SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30080.Seq
         (853 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;...    46   0.001

>UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG4170-PA - Nasonia vitripennis
          Length = 437

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 124 MENSYGVGXVNRXAXXLDDETXPLDALKARXQAKGLXKXDQXGRKEDKGKPEXKPAKGVT 303
           MEN+Y +   N+ +  LD++  PL+ LK R Q K   K ++   KE+K K + + A    
Sbjct: 1   MENTYSITVTNKFSLALDEDEDPLEILKLREQEKEAKKKEKLNEKENKSKHQ-QEAGQTQ 59

Query: 304 VPTRKGIKETQNVKSQXIKSGEQQ 375
             T++  + T+  K +  K  +QQ
Sbjct: 60  QKTQQQQQATKVQKPRPNKENQQQ 83


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 610,123,590
Number of Sequences: 1657284
Number of extensions: 9302868
Number of successful extensions: 13750
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13385
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13727
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75013275813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -