  SAPKVALHMCHSLYRKAKGYVFKNKWILVEHNYKLKADKVPQKLLAAQAEARRSKTEEAH 117

Query: 510 SAARNVLPPRRRNCCR--PSLEKTKPRLPLRSKHYVV 614
                 L  ++           K + +LPL  +  ++
Sbjct: 118 KGCEERLQAKKEEIIETVQGGRKQEIKLPLFGREPII 154


>UniRef50_Q9HPB6 Cluster: 50S ribosomal protein L19e; n=12;
           Euryarchaeota|Rep: 50S ribosomal protein L19e -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 149

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 1/95 (1%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L  QKRLAA V+  G+ +VW DP+  +EIA+  +R++IR+++ DG +  +    +SR
Sbjct: 1   MSDLSAQKRLAADVLDVGENRVWFDPDAQSEIADAITREDIRELVADGTIDAEDTQGNSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA-MRVCHRRNY 282
            R R+       G   G G R+G A  R   +R Y
Sbjct: 61  GRARERDAKESYGHKKGAGSRKGKAGARQNEKREY 95


>UniRef50_Q6L1A9 Cluster: Large subunit ribosomal protein L19E; n=4;
           Thermoplasmatales|Rep: Large subunit ribosomal protein
           L19E - Picrophilus torridus
          Length = 158

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/77 (37%), Positives = 47/77 (61%)
 Frame = +1

Query: 22  KRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNT 201
           K++AA  M+ G  +VW+D N I+++ +  SR+++RK+I   ++ KK    +S  R++K  
Sbjct: 7   KQIAADEMKVGVSRVWIDTNSIDQVLDATSREDVRKLIDLHIIQKKQKKGNSNYRLKKRI 66

Query: 202 EARRKGRHCGFGKRRGT 252
           E   KGR  G G  RGT
Sbjct: 67  EQLAKGRRRGEGSVRGT 83


>UniRef50_Q673R0 Cluster: Ribosomal protein L19; n=2; environmental
           samples|Rep: Ribosomal protein L19 - uncultured marine
           group II euryarchaeote DeepAnt-JyKC7
          Length = 158

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/85 (32%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +1

Query: 19  QKRLAASVMR------CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           QKRLAA +         G  +VW+DP +++++++   ++++R++I +G++  +P    SR
Sbjct: 6   QKRLAAQIFSKREGRPVGVHRVWVDPQKLDDVSDAVQKEDVRRLIDEGVIKARPFVGTSR 65

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           +R RK    + KGR  G G R+G+A
Sbjct: 66  SRARKAAAQKAKGRRSGQGSRKGSA 90


>UniRef50_Q6QI84 Cluster: LRRG00124; n=5; Eukaryota|Rep: LRRG00124 -
           Rattus norvegicus (Rat)
          Length = 487

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 38/94 (40%), Positives = 48/94 (51%)
 Frame = -1

Query: 449 GLLSLLPVDVLHEHTLVLEHITLRLHVE*VV*MPVNLLGSSVLQEQFS*NPLSLYP*FLL 270
           GL+ L  VDVLHE+ L LE+I   L ++ V+ M VNLL   +         + L      
Sbjct: 65  GLVCLQFVDVLHENPLALEYIPFDLQIQGVIYMAVNLLRFQLSLRSRHRILILLIQVTFS 124

Query: 269 WHTRIAVPLLLPKPQ*RPFLRASVFLRTRAREWT 168
               +AVP L P     PF R+ VF R RAREWT
Sbjct: 125 GIQALAVPFLFPMLICLPFRRSKVFFRHRAREWT 158


>UniRef50_Q9YF93 Cluster: 50S ribosomal protein L19e; n=2;
           Desulfurococcaceae|Rep: 50S ribosomal protein L19e -
           Aeropyrum pernix
          Length = 155

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +1

Query: 13  KLQKRLAASVMRCGKKKVWL--DPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRAR 186
           + Q+RLAA ++  G+ ++W+  DP    EI    ++ ++R +IK G++   P   ++   
Sbjct: 4   RFQRRLAAEILGVGESRIWISPDPELREEIEGAVTKADVRALIKRGVIKVLPEKGNAGHA 63

Query: 187 VRKNTEARRKGRHCGFGKRRGTA 255
            +     RRKGR  G G+R+G A
Sbjct: 64  SKVRHLQRRKGRRRGMGRRKGVA 86



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 22/77 (28%), Positives = 29/77 (37%)
 Frame = +3

Query: 195 KHRGT*KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYM 374
           +H    KG    +   K    AR+  KE W                 + IDR  Y  LYM
Sbjct: 67  RHLQRRKGRRRGMGRRKGVATARLDPKERWMHRIRKIRRYLRYLRDKQVIDRKTYRRLYM 126

Query: 375 KAKGNVFKNKRVLMEYI 425
            AKG  F++   L  Y+
Sbjct: 127 LAKGGTFRDLASLKRYM 143


>UniRef50_Q7QT86 Cluster: GLP_72_19704_20255; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_72_19704_20255 - Giardia lamblia
           ATCC 50803
          Length = 183

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 32/83 (38%), Positives = 49/83 (59%)
 Frame = -1

Query: 503 LLYFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLHVE*VV*MPVNLLGSSV 324
           LL  +AA L L+   L   LL L   DVL E+ L+LEH+TL L +E ++ +P++L   +V
Sbjct: 63  LLCLLAALLKLLLLLLLELLLLLHSNDVLQENALILEHVTLSLSIEGLIKVPIDLFVVTV 122

Query: 323 LQEQFS*NPLSLYP*FLLWHTRI 255
             +Q + + L+L P  L  HT +
Sbjct: 123 PAQQATEDTLALNPESLRRHTSL 145


>UniRef50_A3H8Q7 Cluster: Ribosomal protein L19e; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein L19e -
           Caldivirga maquilingensis IC-167
          Length = 158

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = +1

Query: 22  KRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNT 201
           +   A ++   K ++ +    + ++    +R ++R ++K+GL+  KP   +SR R R   
Sbjct: 4   RETVARLLNVPKSRIVIKQEALEQLEEAITRNDVRSLMKEGLIEVKPRKRNSRGRWRITH 63

Query: 202 EARRKGRHCGFGKRRGT 252
           E R+ GR  G G RRGT
Sbjct: 64  EKRKSGRRRGRGSRRGT 80


>UniRef50_A0RUF8 Cluster: Ribosomal protein L19E; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein L19E - Cenarchaeum
           symbiosum
          Length = 150

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/93 (30%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +1

Query: 7   SLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRAR 186
           +L+ +KRLA+ V   G  +++ DP  +++IA+  +R +IR +I    +  KPV+  SR R
Sbjct: 4   NLRTKKRLASRVTGAGIHRIYFDPTHLDDIADAITRNDIRSLITANTIKIKPVSGTSRGR 63

Query: 187 VR-KNTEARRKGRHCGFGKRRGTAMRVCHRRNY 282
            + K  +  ++G   G  K+     RV  ++ Y
Sbjct: 64  AQHKRRQKAKRGSKAG-SKQGRMGARVGKKQVY 95


>UniRef50_Q3LVV0 Cluster: Ribosomal protein L19; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L19 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 150

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 22/82 (26%), Positives = 45/82 (54%)
 Frame = +1

Query: 7   SLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRAR 186
           ++K  K  A+ +++CG  K+ ++P   + + + N+R+ I  + K  ++IKK +   S  R
Sbjct: 2   TIKKLKNTASKLLKCGSNKIKINPIYYSFLKSENNRKKIIDLFKKRIIIKKTIKGVSSYR 61

Query: 187 VRKNTEARRKGRHCGFGKRRGT 252
            +     ++ G   G G+R+GT
Sbjct: 62  KKLRKAKKQSGLKRGIGRRKGT 83


>UniRef50_Q8ZVV8 Cluster: Ribosomal protein L19; n=4;
           Pyrobaculum|Rep: Ribosomal protein L19 - Pyrobaculum
           aerophilum
          Length = 147

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/76 (30%), Positives = 39/76 (51%)
 Frame = +1

Query: 22  KRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNT 201
           KRLAA ++  G  ++ + P     +    ++ ++R +I  GL+  +P    SR R R   
Sbjct: 5   KRLAADILGVGVSRIKISPEAAERLEEVVTKDDVRALIDQGLIWAEPERGVSRGRWRVRH 64

Query: 202 EARRKGRHCGFGKRRG 249
             ++KGR  G G R+G
Sbjct: 65  IKKKKGRRRGHGSRKG 80


>UniRef50_Q9UX89 Cluster: 50S ribosomal protein L19e; n=4;
           Sulfolobaceae|Rep: 50S ribosomal protein L19e -
           Sulfolobus solfataricus
          Length = 151

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 28/85 (32%), Positives = 50/85 (58%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDG-LVIKKPVAVHS 177
           M++LK QKRLAAS+   G  ++ +  + I ++ ++ +R  IR +IKDG +++ K V + S
Sbjct: 1   MTNLKAQKRLAASIAGVGINRIKVVEDYIEDVQSSLTRDEIRNLIKDGKIIVLKKVGI-S 59

Query: 178 RARVRKNTEARR-KGRHCGFGKRRG 249
             R+++  + R  K      G R+G
Sbjct: 60  GGRLKERRKKRSLKSEGKKSGSRKG 84



 Score = 33.9 bits (74), Expect = 3.1
 Identities = 16/47 (34%), Positives = 20/47 (42%)
 Frame = +3

Query: 258 ARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFK 398
           AR   K++W                 K IDRH Y  LY+K KG  +K
Sbjct: 88  ARANSKQMWVKRVRKIRAYLKWLRDHKVIDRHTYRELYLKTKGGNYK 134


>UniRef50_Q680Q9 Cluster: Ribosomal protein L19; n=3; Arabidopsis
           thaliana|Rep: Ribosomal protein L19 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 114

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +3

Query: 336 KKIDRHLY-HSLYMKAKGNVFKNKRVLMEYIHRKKAEK 446
           KKID+ +Y H ++MK KG V+KNK VLME +H+   E+
Sbjct: 54  KKIDKLVYYHDMFMKVKGKVYKNKCVLMESMHKSSRER 91


>UniRef50_Q55DB5 Cluster: Ribosomal protein L19; n=1; Dictyostelium
           discoideum AX4|Rep: Ribosomal protein L19 -
           Dictyostelium discoideum AX4
          Length = 84

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/44 (40%), Positives = 30/44 (68%)
 Frame = +1

Query: 28  LAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKK 159
           LA   +  G KKVWLDP ++++I+   +R+ IR++I  GL+ +K
Sbjct: 8   LAIRYLGVGAKKVWLDPTQMDKISKVKTREGIRELIAQGLIKRK 51


>UniRef50_Q6QI83 Cluster: LRRG00125; n=1; Rattus norvegicus|Rep:
           LRRG00125 - Rattus norvegicus (Rat)
          Length = 123

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/39 (48%), Positives = 26/39 (66%)
 Frame = -3

Query: 162 RFLDDETILDHLTDVLSGVGVCDLIDFIWIQPHLLFTTS 46
           R  DD+ I D L D+L+GVG+ D +  I +QP L FTT+
Sbjct: 5   RLPDDQPIFDQLPDLLTGVGIGDFVGLIGVQPDLRFTTA 43


>UniRef50_Q6QI77 Cluster: LRRG00131; n=1; Rattus norvegicus|Rep:
           LRRG00131 - Rattus norvegicus (Rat)
          Length = 180

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -3

Query: 276 PSVAYAHC-STSSLTKATVTTLSTCLCVFADTGAGVDCYRFLDDETILDHLTDVLSGVGV 100
           P + Y +  ST  L  A +  L +   VF+    G+D ++ LDD+ I D ++D+L GVG+
Sbjct: 100 PLLGYQNVGSTLPLPYAHMPALPSSQGVFSVVSPGMDGHKILDDQRIFDQISDLLMGVGI 159

Query: 99  CDLI 88
            D I
Sbjct: 160 GDFI 163


>UniRef50_A7DRM7 Cluster: Ribosomal protein L19e; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein
           L19e - Candidatus Nitrosopumilus maritimus SCM1
          Length = 151

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +1

Query: 7   SLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRAR 186
           +LK +KRLA+ V   G  ++  D + + ++A+  +R+NIR +I    +        SR R
Sbjct: 4   NLKAKKRLASRVTGVGVHRIKFDADHLTDVADAITRENIRSLITANTIKIDSFTGTSRGR 63

Query: 187 VRKNTEARRKGRHCGFGKRRG 249
             +  +A+R  R    G ++G
Sbjct: 64  A-QTKKAQRNKRGTKQGSKQG 83


>UniRef50_A2YPT1 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 55

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = +3

Query: 372 MKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNK 494
           MK KGN+  NKR       + +AEKAR + LSDQ EA+  K
Sbjct: 1   MKVKGNMLNNKRGPYGEYPQVQAEKARKRTLSDQFEAKLAK 41


>UniRef50_Q5WFH3 Cluster: Sporulation sigma-E factor processing
           peptidase; n=1; Bacillus clausii KSM-K16|Rep:
           Sporulation sigma-E factor processing peptidase -
           Bacillus clausii (strain KSM-K16)
          Length = 297

 Score = 35.5 bits (78), Expect = 1.0
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 4/132 (3%)
 Frame = -2

Query: 547 FLLLGGNTFLAALRASFTLLRRASAWSLSIFVLAFSAFFLWMYSMSTRLFLNTLPFAFM* 368
           +LL  G  +L     +  L RR S W L +  L  S     M++ +  LFLN +      
Sbjct: 9   WLLNAGIDYLLLAATALLLKRRFSQWRLVLAALFASLIVFLMFTPAAPLFLNPVIKLI-- 66

Query: 367 SEWYRCLSIFLAVLYFR-SNFLRTLCLCTHSSFC---GIRALQYLFSYQSHSDDPFYVPL 200
              Y  L +F+A  Y R S FL+ L      +F    G+ A+ Y F  +++ D   ++P 
Sbjct: 67  ---YSGLIVFIAFGYKRFSFFLQNLASFYFVTFVTGGGLFAMHYFF--ETNVDVLAFLP- 120

Query: 199 CFCGHGRGSGLL 164
              GHG G  ++
Sbjct: 121 ---GHGVGGSMV 129


>UniRef50_Q1VH29 Cluster: Putative uncharacterized protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Putative
           uncharacterized protein - Psychroflexus torquis ATCC
           700755
          Length = 38

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 11/28 (39%), Positives = 23/28 (82%)
 Frame = +1

Query: 19  QKRLAASVMRCGKKKVWLDPNEINEIAN 102
           QKR+AA ++ CG+ +VW++P  ++++A+
Sbjct: 6   QKRIAARLLGCGENRVWINPLYVDQVAS 33


>UniRef50_UPI0000F208C3 Cluster: PREDICTED: similar to RIKEN cDNA
           2810004N23 gene; n=1; Danio rerio|Rep: PREDICTED:
           similar to RIKEN cDNA 2810004N23 gene - Danio rerio
          Length = 239

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 22/71 (30%), Positives = 34/71 (47%)
 Frame = +3

Query: 369 YMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRN 548
           Y K +  VF+ +R +M      K +    K+   Q + R+ K KE    A+  L  +RR 
Sbjct: 138 YQKQQQRVFEEERAIMLGARPPKKQYVNYKVYQQQLKERKMKEKEE---AKPELQKKRRK 194

Query: 549 CCRPSLEKTKP 581
             +P  EK+KP
Sbjct: 195 EGKPRTEKSKP 205


>UniRef50_A6TUQ5 Cluster: Signal transduction histidine kinase, LytS
           precursor; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Signal transduction histidine kinase, LytS precursor -
           Alkaliphilus metalliredigens QYMF
          Length = 572

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 3/93 (3%)
 Frame = -2

Query: 592 SGKRGFVFSSEGLQQFLLLGGNTFLAALRASF---TLLRRASAWSLSIFVLAFSAFFLWM 422
           +G    +FS++G   FL++   TFL  +   F    LLR +        ++  ++ F W+
Sbjct: 133 NGYFSIIFSTKGPMFFLMVASGTFLGIISIFFYLRGLLRTSGFHRQGYLIMIIASLFPWV 192

Query: 421 YSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLY 323
                 ++LN +  +F+  +++  +S+   +LY
Sbjct: 193 -----TVYLNAMNKSFLGIDYFPVVSVLSGILY 220


>UniRef50_Q4DE93 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 745

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = -2

Query: 361 WYRCLSIFLAVLYFRSNFLRTLCLCTHSSF-CGIRALQY-LFSY 236
           W+ C ++F+ + +   N    +C C HS    GIR LQ+ LFS+
Sbjct: 33  WFSCRTLFIFLFFKYINIYIYICFCMHSRVGAGIRDLQFSLFSF 76


>UniRef50_Q0TVL0 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 882

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
 Frame = +3

Query: 360 HSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPR 539
           H L +  +    +  R   E   R++ ++A    ++ Q++AR N  + +R     V+PPR
Sbjct: 727 HDLALALQLQEEEEDRQRREAAQRQRDDQASVSAIAAQSQARPNNRRTSRGENPPVIPPR 786

Query: 540 RRNCC--RPSLEKTKP 581
           R N    RP+ E   P
Sbjct: 787 RNNITTHRPAGEPAPP 802


>UniRef50_A6RYJ9 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 72

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +3

Query: 147 RHQETCSSPL-PRPCPQKHRG-T*KGS-SLWLW*EKRYCNARMPQKE 278
           RH  TC+ P  P  CP  H+G   +GS S+WLW EK     R  QK+
Sbjct: 2   RHDTTCTPPFRPSICP-SHKGIASRGSGSMWLWGEKWRLLRRREQKK 47


>UniRef50_Q2QMF8 Cluster: Spc97/Spc98 family protein, expressed;
           n=6; Oryza sativa|Rep: Spc97/Spc98 family protein,
           expressed - Oryza sativa subsp. japonica (Rice)
          Length = 1139

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +1

Query: 16  LQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMI---KDGLVIKKPVAVHSRAR 186
           LQ+ L     +  K   W D  E+N +   + R +  KM+    D LV+   +A H    
Sbjct: 748 LQQFLVTIFDKLDKGNPWDDDFELNTLLQESIRNSADKMLLTAPDSLVVS--LAKHDTRN 805

Query: 187 VRKNTEARRKGRHCGFG 237
             + T   RKGR  GFG
Sbjct: 806 DEETTSISRKGRAQGFG 822


>UniRef50_A5V4Q1 Cluster: Putative uncharacterized protein
           precursor; n=1; Sphingomonas wittichii RW1|Rep: Putative
           uncharacterized protein precursor - Sphingomonas
           wittichii RW1
          Length = 107

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -1

Query: 170 TATGFLMTRPSLIILRMFCLELVFAISLISFGSNHTFFLP 51
           T +GF    P+L+ L  FCL + F   +   G N +FF+P
Sbjct: 25  TTSGFTNPIPTLLSLASFCLGVFFMARISQAGVNLSFFIP 64


>UniRef50_Q6X9Y8 Cluster: Ribosomal protein L19; n=1; Equus
           caballus|Rep: Ribosomal protein L19 - Equus caballus
           (Horse)
          Length = 81

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = +1

Query: 370 T*RRRVMCSRTSVCSWSTSTGXXXXXXXXXXXXXXXXPAAIK*RRH 507
           T +RR MCS+T   SW+TST                 PA ++ R+H
Sbjct: 1   TRKRRAMCSKTRGFSWNTSTSRRQTRLARSFWRTRLRPAGLRPRKH 46


>UniRef50_A7RGT3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 456

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = -2

Query: 544 LLLGGNTFLAALRASFTLLRRASAWSLSIFVLAFSAFFLWMYSMSTRLFLNTLP-FAFM* 368
           +L GG   LA + A   L+     W L   +  ++  F W  S+ T  FL T+P  +   
Sbjct: 328 ILTGGGPSLAGILAVH-LVHHLEIWGLRPKLSKYT--FCWTLSVLTLAFLGTIPHLSNHA 384

Query: 367 SEWYRCLSIFLAVLYFRSNFLRTLCL 290
           + W   +   LA++Y    +++ +CL
Sbjct: 385 NVWGFVVGFLLAMIYIPFQWVKRICL 410


>UniRef50_Q5XJ41 Cluster: Zgc:103708; n=1; Danio rerio|Rep:
           Zgc:103708 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 172

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -3

Query: 309 FLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVFADTGAGVDCYRFLDDETILDH 130
           FL  FVF     SV  A  + S +T  T+ + +TC     D    V C   +  +  +D+
Sbjct: 7   FLLSFVFFVFTFSVVVAQTAKSPVTNCTIKSNTTC----EDCLKIVSCLWCISSQKCIDY 62

Query: 129 -LTDVLSGVGVCDLIDFIW 76
            +  VL    VC L D  W
Sbjct: 63  PVNSVLPSHSVCPLSDARW 81


>UniRef50_Q8DFA7 Cluster: Flagellar motor protein MotB; n=31;
           Gammaproteobacteria|Rep: Flagellar motor protein MotB -
           Vibrio vulnificus
          Length = 300

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -1

Query: 491 IAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 372
           I  G S++A+  RPG     P+DV+ + T+ +   TL  H
Sbjct: 51  IPKGTSIIAQEFRPGRPEPTPIDVIMQQTIDITQQTLEFH 90


>UniRef50_Q0FWV5 Cluster: Parallel beta-helix repeat; n=3;
            Proteobacteria|Rep: Parallel beta-helix repeat -
            Roseovarius sp. HTCC2601
          Length = 10077

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -3

Query: 198  VFADTGAGVDCYRFLDDETILDHLTDVLSGVGVCDLIDFI 79
            +  + GAG D  RFLD  T+  H T VL+G G  DL++ +
Sbjct: 7542 ILVEGGAGADSIRFLDATTMTGHAT-VLAGAG-DDLVEIV 7579


>UniRef50_UPI0000E241F4 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 302

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +3

Query: 138 GWSRHQETCSSPLPRP-CPQKHRGT*KGSSLWLW*EKRYCNA 260
           GWSR     S+PLP P C    R T +   ++ W + R C+A
Sbjct: 256 GWSRAWPGLSAPLPPPPCSHPSRSTLRVHPMYPWVDARSCHA 297


>UniRef50_Q8KN99 Cluster: ORF_14; potential multiple membrane
           spanning domains; n=2; Pseudomonas aeruginosa|Rep:
           ORF_14; potential multiple membrane spanning domains -
           Pseudomonas aeruginosa
          Length = 412

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = -2

Query: 595 LSGKRGFVFSSEGLQQFLLLGGNTFLAALRASFTLLRRASAWSLSIFVLAFSAFFLWMYS 416
           LS K+G+     GL  F L+  + FLA     +       +W L +FVL    F  ++  
Sbjct: 136 LSKKKGY-----GLLNFFLIMWSNFLAFWLGFYFKTSHRKSWFLVVFVLLVLGFCAYVQG 190

Query: 415 MSTRLFL 395
           + +R+FL
Sbjct: 191 IKSRIFL 197


>UniRef50_A1SD74 Cluster: Putative uncharacterized protein; n=1;
           Nocardioides sp. JS614|Rep: Putative uncharacterized
           protein - Nocardioides sp. (strain BAA-499 / JS614)
          Length = 175

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = -2

Query: 547 FLLLGGNTFLAALRA-SFTLLRRASAWSLSIFVLAF--SAFFLWMYSMSTRLFLNTLPFA 377
           +L+LGG TF AALRA +    R  +  +L +  LAF  +A +L + +     F +  PF 
Sbjct: 6   WLVLGGTTFAAALRARTSRRARYVARGALGLLFLAFGVNAIYLALDNGYYDDFADPSPFG 65

Query: 376 FM*SEW 359
           F+   W
Sbjct: 66  FVRDTW 71


>UniRef50_A7PFU6 Cluster: Chromosome chr6 scaffold_15, whole genome
           shotgun sequence; n=8; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_15, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 693

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 23/89 (25%), Positives = 38/89 (42%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS    Q   A    RC  +++     E+ + +   S Q   K IK    ++ P+ V ++
Sbjct: 561 MSYFASQSEKAFKEARCEIQRLICQMEELCKNSVEESEQEDLKAIKHH--VRDPIIVKTK 618

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTAMRVC 267
                  +  +K RHCG  K+ G  +R C
Sbjct: 619 GNPGNLKDKFKKPRHCGKCKKVGHTVRKC 647


>UniRef50_A2G0K1 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 662

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +1

Query: 58  KKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPV 165
           K+V  + N+ NE    N+  N+ KM+KD +V +KPV
Sbjct: 557 KQVVSELNQNNENEPQNNLNNLEKMVKDQIVTEKPV 592


>UniRef50_A0BXE0 Cluster: Chromosome undetermined scaffold_134,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_134,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 775

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +3

Query: 336 KKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAE--KARTKMLSDQAEARRNKVKEAR 509
           KKI+  L     M+A+   FK  R+L E +  +  E  K R ++  +Q E ++  +++  
Sbjct: 366 KKIEMELAREAAMRAQEEKFKENRILAEKMKVEAVERLKERQELQQEQVEYKKQLIEQIM 425

Query: 510 SAARNV 527
            A + V
Sbjct: 426 EAEKKV 431


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 613,395,486
Number of Sequences: 1657284
Number of extensions: 12744736
Number of successful extensions: 40871
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 39133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40788
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -