SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=...    60   2e-08
UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopt...    60   2e-08
UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukary...    56   3e-07
UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabi...    55   8e-07
UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal ...    52   4e-06
UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukar...    52   4e-06
UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal ...    51   9e-06
UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: ...    49   5e-05
UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; ...    46   3e-04
UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, put...    45   6e-04
UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; ...    45   6e-04
UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; T...    44   0.002
UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; ...    40   0.018
UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyosteli...    40   0.018
UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.018
UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; ...    40   0.023
UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces cap...    40   0.031
UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S riboso...    39   0.041
UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal ...    39   0.054
UniRef50_A7RHN0 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.29 
UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, wh...    36   0.29 
UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n...    36   0.38 
UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella ve...    34   1.5  
UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S riboso...    33   2.7  
UniRef50_UPI0000E46A11 Cluster: PREDICTED: similar to GA13983-PA...    31   8.1  
UniRef50_Q7F1T9 Cluster: Putative uncharacterized protein OJ1167...    31   8.1  

>UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=2;
           Neoptera|Rep: Ribosomal protein L29e-like protein -
           Maconellicoccus hirsutus (hibiscus mealybug)
          Length = 90

 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 26/39 (66%), Positives = 29/39 (74%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF 281
           MAK  NHTNHNQNRK HRNGIKKP++ R+E  L   Q F
Sbjct: 1   MAKSKNHTNHNQNRKDHRNGIKKPKRYRYESKLGVCQKF 39



 Score = 36.7 bits (81), Expect = 0.22
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           +K K  +  + LG+  KFL+NQRF  KGNL  A+Q+
Sbjct: 22  KKPKRYRYESKLGVCQKFLKNQRFALKGNLSTAEQV 57


>UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12;
           Endopterygota|Rep: 60S ribosomal protein L29 -
           Drosophila melanogaster (Fruit fly)
          Length = 76

 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL 359
             E++
Sbjct: 60  YNERI 64


>UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40;
           Eukaryota|Rep: 60S ribosomal protein L29 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 61

 Score = 56.0 bits (129), Expect = 3e-07
 Identities = 22/30 (73%), Positives = 27/30 (90%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHTNHNQN+KAHRNGIK+P+K R++
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPQKHRYD 30


>UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4;
           Arabidopsis thaliana|Rep: 60S ribosomal protein L29-2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 61

 Score = 54.8 bits (126), Expect = 8e-07
 Identities = 25/48 (52%), Positives = 31/48 (64%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           MAK  NHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 1   MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 48



 Score = 38.7 bits (86), Expect = 0.054
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           +K +  +   T GMDPKFLRNQR+ +K N+K
Sbjct: 22  KKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52


>UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 97

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 21/30 (70%), Positives = 26/30 (86%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHTNHNQN+KAH+NGI KP++ R+E
Sbjct: 1   MAKSKNHTNHNQNQKAHKNGITKPKRQRNE 30


>UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal
           protein L29,; n=3; Monodelphis domestica|Rep: PREDICTED:
           similar to ribosomal protein L29, - Monodelphis
           domestica
          Length = 407

 Score = 52.4 bits (120), Expect = 4e-06
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 37.5 bits (83), Expect = 0.12
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK   K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHKKKGLKKM 57


>UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251;
           Eukaryota|Rep: 60S ribosomal protein L29 - Homo sapiens
           (Human)
          Length = 159

 Score = 52.4 bits (120), Expect = 4e-06
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.023
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal
           protein L29/cell surface heparin binding protein HIP;
           n=4; Monodelphis domestica|Rep: PREDICTED: similar to
           ribosomal protein L29/cell surface heparin binding
           protein HIP - Monodelphis domestica
          Length = 252

 Score = 51.2 bits (117), Expect = 9e-06
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  ++E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSLKYE 30


>UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep:
           GLP_433_2266_2454 - Giardia lamblia ATCC 50803
          Length = 62

 Score = 48.8 bits (111), Expect = 5e-05
 Identities = 20/29 (68%), Positives = 24/29 (82%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRH 251
           MAK  NHT+ NQNRK HRNGIKKP+K+ +
Sbjct: 1   MAKLKNHTSKNQNRKDHRNGIKKPKKSAY 29


>UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 87

 Score = 46.4 bits (105), Expect = 3e-04
 Identities = 18/24 (75%), Positives = 20/24 (83%)
 Frame = +3

Query: 171 KXXNHTNHNQNRKAHRNGIKKPRK 242
           K  NHTNHN+N KAHRNGI KP+K
Sbjct: 14  KPENHTNHNRNNKAHRNGITKPKK 37


>UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic,
           putative; n=1; Filobasidiella neoformans|Rep: Ribosomal
           protein L29.e, cytosolic, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 99

 Score = 45.2 bits (102), Expect = 6e-04
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 6/52 (11%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRH------EPPLAWIQNF*GIKGFA 302
           MAK  NHT HNQ RKAHRN I++P+  ++      +P + + +N  G  G+A
Sbjct: 1   MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKVGFFRNAKGYVGWA 52


>UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2;
           Eukaryota|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 282

 Score = 45.2 bits (102), Expect = 6e-04
 Identities = 22/34 (64%), Positives = 24/34 (70%)
 Frame = +3

Query: 162 KMAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           +MAK  N + HNQ RKAHRNGIKKP KT   P L
Sbjct: 93  RMAKSKNSSQHNQVRKAHRNGIKKP-KTNKYPSL 125



 Score = 34.7 bits (76), Expect = 0.87
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAK 328
           +K K ++  +  G+DPKF+RNQR+ K G  K  K
Sbjct: 115 KKPKTNKYPSLRGVDPKFVRNQRYAKHGTEKALK 148


>UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7;
           Trypanosomatidae|Rep: Ribosomal protein L29, putative -
           Leishmania major
          Length = 70

 Score = 43.6 bits (98), Expect = 0.002
 Identities = 18/24 (75%), Positives = 19/24 (79%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKP 236
           MAK  NHTNHNQ+ K HRNGIK P
Sbjct: 1   MAKSKNHTNHNQSSKNHRNGIKGP 24


>UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L29 - Entamoeba histolytica HM-1:IMSS
          Length = 64

 Score = 40.3 bits (90), Expect = 0.018
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRH 251
           M+K  N ++HNQ+ KAHRNG  KP+K+ +
Sbjct: 1   MSKDKNRSSHNQSHKAHRNGFYKPKKSAY 29


>UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyostelium
           discoideum AX4|Rep: Ribosomal protein L29 -
           Dictyostelium discoideum AX4
          Length = 93

 Score = 40.3 bits (90), Expect = 0.018
 Identities = 16/23 (69%), Positives = 19/23 (82%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKK 233
           MAK  NH+ H++NRK HRNGIKK
Sbjct: 1   MAKSKNHSTHHKNRKDHRNGIKK 23


>UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 59

 Score = 40.3 bits (90), Expect = 0.018
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 227 QKAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           +K K  +  +  G+DPKF RNQ++C KG +K  K+L
Sbjct: 10  KKPKSHKFMSRKGLDPKFFRNQKYCLKGMIKKQKEL 45



 Score = 31.5 bits (68), Expect = 8.1
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = +3

Query: 201 NRKAHRNGIKKPR 239
           NRKAHRNGIKKP+
Sbjct: 1   NRKAHRNGIKKPK 13


>UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 167

 Score = 39.9 bits (89), Expect = 0.023
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = +3

Query: 171 KXXNHTNHNQNRKAHRNGIKKPR 239
           K  NHTNHNQN  AHR GI KP+
Sbjct: 80  KSKNHTNHNQNNTAHRIGITKPK 102


>UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 176

 Score = 39.5 bits (88), Expect = 0.031
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +3

Query: 183 HTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           H+ H  NRKAHRNGIKKP KT   P L
Sbjct: 118 HSQHTLNRKAHRNGIKKP-KTHRYPSL 143


>UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S ribosomal
           protein L29 (P23); n=2; Rattus norvegicus|Rep:
           PREDICTED: similar to 60S ribosomal protein L29 (P23) -
           Rattus norvegicus
          Length = 105

 Score = 39.1 bits (87), Expect = 0.041
 Identities = 16/25 (64%), Positives = 18/25 (72%)
 Frame = +3

Query: 180 NHTNHNQNRKAHRNGIKKPRKTRHE 254
           NHT HNQ  K HRNGIKKP   R++
Sbjct: 7   NHTTHNQFHKWHRNGIKKPWSQRYK 31


>UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal
           protein; n=2; Mus musculus|Rep: PREDICTED: similar to
           ribosomal protein - Mus musculus
          Length = 244

 Score = 38.7 bits (86), Expect = 0.054
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +3

Query: 168 AKXXNHTNHNQNRKAHRNGIKKPRKTRH 251
           AK  NH  HNQ+ K +RNGIKKPR  ++
Sbjct: 47  AKSKNHITHNQSCKWYRNGIKKPRSPKN 74


>UniRef50_A7RHN0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 446

 Score = 36.3 bits (80), Expect = 0.29
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = -1

Query: 338 SRVAWLASGXPSCKTFDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMIC 186
           S + W+ S     K   +  + DP   W +PGLP+++  IS+   ++++IC
Sbjct: 166 SSIVWVVSALLDKKWSTNPSLADPAGAW-IPGLPFIYSCISLLGGLMLLIC 215


>UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 73

 Score = 36.3 bits (80), Expect = 0.29
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  N T+H+  RK HRNGIKK    R+       Q F   + FA +   + PS  + +
Sbjct: 1   MAKSKNATSHHNARKHHRNGIKKLPNQRYRTLKGCNQRFAKNRRFAIK---NDPSIKKNK 57

Query: 345 -LREKLPEXQRPRNEH 389
            +  +L + +  +N H
Sbjct: 58  SVETRLAKRKANKNIH 73


>UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0BB6 UniRef100 entry -
           Rattus norvegicus
          Length = 142

 Score = 35.9 bits (79), Expect = 0.38
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPR 239
           MAK  NHT H Q++K HRN IKKP+
Sbjct: 17  MAKSKNHTTH-QSQKWHRNSIKKPK 40


>UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 94

 Score = 33.9 bits (74), Expect = 1.5
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 4/38 (10%)
 Frame = +2

Query: 218 KWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLK 319
           KW++    K + ++  +  G+DPKFLRN RF KK N K
Sbjct: 50  KWHRNGIKKPRTNRYPSLKGVDPKFLRNLRFSKKHNKK 87


>UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S ribosomal
           protein L29 (Cell surface heparin-binding protein HIP);
           n=1; Macaca mulatta|Rep: PREDICTED: similar to 60S
           ribosomal protein L29 (Cell surface heparin-binding
           protein HIP) - Macaca mulatta
          Length = 237

 Score = 33.1 bits (72), Expect = 2.7
 Identities = 13/22 (59%), Positives = 18/22 (81%)
 Frame = +3

Query: 186 TNHNQNRKAHRNGIKKPRKTRH 251
           T HNQ+RK +RNGIKK + +R+
Sbjct: 35  TTHNQSRKWNRNGIKKSQSSRY 56


>UniRef50_UPI0000E46A11 Cluster: PREDICTED: similar to GA13983-PA;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA13983-PA - Strongylocentrotus purpuratus
          Length = 336

 Score = 31.5 bits (68), Expect = 8.1
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = +3

Query: 183 HTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKG----FARRXT*SQPSNSRGRLR 350
           H +   N   H++  K PRK +H P   ++ N+ G+       A+R T SQ S+S     
Sbjct: 219 HHHRPTNNVKHQSPRKSPRKRQHIPANEYVTNYLGLGAQDDPAAKRSTQSQSSSSTSEGP 278

Query: 351 EKL 359
           E+L
Sbjct: 279 EEL 281


>UniRef50_Q7F1T9 Cluster: Putative uncharacterized protein
           OJ1167_G06.119; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OJ1167_G06.119 - Oryza sativa subsp. japonica (Rice)
          Length = 270

 Score = 31.5 bits (68), Expect = 8.1
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +3

Query: 189 NHNQNRKAHRNGIKKPRKTRHEPP 260
           NH + R+ HR+ +++P   RH PP
Sbjct: 42  NHGRRRRCHRHRLRRPPLRRHPPP 65


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 341,585,992
Number of Sequences: 1657284
Number of extensions: 5563389
Number of successful extensions: 13434
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 13038
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13421
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 21918499148
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -