SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30054.Seq
         (765 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;...    41   0.039
UniRef50_Q5JVS0-2 Cluster: Isoform 2 of Q5JVS0 ; n=2; Catarrhini...    35   1.9  
UniRef50_Q5JVS0 Cluster: Intracellular hyaluronan-binding protei...    35   1.9  
UniRef50_Q8AV21 Cluster: IHABP; n=2; Tetraodontidae|Rep: IHABP -...    35   2.5  
UniRef50_Q8NC51 Cluster: Plasminogen activator inhibitor 1 RNA-b...    33   5.9  
UniRef50_Q9I9R0 Cluster: Intracellular hyaluronan-binding protei...    33   5.9  
UniRef50_Q6GLG8 Cluster: Hyaluronan binding protein 4; n=2; Xeno...    33   7.8  

>UniRef50_UPI00015B50C6 Cluster: PREDICTED: similar to CG4170-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG4170-PA - Nasonia vitripennis
          Length = 437

 Score = 40.7 bits (91), Expect = 0.039
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           MEN+Y +   N+++  LD++ DPL+ LK REQ K
Sbjct: 1   MENTYSITVTNKFSLALDEDEDPLEILKLREQEK 34


>UniRef50_Q5JVS0-2 Cluster: Isoform 2 of Q5JVS0 ; n=2;
           Catarrhini|Rep: Isoform 2 of Q5JVS0 - Homo sapiens
           (Human)
          Length = 308

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>UniRef50_Q5JVS0 Cluster: Intracellular hyaluronan-binding protein
           4; n=14; Eutheria|Rep: Intracellular hyaluronan-binding
           protein 4 - Homo sapiens (Human)
          Length = 413

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>UniRef50_Q8AV21 Cluster: IHABP; n=2; Tetraodontidae|Rep: IHABP -
           Fugu rubripes (Japanese pufferfish) (Takifugu rubripes)
          Length = 361

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           + +++G    NR+   LDD+ DPLD L   E+ K
Sbjct: 2   LPDAFGCAVANRFGNLLDDDADPLDLLSEAEKVK 35


>UniRef50_Q8NC51 Cluster: Plasminogen activator inhibitor 1
           RNA-binding protein; n=54; Euteleostomi|Rep: Plasminogen
           activator inhibitor 1 RNA-binding protein - Homo sapiens
           (Human)
          Length = 408

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>UniRef50_Q9I9R0 Cluster: Intracellular hyaluronan-binding protein
           4; n=2; Gallus gallus|Rep: Intracellular
           hyaluronan-binding protein 4 - Gallus gallus (Chicken)
          Length = 357

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQ 219
           ME S+     NR+   LDDE+DP D L+  E+
Sbjct: 14  MEGSFSCTVANRFYQLLDDESDPFDNLREAER 45


>UniRef50_Q6GLG8 Cluster: Hyaluronan binding protein 4; n=2; Xenopus
           tropicalis|Rep: Hyaluronan binding protein 4 - Xenopus
           tropicalis (Western clawed frog) (Silurana tropicalis)
          Length = 339

 Score = 33.1 bits (72), Expect = 7.8
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDAL 204
           M++++G    NR+   LDDE+DPLD L
Sbjct: 1   MQDNFGCAVENRFNQLLDDESDPLDFL 27


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 555,133,408
Number of Sequences: 1657284
Number of extensions: 7932287
Number of successful extensions: 11688
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 11498
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11688
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -