SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000051A21B Cluster: PREDICTED: similar to CG3862-PA;...    88   2e-16
UniRef50_UPI0000D56F40 Cluster: PREDICTED: similar to CG3862-PA;...    81   3e-14
UniRef50_Q16W91 Cluster: Regulator of chromosome condensation; n...    79   1e-13
UniRef50_Q9VPU0 Cluster: CG3862-PA; n=3; Sophophora|Rep: CG3862-...    72   2e-11
UniRef50_UPI0000E46979 Cluster: PREDICTED: hypothetical protein;...    65   2e-09
UniRef50_Q96I51 Cluster: Williams-Beuren syndrome chromosome reg...    60   5e-08
UniRef50_Q5C3M7 Cluster: SJCHGC05517 protein; n=1; Schistosoma j...    39   0.14 
UniRef50_Q7YTU7 Cluster: Putative uncharacterized protein; n=5; ...    35   2.2  
UniRef50_UPI000150A161 Cluster: hypothetical protein TTHERM_0047...    34   3.9  

>UniRef50_UPI000051A21B Cluster: PREDICTED: similar to CG3862-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG3862-PA -
           Apis mellifera
          Length = 443

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 45/117 (38%), Positives = 69/117 (58%)
 Frame = +2

Query: 218 PVSNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITN 397
           P+SN++ +R   +VWG A+ GALG                   +  P R SF ER D+TN
Sbjct: 41  PISNERDHRV--YVWGMADHGALGT------LKSTVYEKGISYIPKPKRLSFGERHDVTN 92

Query: 398 IACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLLSYAPIYIPYKE 568
           IACGYGFT  ++++++++ +FG+GINTDSQ+G+    +  P  L+    PI +P K+
Sbjct: 93  IACGYGFTAFAVRSNDKNILFGSGINTDSQLGFDEKDKKFPNGLITEPRPINLPIKD 149


>UniRef50_UPI0000D56F40 Cluster: PREDICTED: similar to CG3862-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG3862-PA - Tribolium castaneum
          Length = 477

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 43/114 (37%), Positives = 61/114 (53%)
 Frame = +2

Query: 224 SNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIA 403
           ++K+ Y++   VWG   +GALGI   R                 P R  FAE+F +T  A
Sbjct: 74  TSKKSYKRV-FVWGNLMSGALGIPYLRRNENVMHRETVDI----PKRLGFAEKFPVTTAA 128

Query: 404 CGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLLSYAPIYIPYK 565
           CG+GFT   + T  + K++GTG+NTDSQIG H   +  PLE++     I +P K
Sbjct: 129 CGFGFTAFGVDTESEDKLYGTGLNTDSQIGRHEVRQGHPLEIIYFPQAIKLPLK 182


>UniRef50_Q16W91 Cluster: Regulator of chromosome condensation; n=2;
           Culicidae|Rep: Regulator of chromosome condensation -
           Aedes aegypti (Yellowfever mosquito)
          Length = 456

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 43/101 (42%), Positives = 56/101 (55%), Gaps = 2/101 (1%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWG A TGALG+                 +V HP R +FAE  DI ++A GYGF+V + 
Sbjct: 52  YVWGLAATGALGLQTS----VKKQAKAHTDVVQHPSRLNFAENRDIVDVAAGYGFSVFAA 107

Query: 434 KTSEQHKVFGTGINTDSQIGYHFT--TRNXPLELLLSYAPI 550
           K      ++GTGINTD+QIGYH        P E+L+  API
Sbjct: 108 KCRHGKSLWGTGINTDAQIGYHKLGGKHRKPFEMLIYPAPI 148


>UniRef50_Q9VPU0 Cluster: CG3862-PA; n=3; Sophophora|Rep: CG3862-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 454

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 47  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 102

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 103 NRDDGETLFGSGLNTDSQLGF 123


>UniRef50_UPI0000E46979 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 455

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +2

Query: 215 IPVSNKQKYRQTS-HVWGFAETGALGI---HLPRXXXXXXXXXXXXXLVWHPMRSSFAER 382
           + +  K + R TS +VWGF  TGALG+     P               +  P +  F E+
Sbjct: 13  VQMVGKHRKRYTSVYVWGFTYTGALGVPSYFFPSQRKNPIRKPKKFQPI--PYKLKFDEK 70

Query: 383 FDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYH 499
             IT  ACGYGF++    T +  KV+G GINT+SQIGYH
Sbjct: 71  --ITTAACGYGFSLIGSHTQDTSKVWGMGINTNSQIGYH 107


>UniRef50_Q96I51 Cluster: Williams-Beuren syndrome chromosome region
           16 protein; n=30; Deuterostomia|Rep: Williams-Beuren
           syndrome chromosome region 16 protein - Homo sapiens
           (Human)
          Length = 464

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>UniRef50_Q5C3M7 Cluster: SJCHGC05517 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05517 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 279

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 32/99 (32%), Positives = 42/99 (42%), Gaps = 2/99 (2%)
 Frame = +2

Query: 203 AFTNIPVSNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAER 382
           A  N+   +  K +Q  +V+GF  TGALG                   V HP+       
Sbjct: 36  AVYNVHSRDSLKSKQV-YVFGFTATGALG----NKTYLGQRGKPGIVGVSHPVPLKCLSS 90

Query: 383 FDIT-NIACGYGFTVASIKTSE-QHKVFGTGINTDSQIG 493
             I    ACGYGFT    + S     V+G GIN+D Q+G
Sbjct: 91  LGIPIKAACGYGFTTYICEGSNGDFGVYGCGINSDGQLG 129


>UniRef50_Q7YTU7 Cluster: Putative uncharacterized protein; n=5;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 404

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +2

Query: 356 PMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHFTTRNXPLELLL 535
           P R ++     I  I+ G+GF++ + K    ++++G GIN   QIG   T  N   +  +
Sbjct: 57  PKRIAYFNTKSIKFISSGFGFSLFASK----NRLYGAGINNRFQIGGQLTNINKYQDYYI 112

Query: 536 SYAPIYIPYKEL 571
           S   I IP  E+
Sbjct: 113 SAKKINIPGDEI 124


>UniRef50_UPI000150A161 Cluster: hypothetical protein
           TTHERM_00473300; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00473300 - Tetrahymena
           thermophila SB210
          Length = 298

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +3

Query: 96  NMYAAKFLIHRRSPV--FLLNRVSITTKKKVHDPSEEELLPIFQYPISKS 239
           N++ +  LI + S +  FLLN + +TTK K+ D S E+    +  PISK+
Sbjct: 20  NIFISLALIPQTSFIHSFLLNTIPLTTKMKIQDDSFEQSPQSYSKPISKT 69


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 667,218,271
Number of Sequences: 1657284
Number of extensions: 12809468
Number of successful extensions: 28121
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 27312
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28108
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -