SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q54VT8 Cluster: Putative uncharacterized protein; n=1; ...    64   2e-09
UniRef50_UPI0000D55908 Cluster: PREDICTED: similar to CG7995-PA,...    59   1e-07
UniRef50_Q14409 Cluster: Glycerol kinase, testis specific 1; n=1...    56   7e-07
UniRef50_Q1DHV8 Cluster: Putative uncharacterized protein; n=2; ...    54   4e-06
UniRef50_Q7WF38 Cluster: Glycerol kinase; n=41; Bacteria|Rep: Gl...    52   9e-06
UniRef50_A1CT92 Cluster: Glycerol kinase, putative; n=25; Dikary...    51   2e-05
UniRef50_Q8R8J4 Cluster: Glycerol kinase; n=13; Bacteria|Rep: Gl...    48   1e-04
UniRef50_Q827G1 Cluster: Glycerol kinase 2; n=3; Actinomycetales...    48   1e-04
UniRef50_Q4RK70 Cluster: Chromosome 2 SCAF15032, whole genome sh...    47   3e-04
UniRef50_Q4SEQ1 Cluster: Chromosome 3 SCAF14614, whole genome sh...    46   7e-04
UniRef50_Q8PQG7 Cluster: Glycerol kinase; n=44; Bacteria|Rep: Gl...    46   7e-04
UniRef50_O69664 Cluster: Glycerol kinase; n=12; cellular organis...    46   7e-04
UniRef50_A0JPS9 Cluster: At1g80460; n=13; Magnoliophyta|Rep: At1...    45   0.001
UniRef50_Q9PB76 Cluster: Glycerol kinase; n=245; cellular organi...    44   0.002
UniRef50_Q8YW05 Cluster: Glycerol kinase; n=8; Bacteria|Rep: Gly...    44   0.002
UniRef50_Q7JY99 Cluster: RE20574p; n=4; Sophophora|Rep: RE20574p...    43   0.005
UniRef50_Q9NJP9 Cluster: Glycerol kinase, glycosomal; n=19; Tryp...    43   0.005
UniRef50_Q8FLY8 Cluster: Glycerol kinase; n=15; Bacteria|Rep: Gl...    43   0.005
UniRef50_O66746 Cluster: Glycerol kinase; n=3; cellular organism...    43   0.005
UniRef50_A3H9C0 Cluster: Glycerol kinase; n=9; cellular organism...    43   0.007
UniRef50_Q176X4 Cluster: Glycerol kinase; n=6; Endopterygota|Rep...    42   0.009
UniRef50_Q5KII9 Cluster: Glycerol kinase, putative; n=1; Filobas...    42   0.016
UniRef50_O29395 Cluster: Uncharacterized sugar kinase AF_0866; n...    42   0.016
UniRef50_Q828K5 Cluster: Glycerol kinase 1; n=3; cellular organi...    42   0.016
UniRef50_A6QVZ2 Cluster: Putative uncharacterized protein; n=1; ...    41   0.028
UniRef50_P44400 Cluster: Glycerol kinase; n=103; cellular organi...    40   0.037
UniRef50_Q9W095 Cluster: CG7995-PA, isoform A; n=4; Endopterygot...    40   0.049
UniRef50_A1WIH8 Cluster: Carbohydrate kinase, FGGY; n=3; Proteob...    40   0.065
UniRef50_A5WG03 Cluster: Glycerol kinase; n=3; Psychrobacter|Rep...    39   0.086
UniRef50_A0U6Y3 Cluster: Putative uncharacterized protein precur...    39   0.086
UniRef50_A5AZ03 Cluster: Putative uncharacterized protein; n=1; ...    39   0.086
UniRef50_Q16PC1 Cluster: Glycerol kinase; n=2; Culicidae|Rep: Gl...    39   0.11 
UniRef50_P57944 Cluster: Glycerol kinase; n=53; Bacteria|Rep: Gl...    38   0.15 
UniRef50_UPI0000E49293 Cluster: PREDICTED: hypothetical protein;...    38   0.26 
UniRef50_A5GTS6 Cluster: Glycerol kinase; n=12; Synechococcus|Re...    38   0.26 
UniRef50_A0H464 Cluster: Carbohydrate kinase, FGGY; n=2; Chlorof...    38   0.26 
UniRef50_A2GDR8 Cluster: Glycerol kinase family protein; n=1; Tr...    38   0.26 
UniRef50_A4TNB8 Cluster: Carbohydrate kinase; n=9; Yersinia|Rep:...    37   0.35 
UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing pro...    37   0.46 
UniRef50_Q4JTK9 Cluster: Putative glycerol kinase; n=1; Coryneba...    36   0.61 
UniRef50_Q189T3 Cluster: Glycerol kinase; n=3; Clostridium diffi...    36   0.61 
UniRef50_Q9HNS5 Cluster: Glycerol kinase; n=104; cellular organi...    36   0.61 
UniRef50_Q6D5T8 Cluster: Glycerol kinase; n=16; Gammaproteobacte...    36   0.80 
UniRef50_Q5SHS2 Cluster: Putative uncharacterized protein TTHA16...    36   0.80 
UniRef50_Q4EMM9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.80 
UniRef50_Q7XI12 Cluster: ATPase-like protein; n=5; Viridiplantae...    36   0.80 
UniRef50_Q96T92 Cluster: Insulinoma-associated protein 2; n=13; ...    36   0.80 
UniRef50_Q8UE58 Cluster: Glycerol kinase 2; n=5; Alphaproteobact...    36   1.1  
UniRef50_Q5KYL0 Cluster: Gluconokinase; n=2; Geobacillus|Rep: Gl...    36   1.1  
UniRef50_Q4ITQ5 Cluster: Putative uncharacterized protein precur...    36   1.1  
UniRef50_UPI0000E81406 Cluster: PREDICTED: hypothetical protein;...    35   1.4  
UniRef50_Q9HJ76 Cluster: Probable glycerol kinase; n=1; Thermopl...    35   1.4  
UniRef50_P77432 Cluster: Uncharacterized sugar kinase ydeV; n=57...    35   1.4  
UniRef50_Q2SYV7 Cluster: Gp48, putative; n=1; Burkholderia thail...    35   1.9  
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    35   1.9  
UniRef50_A3K4H7 Cluster: Glycerol kinase protein; n=1; Sagittula...    35   1.9  
UniRef50_A0IYQ7 Cluster: Carbohydrate kinase, FGGY; n=19; Proteo...    35   1.9  
UniRef50_Q67Y17 Cluster: MRNA, complete cds, clone: RAFL25-18-P1...    35   1.9  
UniRef50_Q80QU6 Cluster: Putative uncharacterized protein; n=1; ...    34   2.4  
UniRef50_Q3WB15 Cluster: Carbohydrate kinase, FGGY; n=1; Frankia...    34   2.4  
UniRef50_A4RTW5 Cluster: Predicted protein; n=2; Ostreococcus|Re...    34   2.4  
UniRef50_Q9P8C8 Cluster: D-xylulokinase; n=1; Piromyces sp. E2|R...    34   2.4  
UniRef50_UPI00006CB160 Cluster: hypothetical protein TTHERM_0029...    34   3.2  
UniRef50_Q755I4 Cluster: GTPase-activating protein GYP5; n=1; Er...    34   3.2  
UniRef50_UPI000155CD21 Cluster: PREDICTED: similar to GK5 protei...    33   4.3  
UniRef50_Q848P3 Cluster: GlpK; n=2; Bacteria|Rep: GlpK - uncultu...    33   4.3  
UniRef50_Q1IT93 Cluster: Xylulokinase; n=8; Bacteria|Rep: Xylulo...    33   4.3  
UniRef50_Q5TV36 Cluster: ENSANGP00000027640; n=1; Anopheles gamb...    33   4.3  
UniRef50_P40349 Cluster: Siderophore biosynthesis regulatory pro...    33   4.3  
UniRef50_UPI0000E80D0B Cluster: PREDICTED: hypothetical protein;...    33   5.7  
UniRef50_UPI0000DA413F Cluster: PREDICTED: hypothetical protein;...    33   5.7  
UniRef50_Q73S55 Cluster: Putative uncharacterized protein; n=2; ...    33   5.7  
UniRef50_Q392M6 Cluster: 6-aminohexanoate-dimer hydrolase; n=7; ...    33   5.7  
UniRef50_Q6UCQ2 Cluster: Predicted glycerol kinase; n=2; Bacteri...    33   5.7  
UniRef50_A3J961 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q7S1W4 Cluster: Putative uncharacterized protein NCU059...    33   5.7  
UniRef50_Q6MYZ3 Cluster: Esterase/lipase/thioesterase family pro...    33   5.7  
UniRef50_A5E1H4 Cluster: Glycerol kinase; n=5; Saccharomycetales...    33   5.7  
UniRef50_UPI0000DD7F6C Cluster: PREDICTED: hypothetical protein;...    33   7.5  
UniRef50_Q3W963 Cluster: Regulatory protein, LuxR:Response regul...    33   7.5  
UniRef50_A6X3I3 Cluster: Carbohydrate kinase FGGY; n=1; Ochrobac...    33   7.5  
UniRef50_A1WHZ5 Cluster: Zinc finger/thioredoxin putative; n=1; ...    33   7.5  
UniRef50_Q0IQW8 Cluster: Os11g0702900 protein; n=1; Oryza sativa...    33   7.5  
UniRef50_A3CRV8 Cluster: CDP-alcohol phosphatidyltransferase pre...    33   7.5  
UniRef50_UPI00005A1939 Cluster: PREDICTED: hypothetical protein ...    32   9.9  
UniRef50_UPI0000EB3566 Cluster: Protein FAM71A.; n=2; Canis lupu...    32   9.9  
UniRef50_Q8UAJ0 Cluster: Rhiziobicin secretion; n=2; Rhizobiales...    32   9.9  
UniRef50_Q2RNP0 Cluster: Carbohydrate kinase, FGGY; n=1; Rhodosp...    32   9.9  
UniRef50_A7HCU5 Cluster: tRNA(Ile)-lysidine synthetase; n=2; Ana...    32   9.9  
UniRef50_A6UD03 Cluster: Carbohydrate kinase FGGY; n=3; Rhizobia...    32   9.9  
UniRef50_A5ZM39 Cluster: Putative uncharacterized protein; n=1; ...    32   9.9  
UniRef50_A3Q2D8 Cluster: Carbohydrate kinase, FGGY; n=6; Actinom...    32   9.9  
UniRef50_A1G8K0 Cluster: Acyl-CoA dehydrogenase-like; n=2; Salin...    32   9.9  
UniRef50_Q6H632 Cluster: Putative uncharacterized protein P0030D...    32   9.9  
UniRef50_Q0IV36 Cluster: Os11g0115800 protein; n=1; Oryza sativa...    32   9.9  
UniRef50_Q0DU45 Cluster: Os03g0208400 protein; n=1; Oryza sativa...    32   9.9  
UniRef50_Q7QJM6 Cluster: ENSANGP00000010758; n=1; Anopheles gamb...    32   9.9  

>UniRef50_Q54VT8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 539

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 30/79 (37%), Positives = 44/79 (55%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLPALTNXXXXXX 330
           +Q+Q+DLLG+PV++P+ +E+T  GAA  AG A  VW  T+       F P L        
Sbjct: 461 LQIQSDLLGLPVVKPISLETTCFGAAFAAGIATGVWKETMQFKIGGKFTPQLDENHKTQK 520

Query: 329 XXXXXEALNKCMGWTDTKN 273
                +A++K + W DTKN
Sbjct: 521 LKEWKKAISKSLDWIDTKN 539


>UniRef50_UPI0000D55908 Cluster: PREDICTED: similar to CG7995-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG7995-PA, isoform A - Tribolium castaneum
          Length = 517

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 35/96 (36%), Positives = 46/96 (47%), Gaps = 5/96 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVWPTTIPSP---PADTFLPALTNX 345
           +Q+QAD+ GIPVIR    + TALG AI AG+A  + VW          P+DTFLP  T  
Sbjct: 396 MQLQADISGIPVIRAQSQDITALGVAIAAGQAKGIEVWDLNAEDREVIPSDTFLPTTTED 455

Query: 344 XXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELL 237
                      A+ + +GW   K      E +  LL
Sbjct: 456 ERDSRYTKWKMAVQRSLGWAVPKKTFTMTEERYRLL 491


>UniRef50_Q14409 Cluster: Glycerol kinase, testis specific 1; n=175;
           cellular organisms|Rep: Glycerol kinase, testis specific
           1 - Homo sapiens (Human)
          Length = 553

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++PLM E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>UniRef50_Q1DHV8 Cluster: Putative uncharacterized protein; n=2;
           Onygenales|Rep: Putative uncharacterized protein -
           Coccidioides immitis
          Length = 569

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 5/81 (6%)
 Frame = -3

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWP-----TTIPSPPADTFLPALTN 348
           ++Q QADL+ IPVIRP M E+TA GAAI AG A+ +W        + +     F P++  
Sbjct: 488 TMQTQADLISIPVIRPAMRETTAFGAAIAAGLAVGLWEGIEELQNVNTDGQTVFGPSIQK 547

Query: 347 XXXXXXXXXXXEALNKCMGWT 285
                      +A+  C GW+
Sbjct: 548 EEAEERFLRWEKAVRMCQGWS 568


>UniRef50_Q7WF38 Cluster: Glycerol kinase; n=41; Bacteria|Rep:
           Glycerol kinase - Bordetella bronchiseptica (Alcaligenes
           bronchisepticus)
          Length = 508

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 24/36 (66%), Positives = 30/36 (83%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +QMQADLLG+PV+RP + ESTALGAA +AG A+  W
Sbjct: 423 MQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFW 458


>UniRef50_A1CT92 Cluster: Glycerol kinase, putative; n=25;
           Dikarya|Rep: Glycerol kinase, putative - Aspergillus
           clavatus
          Length = 596

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/37 (62%), Positives = 30/37 (81%)
 Frame = -3

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           ++Q+QADL+ IPV RP M E+TALGAAI AG A+ +W
Sbjct: 427 AMQIQADLISIPVYRPKMRETTALGAAIAAGLAVGMW 463


>UniRef50_Q8R8J4 Cluster: Glycerol kinase; n=13; Bacteria|Rep:
           Glycerol kinase - Thermoanaerobacter tengcongensis
          Length = 497

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+LG+PV RP ++E+TALGAA +AG A+  W
Sbjct: 417 MQFQADILGVPVDRPQVIETTALGAAYLAGLAVGFW 452


>UniRef50_Q827G1 Cluster: Glycerol kinase 2; n=3;
           Actinomycetales|Rep: Glycerol kinase 2 - Streptomyces
           avermitilis
          Length = 507

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+LG+PVIRP + E+T LGAA  AG A  VW
Sbjct: 423 MQHQADVLGVPVIRPRVSETTCLGAAYAAGLATGVW 458


>UniRef50_Q4RK70 Cluster: Chromosome 2 SCAF15032, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 2
           SCAF15032, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 616

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 5/83 (6%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVWPTT---IPSPPADTFLPALTNX 345
           +Q+QAD+L   V+RP M E+TALGAA+ AG A  + VW  +   +P    + + P +   
Sbjct: 532 MQLQADILCTTVVRPTMSETTALGAAMAAGAAEGVNVWSLSSSHLPKVTCEAYEPQINLD 591

Query: 344 XXXXXXXXXXEALNKCMGWTDTK 276
                     +A+ + M W  T+
Sbjct: 592 ESEFRFARWKKAVQRSMNWETTE 614



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL QL  DGGM  N +L
Sbjct: 492 AALEAVCFQTREILDAMNQDSRVPLTQLQVDGGMTSNRLL 531


>UniRef50_Q4SEQ1 Cluster: Chromosome 3 SCAF14614, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 3
           SCAF14614, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 652

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 5/57 (8%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPAL 354
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  +    ++ F P +
Sbjct: 543 MQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWSLNPEDLSEVTSEKFEPQI 599



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL QL  DGGM  N +L
Sbjct: 503 AALEAVCFQTREILDAMNQDSGIPLTQLQVDGGMTSNRLL 542


>UniRef50_Q8PQG7 Cluster: Glycerol kinase; n=44; Bacteria|Rep:
           Glycerol kinase - Xanthomonas axonopodis pv. citri
          Length = 499

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 3/48 (6%)
 Frame = -3

Query: 536 RRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           R DG  +++    Q Q+D+L +PV+RP + E+TALGAA +AG A   W
Sbjct: 407 RADGGAIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFW 454


>UniRef50_O69664 Cluster: Glycerol kinase; n=12; cellular
           organisms|Rep: Glycerol kinase - Mycobacterium
           tuberculosis
          Length = 517

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 19/36 (52%), Positives = 28/36 (77%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QAD+LG+ V+RP++ E+TALG A  AG A+  W
Sbjct: 436 MQIQADVLGVDVVRPVVAETTALGVAYAAGLAVGFW 471


>UniRef50_A0JPS9 Cluster: At1g80460; n=13; Magnoliophyta|Rep:
           At1g80460 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 522

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/36 (55%), Positives = 28/36 (77%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+QADL+G PV+RP+ +E+TALGAA  A  A+  W
Sbjct: 438 MQIQADLMGSPVVRPVDIETTALGAAYAARLAVGFW 473


>UniRef50_Q9PB76 Cluster: Glycerol kinase; n=245; cellular
           organisms|Rep: Glycerol kinase - Xylella fastidiosa
          Length = 499

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 3/48 (6%)
 Frame = -3

Query: 536 RRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           R DGA +++    Q Q+D+L +PV+R  + E+TALGAA +AG A   W
Sbjct: 407 RTDGAAITNDFMAQFQSDILAVPVLRSEIAETTALGAAYLAGLATGFW 454


>UniRef50_Q8YW05 Cluster: Glycerol kinase; n=8; Bacteria|Rep:
           Glycerol kinase - Anabaena sp. (strain PCC 7120)
          Length = 500

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+LGIPV RP M ++T  GAA  AG A+  W
Sbjct: 422 MQFQADVLGIPVERPTMRDTTVQGAAFAAGLAVGFW 457


>UniRef50_Q7JY99 Cluster: RE20574p; n=4; Sophophora|Rep: RE20574p -
           Drosophila melanogaster (Fruit fly)
          Length = 596

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 5/115 (4%)
 Frame = -3

Query: 530 DGAE-LSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV----WPTTIPSPPADTF 366
           D AE L  VQ  AD++G  + RP       LG  I AG  M+V        + +PP D F
Sbjct: 458 DYAENLHLVQFIADIIGYMLERPQTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVF 517

Query: 365 LPALTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELLQFCRRDFFSSEP 201
            P  T             A+ KC+ W    N +   E  IEL  F +R+   + P
Sbjct: 518 SPTTTKNRRELLYKRWAYAVKKCLHW----NNYETYEADIEL--FAQRELDPNLP 566


>UniRef50_Q9NJP9 Cluster: Glycerol kinase, glycosomal; n=19;
           Trypanosomatidae|Rep: Glycerol kinase, glycosomal -
           Trypanosoma brucei brucei
          Length = 512

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/36 (52%), Positives = 27/36 (75%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +++QA LLG+ ++ P M E+TALGAA+ AG A  VW
Sbjct: 430 MEIQASLLGVDILVPSMHETTALGAALCAGLAAGVW 465


>UniRef50_Q8FLY8 Cluster: Glycerol kinase; n=15; Bacteria|Rep:
           Glycerol kinase - Corynebacterium efficiens
          Length = 508

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = -3

Query: 536 RRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAG 420
           R DGA + +   +QMQAD+LGI VIRP  +E+TALG A  AG
Sbjct: 419 RVDGAMVQNELLMQMQADILGIDVIRPGDIETTALGTAFAAG 460


>UniRef50_O66746 Cluster: Glycerol kinase; n=3; cellular
           organisms|Rep: Glycerol kinase - Aquifex aeolicus
          Length = 492

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/36 (58%), Positives = 26/36 (72%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+LGIPV RP  +E TALGAA +AG    +W
Sbjct: 411 MQFQADILGIPVERPRHVELTALGAAGIAGIYSGMW 446


>UniRef50_A3H9C0 Cluster: Glycerol kinase; n=9; cellular
           organisms|Rep: Glycerol kinase - Caldivirga
           maquilingensis IC-167
          Length = 532

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = -3

Query: 545 PRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           PR + DG        +Q QAD+ GI V RP++ E+T+LGA  +AG A+  W
Sbjct: 429 PRIKVDGGAAKDNFLMQFQADITGIEVWRPVIFETTSLGAGYLAGLAVGFW 479


>UniRef50_Q176X4 Cluster: Glycerol kinase; n=6; Endopterygota|Rep:
           Glycerol kinase - Aedes aegypti (Yellowfever mosquito)
          Length = 557

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 8/99 (8%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPAD--------TFLPAL 354
           +Q+QADL+GIPV++  + +   LG A+ A +A  +    + +   D        TFLP  
Sbjct: 435 MQLQADLVGIPVLKTEVSDPATLGTAMAAAQAKGIELYNMDNDNRDYTLHITHETFLPTT 494

Query: 353 TNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELL 237
           T             A+ + +GW  TK      + +  +L
Sbjct: 495 TEEERNARYTKWKMAVQRSLGWAVTKKSDAMTDERYSML 533


>UniRef50_Q5KII9 Cluster: Glycerol kinase, putative; n=1;
           Filobasidiella neoformans|Rep: Glycerol kinase, putative
           - Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 759

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 9/90 (10%)
 Frame = -3

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV--WPTTIPSPPAD-------TFLP 360
           ++Q+QA++ G  V RP M ESTALG+A++A  A+ +  W  T P   ++       TF P
Sbjct: 650 AMQLQANIGGFNVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAGVHTFEP 709

Query: 359 ALTNXXXXXXXXXXXEALNKCMGWTDTKNE 270
            L             +A+++   W D  +E
Sbjct: 710 ELEEKARLKKIKGWNKAVDRAKKWHDIDDE 739


>UniRef50_O29395 Cluster: Uncharacterized sugar kinase AF_0866; n=1;
           Archaeoglobus fulgidus|Rep: Uncharacterized sugar kinase
           AF_0866 - Archaeoglobus fulgidus
          Length = 492

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = -3

Query: 569 RLRAPEATPRRRRDGAELSS----VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           R   P  T R R DG E+SS    +Q  AD+ G+ V R  ++  T+ GA +VAGRA+  W
Sbjct: 397 RKEFPYETDRIRCDG-EMSSNDFFLQRIADVTGLKVERGAVLSGTSFGAHLVAGRALGKW 455

Query: 401 PTTIPSPPADTFLPAL 354
                 P    F P+L
Sbjct: 456 KKDFCMPFDKVFEPSL 471


>UniRef50_Q828K5 Cluster: Glycerol kinase 1; n=3; cellular
           organisms|Rep: Glycerol kinase 1 - Streptomyces
           avermitilis
          Length = 512

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTT 393
           +Q  +D L  PV+RP++ E+T LGAA  AG A+  W  T
Sbjct: 430 MQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWTNT 468


>UniRef50_A6QVZ2 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 518

 Score = 40.7 bits (91), Expect = 0.028
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 6/82 (7%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT------TIPSPPADTFLPALTN 348
           +Q Q+D++ +P+ RP M E TALGAAI AG A+ ++        T  S  +  F P +  
Sbjct: 434 MQSQSDIIQLPISRPEMHEITALGAAIAAGYAIGIFKDLEALRGTNKSRRSTIFKPEIAE 493

Query: 347 XXXXXXXXXXXEALNKCMGWTD 282
                      +A+    GW D
Sbjct: 494 SESARMYKQWSKAVEMSRGWLD 515


>UniRef50_P44400 Cluster: Glycerol kinase; n=103; cellular
           organisms|Rep: Glycerol kinase - Haemophilus influenzae
          Length = 503

 Score = 40.3 bits (90), Expect = 0.037
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+L + V RP++ E TALGAA +AG A   W
Sbjct: 420 MQFQADILDVNVERPVVKEVTALGAAYLAGLATGFW 455


>UniRef50_Q9W095 Cluster: CG7995-PA, isoform A; n=4;
           Endopterygota|Rep: CG7995-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 576

 Score = 39.9 bits (89), Expect = 0.049
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484


>UniRef50_A1WIH8 Cluster: Carbohydrate kinase, FGGY; n=3;
           Proteobacteria|Rep: Carbohydrate kinase, FGGY -
           Verminephrobacter eiseniae (strain EF01-2)
          Length = 484

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPADTFLPALTNXXXXXXX 327
           Q  AD+LG  ++     E TALG A +A R       T     AD+F P +T        
Sbjct: 400 QFLADMLGRTIVTSRFDERTALGCAALAARGAGQLLPTQADDMADSFEPRITPGQAQDWQ 459

Query: 326 XXXXEALNKCMGW 288
                A++K MGW
Sbjct: 460 LRFDAAVSKTMGW 472


>UniRef50_A5WG03 Cluster: Glycerol kinase; n=3; Psychrobacter|Rep:
           Glycerol kinase - Psychrobacter sp. PRwf-1
          Length = 529

 Score = 39.1 bits (87), Expect = 0.086
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = -3

Query: 560 APEATPRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAG 420
           +P      R DG   ++   +Q Q+D+LG+PV+RP   E TA G A++AG
Sbjct: 434 SPSPLTELRVDGGAANNNLLMQFQSDMLGVPVLRPKDTEITAKGVALLAG 483


>UniRef50_A0U6Y3 Cluster: Putative uncharacterized protein
           precursor; n=1; Burkholderia cenocepacia MC0-3|Rep:
           Putative uncharacterized protein precursor -
           Burkholderia cenocepacia MC0-3
          Length = 633

 Score = 39.1 bits (87), Expect = 0.086
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 5/78 (6%)
 Frame = +1

Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGA----RSLQP 576
           R+A+P+++A      +  RGR   +  +  C       A  LRRR VA  A       +P
Sbjct: 116 RVAQPSSVARVTGRRAPYRGRTRPVGLEDHCELAGRRHAAPLRRRRVARAAVQQRGHRRP 175

Query: 577 SRPPRRAS-GDTRPPARP 627
            RP RRA  GD RP  RP
Sbjct: 176 DRPARRAGPGDRRPRGRP 193


>UniRef50_A5AZ03 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 180

 Score = 39.1 bits (87), Expect = 0.086
 Identities = 19/35 (54%), Positives = 26/35 (74%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV 405
           +Q+QADLL  PV+RP  +E+TALGAA   G A+ +
Sbjct: 146 MQIQADLLRNPVVRPGDIETTALGAAYATGLAVGI 180


>UniRef50_Q16PC1 Cluster: Glycerol kinase; n=2; Culicidae|Rep:
           Glycerol kinase - Aedes aegypti (Yellowfever mosquito)
          Length = 595

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT----TIPSPPADTFLPALTNXX 342
           +Q+ ADL G+ + RP       LG  + AG AM +           PP D + PAL +  
Sbjct: 466 MQILADLCGVSIERPQTSTPACLGTMLAAGLAMEILTLDEFRACCIPPTDQYSPALNSSH 525

Query: 341 XXXXXXXXXEALNKCMGWTDTKNEHVNAENQIEL 240
                     A+++C+ +       ++   Q EL
Sbjct: 526 RDMKFRKWKIAVDRCLNFDSVSETDLSKFQQEEL 559


>UniRef50_P57944 Cluster: Glycerol kinase; n=53; Bacteria|Rep:
           Glycerol kinase - Pasteurella multocida
          Length = 502

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q QAD+L   V RP + E TALGAA +AG A   W
Sbjct: 420 MQFQADILATKVERPKVKEVTALGAAYLAGLATGFW 455


>UniRef50_UPI0000E49293 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 475

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q  A+LLG P+ RP  ++ + LGAA +AG A  +W
Sbjct: 396 LQSMANLLGQPIERPTNLDMSCLGAAFLAGLATGIW 431


>UniRef50_A5GTS6 Cluster: Glycerol kinase; n=12; Synechococcus|Rep:
           Glycerol kinase - Synechococcus sp. (strain RCC307)
          Length = 509

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAG 420
           +Q QA+  G+PV RP  +ESTALG A++AG
Sbjct: 425 LQAQANSSGVPVRRPDQLESTALGVALLAG 454


>UniRef50_A0H464 Cluster: Carbohydrate kinase, FGGY; n=2;
           Chloroflexus|Rep: Carbohydrate kinase, FGGY -
           Chloroflexus aggregans DSM 9485
          Length = 523

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT-TIP---SPPADTFLPALTNXXX 339
           Q+QAD+ G+ +IR    E+TA G A++AG    +W   T+P      A  F+P L     
Sbjct: 415 QIQADISGVTLIRARDTETTARGVALLAGIGAGIWSLGTMPVLVDETARRFVPQLWASER 474

Query: 338 XXXXXXXXEALNKCMGW 288
                    A+ +  GW
Sbjct: 475 AARYAQWQMAVERVKGW 491


>UniRef50_A2GDR8 Cluster: Glycerol kinase family protein; n=1;
           Trichomonas vaginalis G3|Rep: Glycerol kinase family
           protein - Trichomonas vaginalis G3
          Length = 501

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVA--GRAMRVWPTTIPSPPADTFLPALTNXXXX 336
           +Q QADLL I V+R   +E+T+ GAAI A  G  M             TF P +++    
Sbjct: 416 LQFQADLLNIDVLRGANVEATSKGAAIAAAYGIGMAGAGIITGDEECKTFSPMVSDRKRS 475

Query: 335 XXXXXXXEALNKCMGWTDTKNE 270
                  +A+ + M W + + E
Sbjct: 476 FKLKMWKKAIQRSMDWLEQEEE 497


>UniRef50_A4TNB8 Cluster: Carbohydrate kinase; n=9; Yersinia|Rep:
           Carbohydrate kinase - Yersinia pestis (strain Pestoides
           F)
          Length = 517

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPL-MMESTALGAAIVAGRAMRVWP 399
           QMQAD+ G  V+      E  A GAA+VAG A+ VWP
Sbjct: 429 QMQADIFGCDVLTTKGAAEGAAFGAALVAGLAIGVWP 465


>UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing
           protein 5; n=4; Arabidopsis thaliana|Rep: Formin
           homology 2 domain-containing protein 5 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 900

 Score = 36.7 bits (81), Expect = 0.46
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPARP 627
           LSS   + RR +A+    + S  PSRPP+R+ G  RPP RP
Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPTRP 167


>UniRef50_Q4JTK9 Cluster: Putative glycerol kinase; n=1;
           Corynebacterium jeikeium K411|Rep: Putative glycerol
           kinase - Corynebacterium jeikeium (strain K411)
          Length = 528

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAM 411
           +Q QAD L +PV  P + E+TALGAA  AG A+
Sbjct: 448 MQFQADQLEVPVTVPEVSETTALGAAYAAGLAV 480


>UniRef50_Q189T3 Cluster: Glycerol kinase; n=3; Clostridium
           difficile|Rep: Glycerol kinase - Clostridium difficile
           (strain 630)
          Length = 508

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)
 Frame = -3

Query: 512 SVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT--TIPS--PPADTFLPALTNX 345
           ++Q Q+D+LGIP+      E+T LG   +AG +  VW +   I S    +  ++P +T  
Sbjct: 420 TMQFQSDILGIPIEIAENPETTVLGVGYMAGLSCGVWNSIDEIRSEFTISKKYIPNMTTQ 479

Query: 344 XXXXXXXXXXEALNKCMGW-TDTKNEHVN 261
                     +A+ + M W  DTK    N
Sbjct: 480 KREEILLGWNQAVKRAMNWENDTKKVCAN 508


>UniRef50_Q9HNS5 Cluster: Glycerol kinase; n=104; cellular
           organisms|Rep: Glycerol kinase - Halobacterium
           salinarium (Halobacterium halobium)
          Length = 510

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = -3

Query: 551 ATPRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +T   R DG  + +    Q+Q+D++   + RP + E+TALGAA  AG A+  W
Sbjct: 412 STTTLRVDGGAVKNNFLCQLQSDIIQTDLARPEVDETTALGAAYAAGLAVGYW 464


>UniRef50_Q6D5T8 Cluster: Glycerol kinase; n=16;
           Gammaproteobacteria|Rep: Glycerol kinase - Erwinia
           carotovora subsp. atroseptica (Pectobacterium
           atrosepticum)
          Length = 496

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
 Frame = -3

Query: 551 ATPRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           A P  R DG    +   +Q QADLL  P+IR    E +ALGAA + G+ +  W
Sbjct: 399 ALPALRVDGGATQNRWLMQFQADLLQRPLIRNHNAEVSALGAAYLGGKMLGWW 451


>UniRef50_Q5SHS2 Cluster: Putative uncharacterized protein TTHA1658;
           n=2; Thermus thermophilus|Rep: Putative uncharacterized
           protein TTHA1658 - Thermus thermophilus (strain HB8 /
           ATCC 27634 / DSM 579)
          Length = 256

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 4/75 (5%)
 Frame = +1

Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICT-ELSSAPSLRRRGVASGARSLQ---PSR 582
           ARPA   AP+A  +   G     P++   +    L  AP     G ASG   +    PS 
Sbjct: 36  ARPAPPPAPQAPAATAPGPAGEAPAEEPVVTVLPLPEAPPAPSPGEASGRAPVSAPSPSE 95

Query: 583 PPRRASGDTRPPARP 627
           P R ++G   PPA P
Sbjct: 96  PARSSAGAASPPASP 110


>UniRef50_Q4EMM9 Cluster: Putative uncharacterized protein; n=1;
           Listeria monocytogenes str. 1/2a F6854|Rep: Putative
           uncharacterized protein - Listeria monocytogenes str.
           1/2a F6854
          Length = 242

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 22/47 (46%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = +1

Query: 406 TRIARPATMAAPRAVLSIMRGRMTGIP--SKSACICTELSSAPSLRR 540
           T  ARPA  AAP  V+S+  GR TG P  S   CI   L+ AP   R
Sbjct: 177 TPTARPAKKAAPSTVVSLFSGRSTGTPRISDWNCIKKLLAEAPPSTR 223


>UniRef50_Q7XI12 Cluster: ATPase-like protein; n=5;
           Viridiplantae|Rep: ATPase-like protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 707

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 490 KSAC-ICTELSSAPSLRRRGVASGARSLQPSRPPRRASGD 606
           + AC + ++    PS RRRG   G R   P  P RR SGD
Sbjct: 15  RPACRVASQCGGRPSTRRRGAGGGPRRAVPQPPVRRPSGD 54


>UniRef50_Q96T92 Cluster: Insulinoma-associated protein 2; n=13;
           Euteleostomi|Rep: Insulinoma-associated protein 2 - Homo
           sapiens (Human)
          Length = 567

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 30/87 (34%), Positives = 39/87 (44%), Gaps = 1/87 (1%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRD-GAELSSVQMQADLLGIPVIRPLMMESTAL 441
           GGR   + R GGR+G    +P  +P   +  GAEL   +  +  L  PV      ES   
Sbjct: 87  GGREGAEWRAGGREGPG-PSPSPSPSPAKPAGAELRRARSWSACLSSPV----SAESFPG 141

Query: 440 GAAIVAGRAMRVWPTTIPSPPADTFLP 360
           GAA VA  +  V P   P+P     LP
Sbjct: 142 GAAAVAAFSCSVAPAAAPTPGEQFLLP 168


>UniRef50_Q8UE58 Cluster: Glycerol kinase 2; n=5;
           Alphaproteobacteria|Rep: Glycerol kinase 2 -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 489

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 3/59 (5%)
 Frame = -3

Query: 569 RLRAPEATPRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           R ++P    R   DG    +   +Q  AD+L  PVI+    E++ALGAA +AG A+ VW
Sbjct: 384 RAQSPSGFGRLFVDGGPSQNRFLMQCVADMLEHPVIQRDAPEASALGAAYLAGLALGVW 442


>UniRef50_Q5KYL0 Cluster: Gluconokinase; n=2; Geobacillus|Rep:
           Gluconokinase - Geobacillus kaustophilus
          Length = 521

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           QM AD+LG P+I P   E++ALGAA VA  A+   P+
Sbjct: 432 QMLADMLGKPLIVPQTHEASALGAAAVALHALGELPS 468


>UniRef50_Q4ITQ5 Cluster: Putative uncharacterized protein
           precursor; n=1; Azotobacter vinelandii AvOP|Rep:
           Putative uncharacterized protein precursor - Azotobacter
           vinelandii AvOP
          Length = 792

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 33/90 (36%), Positives = 37/90 (41%)
 Frame = +1

Query: 358 AGRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLR 537
           AGR   A       G  R  RP    APR+  +   G   G   +   IC    + P  R
Sbjct: 197 AGRGPGASRRWRPSGRARPGRPG--GAPRSPPARCAGGSAGRFRQGGRICRRSRATP--R 252

Query: 538 RRGVASGARSLQPSRPPRRASGDTRPPARP 627
           R G A  AR   PS P RR   D RPP RP
Sbjct: 253 RAGRA--ARRRGPS-PRRRRGADGRPPGRP 279


>UniRef50_UPI0000E81406 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 310

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
 Frame = +1

Query: 463 RGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP--RRASGDTRPPARP 627
           R R  G+ S      T L  A SLRRR    G ++ +P RPP  RR +   RPP  P
Sbjct: 104 RRRPRGLRSGLRGRVTPLLGAASLRRRRENGGKKAARPRRPPSSRRGALPPRPPPPP 160


>UniRef50_Q9HJ76 Cluster: Probable glycerol kinase; n=1;
           Thermoplasma acidophilum|Rep: Probable glycerol kinase -
           Thermoplasma acidophilum
          Length = 488

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 4/78 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPP----ADTFLPALTNXX 342
           +Q QAD+    V+ P   E+TALG+A ++G    +W +             + P ++   
Sbjct: 407 MQFQADIANAEVLVPESSETTALGSAYLSGLVSGLWKSKDEIRELWRLKKVYRPVMSEEE 466

Query: 341 XXXXXXXXXEALNKCMGW 288
                    +A+ +CMGW
Sbjct: 467 RKRNYVGWKDAVKRCMGW 484


>UniRef50_P77432 Cluster: Uncharacterized sugar kinase ydeV; n=57;
           Bacteria|Rep: Uncharacterized sugar kinase ydeV -
           Escherichia coli (strain K12)
          Length = 530

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAG 420
           Q+ AD+ G+PV  P++ E+TALG AI AG
Sbjct: 437 QILADVSGLPVNIPVVKEATALGCAIAAG 465


>UniRef50_Q2SYV7 Cluster: Gp48, putative; n=1; Burkholderia
           thailandensis E264|Rep: Gp48, putative - Burkholderia
           thailandensis (strain E264 / ATCC 700388 / DSM 13276
           /CIP 106301)
          Length = 630

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 30/88 (34%), Positives = 42/88 (47%)
 Frame = +1

Query: 358 AGRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLR 537
           A R     G+   + + R A P+  AA  AV S+ R R   +   +  +   LS AP+L 
Sbjct: 46  AARRRRGNGIERRLSYHREASPSR-AAEIAVQSVHRNR--NMRHAALAVLVSLSVAPALA 102

Query: 538 RRGVASGARSLQPSRPPRRASGDTRPPA 621
              VAS A S   +RPP  A+G  +P A
Sbjct: 103 AAQVASPADSASTARPP-AAAGRPQPDA 129


>UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1;
           Plesiocystis pacifica SIR-1|Rep: Translation initiation
           factor IF-2 - Plesiocystis pacifica SIR-1
          Length = 936

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +1

Query: 490 KSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624
           ++A +  + S AP++RR  V    +S + SR P R  G  R PAR
Sbjct: 105 EAARVAAQPSPAPAVRRSEVRRRGQSPEASRSPERRDGSARQPAR 149


>UniRef50_A3K4H7 Cluster: Glycerol kinase protein; n=1; Sagittula
           stellata E-37|Rep: Glycerol kinase protein - Sagittula
           stellata E-37
          Length = 86

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWP 399
           +Q   D+L  P+ RP + E+TA G A +AG    +WP
Sbjct: 1   MQFLDDMLDCPIDRPRITETTAFGVAWLAGYTSGLWP 37


>UniRef50_A0IYQ7 Cluster: Carbohydrate kinase, FGGY; n=19;
           Proteobacteria|Rep: Carbohydrate kinase, FGGY -
           Shewanella woodyi ATCC 51908
          Length = 528

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 14/39 (35%), Positives = 27/39 (69%)
 Frame = -3

Query: 515 SSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWP 399
           +++Q+ AD+ G+P +R   +E++ LGAAI A   + ++P
Sbjct: 434 AAMQIAADIFGLPTVRAHTIETSGLGAAIDAAVGLGLYP 472


>UniRef50_Q67Y17 Cluster: MRNA, complete cds, clone: RAFL25-18-P16;
           n=9; cellular organisms|Rep: MRNA, complete cds, clone:
           RAFL25-18-P16 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 579

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           +Q  AD++G P+I P   ES  LGAAI+   A + +P+
Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526


>UniRef50_Q80QU6 Cluster: Putative uncharacterized protein; n=1;
           Oyster mushroom spherical virus|Rep: Putative
           uncharacterized protein - Oyster mushroom spherical
           virus
          Length = 210

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 21/57 (36%), Positives = 29/57 (50%)
 Frame = +1

Query: 424 ATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           +++A    VLSI       +   +  ICT+  SAP LRR  V   A+ LQ +  PRR
Sbjct: 73  SSLAQRTRVLSISPAAFAPMEPLNLPICTKPLSAPELRRYSVVLSAQVLQSALHPRR 129


>UniRef50_Q3WB15 Cluster: Carbohydrate kinase, FGGY; n=1; Frankia
           sp. EAN1pec|Rep: Carbohydrate kinase, FGGY - Frankia sp.
           EAN1pec
          Length = 506

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTT-IPSPP 378
           +Q+QAD+ G+PV        +ALGAA++AG     W    +P PP
Sbjct: 421 MQLQADVSGLPVRISATPNLSALGAALLAGVGAGWWTLDGLPEPP 465


>UniRef50_A4RTW5 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 522

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVA 423
           +Q+QAD +G+ VIRP  +E+TA GAA  A
Sbjct: 438 MQIQADCIGLNVIRPSDVETTARGAAYAA 466


>UniRef50_Q9P8C8 Cluster: D-xylulokinase; n=1; Piromyces sp. E2|Rep:
           D-xylulokinase - Piromyces sp. E2
          Length = 494

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = -3

Query: 596 ARRGGRDGCRLRAPEATPRRRRDGAELSSV--QMQADLLGIPVIRPLMMESTALGAAIVA 423
           A RGG D  R    +    R   G   S +  Q+ AD++ +P+  PL+ E+ ALG A+ A
Sbjct: 377 AMRGGLDAFRKLGFQPKEIRLIGGGSKSDLWRQIAADIMNLPIRVPLLEEAAALGGAVQA 436


>UniRef50_UPI00006CB160 Cluster: hypothetical protein TTHERM_00298410;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00298410 - Tetrahymena thermophila SB210
          Length = 1366

 Score = 33.9 bits (74), Expect = 3.2
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +3

Query: 387  GYCRGPHTHCATCDNGRPQGC 449
            G C G H  C++C NG PQGC
Sbjct: 1160 GNCSGCHYSCSSCLNGSPQGC 1180


>UniRef50_Q755I4 Cluster: GTPase-activating protein GYP5; n=1;
           Eremothecium gossypii|Rep: GTPase-activating protein
           GYP5 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 829

 Score = 33.9 bits (74), Expect = 3.2
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 2/90 (2%)
 Frame = +1

Query: 364 RNVSAGGLGIV--VGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLR 537
           R  +A   G +  +G  R        +P+A  +    R  G  +K A I      A S +
Sbjct: 98  RKATAAAAGALPGIGRARSGSVKEGGSPKAAGAESPRRGAGAAAKDAKISERAEGAGSPQ 157

Query: 538 RRGVASGARSLQPSRPPRRASGDTRPPARP 627
           +R   +GA +  P  PPRR      PPA P
Sbjct: 158 QRKQGTGAAA--PGSPPRRRLEAAEPPATP 185


>UniRef50_UPI000155CD21 Cluster: PREDICTED: similar to GK5 protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           GK5 protein - Ornithorhynchus anatinus
          Length = 618

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +QM +DL+   + RP  ++ + LGAA +AG A+  W
Sbjct: 478 MQMTSDLINEKIDRPAQVDMSCLGAAFLAGLAVGFW 513


>UniRef50_Q848P3 Cluster: GlpK; n=2; Bacteria|Rep: GlpK - uncultured
           bacterium
          Length = 502

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/34 (44%), Positives = 25/34 (73%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMR 408
           +Q QADLLG PV+R  + E +A+GA ++A + ++
Sbjct: 423 MQYQADLLGCPVMRSDIPELSAIGAGLLARKKLQ 456


>UniRef50_Q1IT93 Cluster: Xylulokinase; n=8; Bacteria|Rep:
           Xylulokinase - Acidobacteria bacterium (strain Ellin345)
          Length = 505

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPS-----PPADTFLPALTN 348
           Q+QAD+    V   L+ E  A GAA++AG   +VWPT   +        +T  P LTN
Sbjct: 418 QIQADVYKHKVETILVDEGAAHGAALLAGVGAKVWPTVDAACAETVQVGETIAPDLTN 475


>UniRef50_Q5TV36 Cluster: ENSANGP00000027640; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000027640 - Anopheles gambiae
           str. PEST
          Length = 404

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 5/74 (6%)
 Frame = +1

Query: 421 PATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPR--- 591
           P  +  PR  +  ++ + T  PS+ A      SS P L        AR+  P+ PPR   
Sbjct: 98  PVLLRLPRRTMRSLKPKPTPSPSRPASTTRSSSSRPRLPAPTPVHPARTRTPAPPPRHTR 157

Query: 592 --RASGDTRPPARP 627
             RA+  + P  RP
Sbjct: 158 PARATPSSMPATRP 171


>UniRef50_P40349 Cluster: Siderophore biosynthesis regulatory protein
            URBS1; n=1; Ustilago maydis|Rep: Siderophore biosynthesis
            regulatory protein URBS1 - Ustilago maydis (Smut fungus)
          Length = 1084

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 2/75 (2%)
 Frame = -3

Query: 626  GRAGGRVSPDAR--RGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMME 453
            G A G    DAR  R G D  +  AP+A PRR +  +  SS   + +L   P      + 
Sbjct: 864  GSAQGSPGADARGTRSGHDSIKQEAPDAAPRRSKAFSNSSSSSEKDELESPPPSAHQQLA 923

Query: 452  STALGAAIVAGRAMR 408
            S  L AA  A  A R
Sbjct: 924  SQPLVAATGAQPASR 938


>UniRef50_UPI0000E80D0B Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 176

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = +1

Query: 508 TELSSAPSLR----RRGVASGARSLQPSRPPRRASGDTRPPARP 627
           T L   PSLR    RR   SG R LQ  RPP RASG  + P  P
Sbjct: 29  TLLGPLPSLRSRTRRRSAPSGQRRLQSRRPP-RASGRRQKPGGP 71


>UniRef50_UPI0000DA413F Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 373

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 29/91 (31%), Positives = 37/91 (40%), Gaps = 2/91 (2%)
 Frame = +1

Query: 361 GRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRR 540
           GR  + GG+G  V     A      APR+V    RGR        A +    +  P LR 
Sbjct: 164 GRGAAGGGVGARVCECVRAVAPPPPAPRSVPLACRGR--------AALSRVRAPPPPLRL 215

Query: 541 RGVASGARSLQPSRPPRRASG--DTRPPARP 627
              AS ++ L+P  PP R       R P RP
Sbjct: 216 LHFASSSQCLEPESPPARRGRILRARQPGRP 246


>UniRef50_Q73S55 Cluster: Putative uncharacterized protein; n=2;
           Mycobacterium avium|Rep: Putative uncharacterized
           protein - Mycobacterium paratuberculosis
          Length = 441

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = +1

Query: 355 RAGRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSL 534
           R GR+ +AG   +VV    +    T AAP  V    R   T   + S+ + T  S+A  +
Sbjct: 315 RPGRHPAAGRGQLVVDRKAVDGAQTPAAPEVVCGHHRRTRTS-GNHSSTVST--SAATLI 371

Query: 535 RRRGVASGARSLQPSRPPRR--ASGDTRPPA 621
              G  S  RS +P+ P  R  A+  + PPA
Sbjct: 372 AAYGAGSQPRSAKPNSPTVRDAANAASEPPA 402


>UniRef50_Q392M6 Cluster: 6-aminohexanoate-dimer hydrolase; n=7;
           Proteobacteria|Rep: 6-aminohexanoate-dimer hydrolase -
           Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 449

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 27/90 (30%), Positives = 39/90 (43%)
 Frame = +1

Query: 358 AGRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLR 537
           +G  V AGGL +      IA  A  AAP A  ++M G M G P  +  +  + ++    R
Sbjct: 17  SGAFVLAGGLALAA----IAH-AVPAAPAATDTVMPGMMHGFPPPADQVVNKANAFTPAR 71

Query: 538 RRGVASGARSLQPSRPPRRASGDTRPPARP 627
            R      R L P+   R A+     P +P
Sbjct: 72  LRWALGNTRLLAPTAGIRHATTPMLLPEQP 101


>UniRef50_Q6UCQ2 Cluster: Predicted glycerol kinase; n=2;
           Bacteria|Rep: Predicted glycerol kinase - uncultured
           marine alpha proteobacterium HOT2C01
          Length = 497

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +Q+ +D+  + + RPL  ESTA+GAA +AG    V+
Sbjct: 419 MQLLSDITQVRIERPLNQESTAMGAAYLAGMKSGVY 454


>UniRef50_A3J961 Cluster: Putative uncharacterized protein; n=1;
           Marinobacter sp. ELB17|Rep: Putative uncharacterized
           protein - Marinobacter sp. ELB17
          Length = 976

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 28/82 (34%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -2

Query: 597 RAPWRTRWLQTARP*GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGK-YSPGGG-HCR 424
           R P +  WL  ARP  NS    G    Q   D         H  P  G  ++  GG H  
Sbjct: 647 RDPRQDDWLFDARPMANS----GAASVQMFLDDNNNGVMDEHEPPLSGAGFTVNGGRHKA 702

Query: 423 RSRNACVAHDNTQPTGRYIPAG 358
           R+  A VAH N  P  RY+  G
Sbjct: 703 RTNAAGVAHINHLPVNRYVDIG 724


>UniRef50_Q7S1W4 Cluster: Putative uncharacterized protein
           NCU05957.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU05957.1 - Neurospora crassa
          Length = 560

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +3

Query: 354 KSRQECIGRWAGYCRGPHTHCATCDNGRPQG 446
           K   + IG W   CR  H+HC   D GR  G
Sbjct: 217 KVNLDLIGEWLTLCRSTHSHCEDVDAGRIPG 247


>UniRef50_Q6MYZ3 Cluster: Esterase/lipase/thioesterase family
           protein, putative; n=2; Trichocomaceae|Rep:
           Esterase/lipase/thioesterase family protein, putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 292

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 491 LLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPP 378
           ++GIP++  L++   A G AI       VW T  P+PP
Sbjct: 1   MIGIPLLASLLLSGIAQGLAIAERATTPVWLTLPPTPP 38


>UniRef50_A5E1H4 Cluster: Glycerol kinase; n=5;
           Saccharomycetales|Rep: Glycerol kinase - Lodderomyces
           elongisporus (Yeast) (Saccharomyces elongisporus)
          Length = 631

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (5%)
 Frame = -3

Query: 509 VQMQADLLG--IPVIRPLMMESTALGAAIVAGRAMR 408
           +Q+QAD+LG  + V R  + E TALGAAI AG + +
Sbjct: 537 LQIQADILGPCVEVKRAQISECTALGAAIAAGLSFK 572


>UniRef50_UPI0000DD7F6C Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 255

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +1

Query: 505 CTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARP 627
           C E  SA    R    SGA SL+ +RPP R +  +R P+RP
Sbjct: 103 CPEPVSARRAWRAVRGSGAPSLRGARPPARRARRSRAPSRP 143


>UniRef50_Q3W963 Cluster: Regulatory protein, LuxR:Response
           regulator receiver:ATP-binding region, ATPase-like; n=1;
           Frankia sp. EAN1pec|Rep: Regulatory protein,
           LuxR:Response regulator receiver:ATP-binding region,
           ATPase-like - Frankia sp. EAN1pec
          Length = 520

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 30/79 (37%), Positives = 37/79 (46%)
 Frame = +1

Query: 364 RNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRR 543
           R  +AG    V G  R ARPA +AAPR    I RG   G+  ++   C      P+ RRR
Sbjct: 40  RPAAAGRDAAVPG--RAARPAVVAAPRPAGGIPRGH-GGVRRRAGRRC------PAARRR 90

Query: 544 GVASGARSLQPSRPPRRAS 600
             A   R LQP  P   A+
Sbjct: 91  RAA--GRRLQPGAPRAAAA 107


>UniRef50_A6X3I3 Cluster: Carbohydrate kinase FGGY; n=1;
           Ochrobactrum anthropi ATCC 49188|Rep: Carbohydrate
           kinase FGGY - Ochrobactrum anthropi (strain ATCC 49188 /
           DSM 6882 / NCTC 12168)
          Length = 511

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAG 420
           Q+ AD+LG+PV   +  E+ ALGAAI AG
Sbjct: 415 QIFADVLGVPVSVAVSRETGALGAAIAAG 443


>UniRef50_A1WHZ5 Cluster: Zinc finger/thioredoxin putative; n=1;
           Verminephrobacter eiseniae EF01-2|Rep: Zinc
           finger/thioredoxin putative - Verminephrobacter eiseniae
           (strain EF01-2)
          Length = 321

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = +1

Query: 418 RPATMAAPRAVLSIM---RGRMTGIPSKSACICTELSSA-PSLRRRGVASGARSLQPSRP 585
           +PAT  AP+ V ++       M   P+ +  +     +A PSL  R     ARS  PS P
Sbjct: 49  KPATAMAPQPVAAVAPQPTAAMASQPAAAPPLPKPAKAAHPSLAPRTAPVRARSDAPSVP 108

Query: 586 PRRASGDTRPPAR 624
           P++A+    PP +
Sbjct: 109 PKQAAAPLPPPIK 121


>UniRef50_Q0IQW8 Cluster: Os11g0702900 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0702900 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 225

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 17/43 (39%), Positives = 22/43 (51%)
 Frame = -3

Query: 623 RAGGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQA 495
           R   RV+P A      G R  AP   PRR R+G E  +V ++A
Sbjct: 120 RRVARVAPAAAVASAAGARHHAPGPRPRREREGGEAVAVAVEA 162


>UniRef50_A3CRV8 Cluster: CDP-alcohol phosphatidyltransferase
           precursor; n=1; Methanoculleus marisnigri JR1|Rep:
           CDP-alcohol phosphatidyltransferase precursor -
           Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498
           / JR1)
          Length = 200

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 20/58 (34%), Positives = 28/58 (48%)
 Frame = +1

Query: 418 RPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPR 591
           R    A P  +  I+ G +TG    +  I    ++  +LRR     GA +L PSRPPR
Sbjct: 142 RAGLFARPERIAVIIAGLVTGFVLPALVILAVATNVTALRRLLCVRGA-TLLPSRPPR 198


>UniRef50_UPI00005A1939 Cluster: PREDICTED: hypothetical protein
           XP_863504; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_863504 - Canis familiaris
          Length = 247

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 20/52 (38%), Positives = 22/52 (42%)
 Frame = +1

Query: 463 RGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           RGR    P   +  C     AP LR R V  GAR    +RPP    G T  P
Sbjct: 41  RGRGGASPPARSSAC---GFAPGLRHRPVRQGARKRNLTRPPPAPDGGTHLP 89


>UniRef50_UPI0000EB3566 Cluster: Protein FAM71A.; n=2; Canis lupus
           familiaris|Rep: Protein FAM71A. - Canis familiaris
          Length = 444

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +1

Query: 373 SAGGLGIVVGHTRIARPATMAAPRAVLSIMRG--RMTGIPSKSACICTELSSAPSLRRRG 546
           +AG LG+ +  T+    A  A+P++  + + G  +  G PS S+   T LS  PS     
Sbjct: 269 AAGALGVAI--TKPGG-APSASPKSAAAAVAGAAKTPGFPSDSS---TSLSPEPSKALAF 322

Query: 547 VASGARSLQPSRPPRRASGDTRP 615
              G+R  +P+    +ASGD  P
Sbjct: 323 ARRGSRRRRPADSRHKASGDKGP 345


>UniRef50_Q8UAJ0 Cluster: Rhiziobicin secretion; n=2;
           Rhizobiales|Rep: Rhiziobicin secretion - Agrobacterium
           tumefaciens (strain C58 / ATCC 33970)
          Length = 615

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +1

Query: 349 LVRAGRNVSA-GGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSA 525
           +V+A  +V A GG+ +VV H    RP+ + A   +L +  GRM     +   +   L   
Sbjct: 512 VVKAITSVKARGGIAVVVAH----RPSAIGAVDYILMMEDGRMKAFGPRDEVLSKVLRVP 567

Query: 526 PSLRRRGVASGARSLQPSR 582
            +   +G A+ A+++ P R
Sbjct: 568 QAQAAKGFAASAQTVSPLR 586


>UniRef50_Q2RNP0 Cluster: Carbohydrate kinase, FGGY; n=1;
           Rhodospirillum rubrum ATCC 11170|Rep: Carbohydrate
           kinase, FGGY - Rhodospirillum rubrum (strain ATCC 11170
           / NCIB 8255)
          Length = 505

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 13/26 (50%), Positives = 21/26 (80%)
 Frame = -3

Query: 497 ADLLGIPVIRPLMMESTALGAAIVAG 420
           A++L +PV RP + E+ A+GAA++AG
Sbjct: 430 ANILEVPVERPAIAETAAMGAALLAG 455


>UniRef50_A7HCU5 Cluster: tRNA(Ile)-lysidine synthetase; n=2;
           Anaeromyxobacter|Rep: tRNA(Ile)-lysidine synthetase -
           Anaeromyxobacter sp. Fw109-5
          Length = 436

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = -3

Query: 623 RAGGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIP 477
           R G R  PD  RG +   R       PR RRDG  L  +  ++D+L IP
Sbjct: 366 RPGDRWRPDGGRGSKTLKRWLIDRKVPRERRDGLVL--LARESDVLAIP 412


>UniRef50_A6UD03 Cluster: Carbohydrate kinase FGGY; n=3;
           Rhizobiales|Rep: Carbohydrate kinase FGGY -
           Sinorhizobium medicae WSM419
          Length = 521

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVA 423
           QM AD  G+PVIR L  E++ALGA + A
Sbjct: 437 QMIADASGLPVIRSLSNEASALGAGMSA 464


>UniRef50_A5ZM39 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 500

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/60 (28%), Positives = 33/60 (55%)
 Frame = -3

Query: 581 RDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           + GC+ +   AT    R G  +   QM+AD+L +P+     +++  +G+A++ G A  V+
Sbjct: 399 KSGCKFKKLNATGGGARSGEWM---QMKADMLNVPITALKTVDAGTVGSAMLTGIATGVF 455


>UniRef50_A3Q2D8 Cluster: Carbohydrate kinase, FGGY; n=6;
           Actinomycetales|Rep: Carbohydrate kinase, FGGY -
           Mycobacterium sp. (strain JLS)
          Length = 482

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = -3

Query: 542 RRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPAD 372
           R R DG    S   +Q QADL  IPV     + +TALGAA  A  A+   P+  P+    
Sbjct: 386 RLRVDGGLTRSTVLMQAQADLAQIPVDVYPSLHATALGAAACARLALE--PSLTPAEAVG 443

Query: 371 TFLPALT 351
           T+ P  T
Sbjct: 444 TWTPVHT 450


>UniRef50_A1G8K0 Cluster: Acyl-CoA dehydrogenase-like; n=2;
           Salinispora|Rep: Acyl-CoA dehydrogenase-like -
           Salinispora arenicola CNS205
          Length = 665

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 26/80 (32%), Positives = 28/80 (35%)
 Frame = +1

Query: 385 LGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGAR 564
           L    GH R  R A  AAPR V    R R  G        C    +AP       A G R
Sbjct: 50  LAATAGHGRAGRYAHRAAPRTVRDGRRRRRPG------TACRRADAAPRGAGSAAALGGR 103

Query: 565 SLQPSRPPRRASGDTRPPAR 624
                R  RR +   RP  R
Sbjct: 104 HPSVDRGDRRCAAGRRPGRR 123


>UniRef50_Q6H632 Cluster: Putative uncharacterized protein
           P0030D07.25; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0030D07.25 - Oryza sativa subsp. japonica (Rice)
          Length = 327

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 27/87 (31%), Positives = 37/87 (42%)
 Frame = +1

Query: 361 GRNVSAGGLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRR 540
           G  +     G+V   TR A PAT A+P    S+ R R +      A   T  ++ PS   
Sbjct: 34  GSQLQVNSRGLVGRATRAATPATTASPPPSPSLPRRRPSSRRQSWAAART-AAAGPSFSL 92

Query: 541 RGVASGARSLQPSRPPRRASGDTRPPA 621
             +  G  S +  R   R  G +RPPA
Sbjct: 93  APLPVGWSS-EGERTEGRRRGSSRPPA 118


>UniRef50_Q0IV36 Cluster: Os11g0115800 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0115800 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 155

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 11/17 (64%), Positives = 11/17 (64%)
 Frame = -2

Query: 624 PRWRPCVTRRAPWRTRW 574
           P WR C  RR  WRTRW
Sbjct: 139 PPWRRCCCRRRRWRTRW 155


>UniRef50_Q0DU45 Cluster: Os03g0208400 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os03g0208400 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 109

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -3

Query: 614 GRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGA 435
           GRV PD R     GC +R  E   R  R   +++S ++Q    G   ++   + +  L  
Sbjct: 21  GRVEPDGRAASASGCLMRRSEGRRRPWRHLLKITSEEIQQVQQGFLTVQKFQVSTAILQI 80

Query: 434 AIV 426
            I+
Sbjct: 81  III 83


>UniRef50_Q7QJM6 Cluster: ENSANGP00000010758; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010758 - Anopheles gambiae
           str. PEST
          Length = 499

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = -3

Query: 506 QMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396
           Q  ADL GI V R  + +S+ALGA  +AG    +W T
Sbjct: 412 QTLADLTGIEVERGEVADSSALGAMYMAGLNCGIWST 448


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 641,052,714
Number of Sequences: 1657284
Number of extensions: 14566275
Number of successful extensions: 46491
Number of sequences better than 10.0: 97
Number of HSP's better than 10.0 without gapping: 43210
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46407
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46466611856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -