SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopt...    65   6e-10
UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=...    64   1e-09
UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukary...    60   2e-08
UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabi...    59   4e-08
UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; ...    58   9e-08
UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal ...    57   2e-07
UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukar...    57   2e-07
UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal ...    56   5e-07
UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: ...    51   1e-05
UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, put...    50   3e-05
UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; ...    50   3e-05
UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; T...    48   9e-05
UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; ...    47   2e-04
UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyosteli...    45   8e-04
UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; ...    44   0.001
UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal ...    43   0.003
UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; ...    43   0.003
UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S riboso...    43   0.003
UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, wh...    42   0.006
UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces cap...    41   0.010
UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n...    40   0.018
UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.074
UniRef50_A7RHN0 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.30 
UniRef50_A0ZIW5 Cluster: Two-component sensor histidine kinase; ...    36   0.52 
UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S riboso...    35   0.91 
UniRef50_A6SNG7 Cluster: Predicted protein; n=1; Botryotinia fuc...    34   1.2  
UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella ve...    33   3.7  
UniRef50_UPI0000E46A11 Cluster: PREDICTED: similar to GA13983-PA...    32   6.4  
UniRef50_Q7F1T9 Cluster: Putative uncharacterized protein OJ1167...    31   8.5  

>UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12;
           Endopterygota|Rep: 60S ribosomal protein L29 -
           Drosophila melanogaster (Fruit fly)
          Length = 76

 Score = 65.3 bits (152), Expect = 6e-10
 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL-PEKQRPR 380
             E++  +K +P+
Sbjct: 60  YNERIASQKGKPK 72


>UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=2;
           Neoptera|Rep: Ribosomal protein L29e-like protein -
           Maconellicoccus hirsutus (hibiscus mealybug)
          Length = 90

 Score = 64.5 bits (150), Expect = 1e-09
 Identities = 28/39 (71%), Positives = 31/39 (79%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF 281
           MAKSKNHTNHNQNRK HRNGIKKP++ R+E  L   Q F
Sbjct: 1   MAKSKNHTNHNQNRKDHRNGIKKPKRYRYESKLGVCQKF 39



 Score = 34.7 bits (76), Expect = 0.91
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 236 KEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           K  +  + LG+  KFL+NQRF  KGNL  A+Q+
Sbjct: 25  KRYRYESKLGVCQKFLKNQRFALKGNLSTAEQV 57


>UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40;
           Eukaryota|Rep: 60S ribosomal protein L29 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 61

 Score = 60.5 bits (140), Expect = 2e-08
 Identities = 24/30 (80%), Positives = 29/30 (96%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHTNHNQN+KAHRNGIK+P+K R++
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPQKHRYD 30


>UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4;
           Arabidopsis thaliana|Rep: 60S ribosomal protein L29-2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 61

 Score = 59.3 bits (137), Expect = 4e-08
 Identities = 27/48 (56%), Positives = 33/48 (68%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308
           MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P       F   + +AR+
Sbjct: 1   MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 48



 Score = 37.5 bits (83), Expect = 0.13
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +2

Query: 257 TLGMDPKFLRNQRFCKKGNLK 319
           T GMDPKFLRNQR+ +K N+K
Sbjct: 32  TRGMDPKFLRNQRYARKHNVK 52


>UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 97

 Score = 58.0 bits (134), Expect = 9e-08
 Identities = 23/30 (76%), Positives = 28/30 (93%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHTNHNQN+KAH+NGI KP++ R+E
Sbjct: 1   MAKSKNHTNHNQNQKAHKNGITKPKRQRNE 30


>UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal
           protein L29,; n=3; Monodelphis domestica|Rep: PREDICTED:
           similar to ribosomal protein L29, - Monodelphis
           domestica
          Length = 407

 Score = 56.8 bits (131), Expect = 2e-07
 Identities = 24/30 (80%), Positives = 26/30 (86%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 33.5 bits (73), Expect = 2.1
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +2

Query: 263 GMDPKFLRNQRFCKKGNLKPAKQL 334
           G+DPKFLRN RF KK   K  K++
Sbjct: 34  GVDPKFLRNMRFAKKHKKKGLKKM 57


>UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251;
           Eukaryota|Rep: 60S ribosomal protein L29 - Homo sapiens
           (Human)
          Length = 159

 Score = 56.8 bits (131), Expect = 2e-07
 Identities = 24/30 (80%), Positives = 26/30 (86%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 35.9 bits (79), Expect = 0.39
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +2

Query: 263 GMDPKFLRNQRFCKKGNLKPAKQL 334
           G+DPKFLRN RF KK N K  K++
Sbjct: 34  GVDPKFLRNMRFAKKHNKKGLKKM 57


>UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal
           protein L29/cell surface heparin binding protein HIP;
           n=4; Monodelphis domestica|Rep: PREDICTED: similar to
           ribosomal protein L29/cell surface heparin binding
           protein HIP - Monodelphis domestica
          Length = 252

 Score = 55.6 bits (128), Expect = 5e-07
 Identities = 23/30 (76%), Positives = 26/30 (86%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAKSKNHT HNQ+RK HRNGIKKPR  ++E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSLKYE 30


>UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep:
           GLP_433_2266_2454 - Giardia lamblia ATCC 50803
          Length = 62

 Score = 50.8 bits (116), Expect = 1e-05
 Identities = 21/29 (72%), Positives = 25/29 (86%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRH 251
           MAK KNHT+ NQNRK HRNGIKKP+K+ +
Sbjct: 1   MAKLKNHTSKNQNRKDHRNGIKKPKKSAY 29


>UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic,
           putative; n=1; Filobasidiella neoformans|Rep: Ribosomal
           protein L29.e, cytosolic, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 99

 Score = 49.6 bits (113), Expect = 3e-05
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 6/52 (11%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRH------EPPLAWIQNF*GIKGFA 302
           MAKSKNHT HNQ RKAHRN I++P+  ++      +P + + +N  G  G+A
Sbjct: 1   MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKVGFFRNAKGYVGWA 52


>UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2;
           Eukaryota|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 282

 Score = 49.6 bits (113), Expect = 3e-05
 Identities = 24/34 (70%), Positives = 26/34 (76%)
 Frame = +3

Query: 162 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           +MAKSKN + HNQ RKAHRNGIKKP KT   P L
Sbjct: 93  RMAKSKNSSQHNQVRKAHRNGIKKP-KTNKYPSL 125



 Score = 32.7 bits (71), Expect = 3.7
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 263 GMDPKFLRNQRFCKKGNLKPAK 328
           G+DPKF+RNQR+ K G  K  K
Sbjct: 127 GVDPKFVRNQRYAKHGTEKALK 148


>UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7;
           Trypanosomatidae|Rep: Ribosomal protein L29, putative -
           Leishmania major
          Length = 70

 Score = 48.0 bits (109), Expect = 9e-05
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKP 236
           MAKSKNHTNHNQ+ K HRNGIK P
Sbjct: 1   MAKSKNHTNHNQSSKNHRNGIKGP 24


>UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 87

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 18/24 (75%), Positives = 21/24 (87%)
 Frame = +3

Query: 171 KSKNHTNHNQNRKAHRNGIKKPRK 242
           K +NHTNHN+N KAHRNGI KP+K
Sbjct: 14  KPENHTNHNRNNKAHRNGITKPKK 37


>UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyostelium
           discoideum AX4|Rep: Ribosomal protein L29 -
           Dictyostelium discoideum AX4
          Length = 93

 Score = 44.8 bits (101), Expect = 8e-04
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKK 233
           MAKSKNH+ H++NRK HRNGIKK
Sbjct: 1   MAKSKNHSTHHKNRKDHRNGIKK 23


>UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 167

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +3

Query: 171 KSKNHTNHNQNRKAHRNGIKKPR 239
           KSKNHTNHNQN  AHR GI KP+
Sbjct: 80  KSKNHTNHNQNNTAHRIGITKPK 102


>UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal
           protein; n=2; Mus musculus|Rep: PREDICTED: similar to
           ribosomal protein - Mus musculus
          Length = 244

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +3

Query: 168 AKSKNHTNHNQNRKAHRNGIKKPRKTRH 251
           AKSKNH  HNQ+ K +RNGIKKPR  ++
Sbjct: 47  AKSKNHITHNQSCKWYRNGIKKPRSPKN 74


>UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L29 - Entamoeba histolytica HM-1:IMSS
          Length = 64

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRH 251
           M+K KN ++HNQ+ KAHRNG  KP+K+ +
Sbjct: 1   MSKDKNRSSHNQSHKAHRNGFYKPKKSAY 29


>UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S ribosomal
           protein L29 (P23); n=2; Rattus norvegicus|Rep:
           PREDICTED: similar to 60S ribosomal protein L29 (P23) -
           Rattus norvegicus
          Length = 105

 Score = 42.7 bits (96), Expect = 0.003
 Identities = 18/27 (66%), Positives = 20/27 (74%)
 Frame = +3

Query: 174 SKNHTNHNQNRKAHRNGIKKPRKTRHE 254
           SKNHT HNQ  K HRNGIKKP   R++
Sbjct: 5   SKNHTTHNQFHKWHRNGIKKPWSQRYK 31


>UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 73

 Score = 41.9 bits (94), Expect = 0.006
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKN T+H+  RK HRNGIKK    R+       Q F   + FA +   + PS  + +
Sbjct: 1   MAKSKNATSHHNARKHHRNGIKKLPNQRYRTLKGCNQRFAKNRRFAIK---NDPSIKKNK 57

Query: 345 -LREKLPEKQRPRNEH 389
            +  +L +++  +N H
Sbjct: 58  SVETRLAKRKANKNIH 73


>UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 176

 Score = 41.1 bits (92), Expect = 0.010
 Identities = 19/36 (52%), Positives = 21/36 (58%)
 Frame = +3

Query: 156 LIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           L+       H+ H  NRKAHRNGIKKP KT   P L
Sbjct: 109 LLPQTHQNGHSQHTLNRKAHRNGIKKP-KTHRYPSL 143


>UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0BB6 UniRef100 entry -
           Rattus norvegicus
          Length = 142

 Score = 40.3 bits (90), Expect = 0.018
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPR 239
           MAKSKNHT H Q++K HRN IKKP+
Sbjct: 17  MAKSKNHTTH-QSQKWHRNSIKKPK 40


>UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 59

 Score = 38.3 bits (85), Expect = 0.074
 Identities = 14/24 (58%), Positives = 19/24 (79%)
 Frame = +2

Query: 263 GMDPKFLRNQRFCKKGNLKPAKQL 334
           G+DPKF RNQ++C KG +K  K+L
Sbjct: 22  GLDPKFFRNQKYCLKGMIKKQKEL 45



 Score = 31.5 bits (68), Expect = 8.5
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = +3

Query: 201 NRKAHRNGIKKPR 239
           NRKAHRNGIKKP+
Sbjct: 1   NRKAHRNGIKKPK 13


>UniRef50_A7RHN0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 446

 Score = 36.3 bits (80), Expect = 0.30
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = -1

Query: 338 SRVAWLASGYPSCKTFDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMIC 186
           S + W+ S     K   +  + DP   W +PGLP+++  IS+   ++++IC
Sbjct: 166 SSIVWVVSALLDKKWSTNPSLADPAGAW-IPGLPFIYSCISLLGGLMLLIC 215


>UniRef50_A0ZIW5 Cluster: Two-component sensor histidine kinase;
           n=1; Nodularia spumigena CCY 9414|Rep: Two-component
           sensor histidine kinase - Nodularia spumigena CCY 9414
          Length = 265

 Score = 35.5 bits (78), Expect = 0.52
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +1

Query: 139 LYRIENSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNHPWHGSKIFKESKV 297
           L RI+ S +WQ+QR   +I++      + ++ QG  G N  +H S  F    +
Sbjct: 44  LARIDTSLEWQTQRFTLVISEQFSALLLGTQEQGEEGNNTGFHASLTFNSQAI 96


>UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S ribosomal
           protein L29 (Cell surface heparin-binding protein HIP);
           n=1; Macaca mulatta|Rep: PREDICTED: similar to 60S
           ribosomal protein L29 (Cell surface heparin-binding
           protein HIP) - Macaca mulatta
          Length = 237

 Score = 34.7 bits (76), Expect = 0.91
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +3

Query: 159 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRH 251
           ++   S + T HNQ+RK +RNGIKK + +R+
Sbjct: 26  VQTCPSPHTTTHNQSRKWNRNGIKKSQSSRY 56


>UniRef50_A6SNG7 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 329

 Score = 34.3 bits (75), Expect = 1.2
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +3

Query: 132 YFPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQ 275
           YFP+Q   +   A SK +++ ++NR      I  PRKT     ++W Q
Sbjct: 3   YFPIQAQDVHFQASSKRNSDSSENRTCPVEDINDPRKTPSPSAISWFQ 50


>UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 94

 Score = 32.7 bits (71), Expect = 3.7
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = +2

Query: 263 GMDPKFLRNQRFCKKGNLK 319
           G+DPKFLRN RF KK N K
Sbjct: 69  GVDPKFLRNLRFSKKHNKK 87


>UniRef50_UPI0000E46A11 Cluster: PREDICTED: similar to GA13983-PA;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA13983-PA - Strongylocentrotus purpuratus
          Length = 336

 Score = 31.9 bits (69), Expect = 6.4
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 11/73 (15%)
 Frame = +3

Query: 174 SKNHTNHNQ-------NRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKG----FARRVT*S 320
           S +HTN N        N   H++  K PRK +H P   ++ N+ G+       A+R T S
Sbjct: 209 SSHHTNSNNMHHHRPTNNVKHQSPRKSPRKRQHIPANEYVTNYLGLGAQDDPAAKRSTQS 268

Query: 321 QPSNSRGRLREKL 359
           Q S+S     E+L
Sbjct: 269 QSSSSTSEGPEEL 281


>UniRef50_Q7F1T9 Cluster: Putative uncharacterized protein
           OJ1167_G06.119; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OJ1167_G06.119 - Oryza sativa subsp. japonica (Rice)
          Length = 270

 Score = 31.5 bits (68), Expect = 8.5
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +3

Query: 189 NHNQNRKAHRNGIKKPRKTRHEPP 260
           NH + R+ HR+ +++P   RH PP
Sbjct: 42  NHGRRRRCHRHRLRRPPLRRHPPP 65


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 354,311,391
Number of Sequences: 1657284
Number of extensions: 6000700
Number of successful extensions: 16961
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 16249
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16931
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 22761518346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -