SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00006A1716 Cluster: UPI00006A1716 related cluster; n...    34   1.2  
UniRef50_O78941 Cluster: Putative uncharacterized protein; n=1; ...    33   3.8  

>UniRef50_UPI00006A1716 Cluster: UPI00006A1716 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A1716 UniRef100 entry -
           Xenopus tropicalis
          Length = 158

 Score = 34.3 bits (75), Expect = 1.2
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 266 CIYFHALLVCSLLHFCYYIFISTS--SLAVCLDLNNSHYRRPLFISTY-YASIWYI 424
           C Y +  +   LL  CYY++ +T+   L +C  L  + Y   LFI  Y YA+  Y+
Sbjct: 57  CYYLYVTIYIRLLFICYYLYAATNYMLLFICYYLYATIYMHLLFICYYLYAATIYM 112


>UniRef50_O78941 Cluster: Putative uncharacterized protein; n=1;
           Agrocybe aegerita|Rep: Putative uncharacterized protein
           - Agrocybe aegerita (Black poplar mushroom)
          Length = 107

 Score = 32.7 bits (71), Expect = 3.8
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +2

Query: 269 IYFHALLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK*YLL 442
           +YF  + +  L+ F Y++F+  S+L   L    S+Y    FI+ Y+ S  YI+  +L+
Sbjct: 18  LYFFIIAIFFLVVFIYFLFVRYSTL---LLFRVSNYNSFFFITHYFISYLYISPPFLI 72


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 392,915,286
Number of Sequences: 1657284
Number of extensions: 6598224
Number of successful extensions: 8878
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8875
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 23604537544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -