SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0LJP8 Cluster: CRISPR-associated protein, TM1807; n=1;...    39   0.17 
UniRef50_A0B6J3 Cluster: Glycosyl transferase, group 1; n=1; Met...    37   0.53 
UniRef50_A7S3I9 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.93 
UniRef50_A7RGM3 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.93 
UniRef50_A0M269 Cluster: Putative uncharacterized protein; n=1; ...    35   2.2  
UniRef50_UPI0000DB79FD Cluster: PREDICTED: similar to WD repeat ...    35   2.8  
UniRef50_Q4SQW6 Cluster: Chromosome 11 SCAF14528, whole genome s...    35   2.8  
UniRef50_Q15061 Cluster: WD repeat-containing protein 43; n=33; ...    34   3.8  
UniRef50_A1Z7J6 Cluster: CG8266-PB, isoform B; n=5; Sophophora|R...    34   5.0  
UniRef50_A0E258 Cluster: Chromosome undetermined scaffold_74, wh...    34   5.0  
UniRef50_O97254 Cluster: Putative uncharacterized protein MAL3P2...    33   6.6  
UniRef50_A4MJW9 Cluster: WD-40 repeat protein; n=1; Petrotoga mo...    33   8.7  
UniRef50_A5DI19 Cluster: Putative uncharacterized protein; n=1; ...    33   8.7  

>UniRef50_Q0LJP8 Cluster: CRISPR-associated protein, TM1807; n=1;
           Herpetosiphon aurantiacus ATCC 23779|Rep:
           CRISPR-associated protein, TM1807 - Herpetosiphon
           aurantiacus ATCC 23779
          Length = 362

 Score = 38.7 bits (86), Expect = 0.17
 Identities = 21/82 (25%), Positives = 37/82 (45%)
 Frame = -1

Query: 429 IFNRNIIGLFN*TIFYVPLIDSTVLSTAVQTVFSTPIQGGHFSAKMFGGHPNIYYFRLII 250
           IFN N++ L N       ++         Q + +TP  G   +A +   HP +YY++L  
Sbjct: 31  IFN-NVLYLLNVDAVLEQILPENPNDRLYQQILNTPDLGSFLTADLLSKHPELYYYKL-- 87

Query: 249 EYINSLPFVVPNXMHWDSXSFV 184
           E ++ L  + P   HW    ++
Sbjct: 88  EGVSKLETMRPVIKHWTHAPYI 109


>UniRef50_A0B6J3 Cluster: Glycosyl transferase, group 1; n=1;
           Methanosaeta thermophila PT|Rep: Glycosyl transferase,
           group 1 - Methanosaeta thermophila (strain DSM 6194 /
           PT) (Methanothrixthermophila (strain DSM 6194 / PT))
          Length = 363

 Score = 37.1 bits (82), Expect = 0.53
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 199 VPMHXIRHYKW*TVNILNNQAKIINVWVPAKHFSAKVTALDWSRKYGLYSCTKDSRVYEW 378
           VP+  +RH      ++L  +  +I+   PA    A   ALD SRK G   C + +  Y+W
Sbjct: 290 VPVVAVRHRMNAACDLLTPETGVISELSPASMADAIQAALDLSRKAG-QKCREIASRYDW 348

Query: 379 NIEDGSVKQTY 411
           ++  G +++ Y
Sbjct: 349 DVICGEIERVY 359


>UniRef50_A7S3I9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 700

 Score = 36.3 bits (80), Expect = 0.93
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289 KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQTYNISIENNT 435
           K   + + AL + +  G LYS  +DS +  WN+ +  +K  Y +S+E++T
Sbjct: 27  KRHRSGINALQYDKSNGRLYSAGRDSIIRCWNVRNERIKDPYMVSLEHHT 76


>UniRef50_A7RGM3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 686

 Score = 36.3 bits (80), Expect = 0.93
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +1

Query: 298 SAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTY 411
           S+KV  ++WSR   LYSC+ D  + EW  E    K  +
Sbjct: 137 SSKVNDVEWSRNGELYSCSSDKYIVEWCTEKAEHKSKW 174


>UniRef50_A0M269 Cluster: Putative uncharacterized protein; n=1;
           Gramella forsetii KT0803|Rep: Putative uncharacterized
           protein - Gramella forsetii (strain KT0803)
          Length = 377

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +1

Query: 313 ALDWSRKYGLYSCTKDSRVYEWNI-EDGSVKQTYNISIENNTKQGSHINAIKIIPHN 480
           ALD S KY   S      V  + I EDGS+ Q   I++EN TK  SH +++KI   N
Sbjct: 133 ALDRSGKYVFVSNYMGGVVMSYKINEDGSLTQNQKINLENPTK--SHAHSVKISGDN 187


>UniRef50_UPI0000DB79FD Cluster: PREDICTED: similar to WD repeat
           domain 43, like; n=2; Apocrita|Rep: PREDICTED: similar
           to WD repeat domain 43, like - Apis mellifera
          Length = 624

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 298 SAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVK 402
           S  VTA  WS   G  + + D  + +WN+++  VK
Sbjct: 114 SGSVTAATWSENVGFITASDDHHIIQWNLQENGVK 148


>UniRef50_Q4SQW6 Cluster: Chromosome 11 SCAF14528, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 11
           SCAF14528, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 685

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +1

Query: 289 KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDG 393
           K  S KV ++ WS   G L SC  D  VYEWN + G
Sbjct: 546 KGHSGKVRSVAWSPDDGGLVSCGMDGAVYEWNTQSG 581


>UniRef50_Q15061 Cluster: WD repeat-containing protein 43; n=33;
           Euteleostomi|Rep: WD repeat-containing protein 43 - Homo
           sapiens (Human)
          Length = 677

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 304 KVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVK 402
           +V  + W +  G LYSC+ D  + EWN++   VK
Sbjct: 128 RVNCIQWHQDSGCLYSCSDDKHIVEWNVQTCKVK 161


>UniRef50_A1Z7J6 Cluster: CG8266-PB, isoform B; n=5; Sophophora|Rep:
           CG8266-PB, isoform B - Drosophila melanogaster (Fruit
           fly)
          Length = 1241

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 250 NNQAKIINVW------VPAKHFSAK---VTALDWSRKYG--LYSCTKDSRVYEWNIEDGS 396
           ++QA ++ +W       PAK +      V  + W  +    + SC KD+R+Y WN    +
Sbjct: 228 DDQAPVVQLWDLRYATAPAKTYQIHERGVLGMSWCLQDNDLMVSCGKDNRIYCWN---PN 284

Query: 397 VKQTYNISIENNTKQGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEGFT 546
            K      +       S  + ++  P NPA        G +S  SL G T
Sbjct: 285 TKIPEGEILSEVATTASWYSDVQFCPRNPALIASASLEGAVSIYSLHGGT 334


>UniRef50_A0E258 Cluster: Chromosome undetermined scaffold_74, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_74,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 425

 Score = 33.9 bits (74), Expect = 5.0
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 310 TALDWSRKYGLYSCTKDSRVYEWNIED 390
           TALDWS++Y L S  KD ++  W+I D
Sbjct: 177 TALDWSQEYKLGSGGKDCKILLWDIND 203


>UniRef50_O97254 Cluster: Putative uncharacterized protein
           MAL3P2.33; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL3P2.33 - Plasmodium
           falciparum (isolate 3D7)
          Length = 746

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +1

Query: 334 YGLYSCTKDSRVYEWNIEDGSVKQTYNISIENNTKQGSHINAIKIIPHNP 483
           Y   + + D+ +YE N ++ S+    +++I NN     HIN      +NP
Sbjct: 611 YSSDTTSNDTIIYEENSKNSSLSDLTDLNINNNVSNNQHINHFSYTMNNP 660


>UniRef50_A4MJW9 Cluster: WD-40 repeat protein; n=1; Petrotoga
           mobilis SJ95|Rep: WD-40 repeat protein - Petrotoga
           mobilis SJ95
          Length = 849

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +1

Query: 298 SAKVTALDWSRKYGLYSC-TKDSRVYEWNIEDGSVKQTYNIS 420
           +A + A++WS      +  T D  VY WN ++G+++ T NIS
Sbjct: 572 TAPIKAIEWSPDDNYVATGTTDGNVYIWNSKNGNLESTMNIS 613


>UniRef50_A5DI19 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 3274

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
 Frame = +1

Query: 379 NIEDGSVKQTYNISIENNTK-----QGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEGF 543
           N+ D S+  ++N+ +ENN        G+ I+AI  I HN   A P+L  G +    L+ +
Sbjct: 534 NLFDSSILHSFNLILENNWTFGPLILGATIDAIFYIIHNEPTAFPILKEGKVVDTILDNY 593


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 726,597,373
Number of Sequences: 1657284
Number of extensions: 13877535
Number of successful extensions: 30040
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 29066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30018
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71324098314
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -