SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P27635 Cluster: 60S ribosomal protein L10; n=53; Fungi/...   151   2e-35
UniRef50_Q96L21 Cluster: 60S ribosomal protein L10-like; n=168; ...   144   1e-33
UniRef50_UPI00015B4E4A Cluster: PREDICTED: similar to ribosomal ...   137   2e-31
UniRef50_Q5B047 Cluster: Putative uncharacterized protein; n=1; ...   136   3e-31
UniRef50_Q9M5M7 Cluster: 60S ribosomal protein L10; n=52; Eukary...   129   6e-29
UniRef50_Q6LAD9 Cluster: LAMININ RECEPTOR; n=4; Eukaryota|Rep: L...   113   3e-24
UniRef50_UPI0000499E88 Cluster: 60S ribosomal protein L10; n=1; ...    93   5e-18
UniRef50_Q3LW95 Cluster: Ribosomal protein L10e; n=1; Bigelowiel...    81   3e-14
UniRef50_UPI00005A4DCA Cluster: PREDICTED: similar to ribosomal ...    71   2e-11
UniRef50_UPI0000DD7887 Cluster: PREDICTED: similar to 60S riboso...    71   3e-11
UniRef50_UPI0000EBD477 Cluster: PREDICTED: similar to ribosomal ...    70   5e-11
UniRef50_UPI0000DD7A8E Cluster: PREDICTED: similar to ribosomal ...    67   3e-10
UniRef50_UPI00006C12B9 Cluster: PREDICTED: similar to ribosomal ...    62   1e-08
UniRef50_UPI0000D9B764 Cluster: PREDICTED: similar to 60S riboso...    61   2e-08
UniRef50_Q58DU2 Cluster: Similar to 60S ribosomal protein L10; n...    61   2e-08
UniRef50_Q96YA4 Cluster: 50S ribosomal protein L10e; n=4; Sulfol...    61   2e-08
UniRef50_Q9UWP5 Cluster: 50S ribosomal protein L10e; n=4; Thermo...    60   4e-08
UniRef50_Q6LXR0 Cluster: 50S ribosomal protein L10e; n=3; Methan...    59   7e-08
UniRef50_Q8ZSV4 Cluster: 50S ribosomal protein L10e; n=9; Thermo...    58   2e-07
UniRef50_A7I691 Cluster: Ribosomal protein L10E; n=5; Archaea|Re...    57   3e-07
UniRef50_UPI00015BAE8F Cluster: LSU ribosomal protein L10AE; n=1...    57   4e-07
UniRef50_O27191 Cluster: 50S ribosomal protein L10e; n=6; Euryar...    56   5e-07
UniRef50_Q2FLD3 Cluster: Ribosomal protein L10.e; n=3; Methanomi...    55   2e-06
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    54   2e-06
UniRef50_P60617 Cluster: 50S ribosomal protein L10e; n=9; Euryar...    54   4e-06
UniRef50_UPI0000EB0151 Cluster: UPI0000EB0151 related cluster; n...    52   1e-05
UniRef50_P58299 Cluster: 50S ribosomal protein L10e; n=9; Archae...    52   1e-05
UniRef50_A0RWP6 Cluster: Ribosomal protein L16/L10E; n=2; Thermo...    51   2e-05
UniRef50_UPI00005A4DCE Cluster: PREDICTED: similar to ribosomal ...    48   1e-04
UniRef50_Q01C83 Cluster: RL10_CAEEL 60S ribosomal protein L10; n...    48   2e-04
UniRef50_Q01C82 Cluster: 3'-5' exonuclease, putative; n=3; Ostre...    44   0.002
UniRef50_Q8ISR4 Cluster: QM protein; n=16; Coelomata|Rep: QM pro...    42   0.016
UniRef50_Q74M84 Cluster: 50S ribosomal protein L10e; n=1; Nanoar...    41   0.021
UniRef50_UPI000023CC99 Cluster: hypothetical protein FG07157.1; ...    33   4.2  
UniRef50_Q1YM22 Cluster: Sensor protein; n=4; Rhizobiales|Rep: S...    32   9.8  
UniRef50_Q1Q580 Cluster: Putative uncharacterized protein; n=1; ...    32   9.8  

>UniRef50_P27635 Cluster: 60S ribosomal protein L10; n=53;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L10 -
           Homo sapiens (Human)
          Length = 214

 Score =  151 bits (365), Expect = 2e-35
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 2e-25
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>UniRef50_Q96L21 Cluster: 60S ribosomal protein L10-like; n=168;
           Eukaryota|Rep: 60S ribosomal protein L10-like - Homo
           sapiens (Human)
          Length = 214

 Score =  144 bits (350), Expect = 1e-33
 Identities = 65/85 (76%), Positives = 71/85 (83%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPL  H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FH+R
Sbjct: 64  ALEAARICANKYMVKSCGRDGFHMR 88



 Score =  117 bits (282), Expect = 2e-25
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNEE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>UniRef50_UPI00015B4E4A Cluster: PREDICTED: similar to ribosomal
           protein L10e isoform 2; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ribosomal protein L10e isoform 2 -
           Nasonia vitripennis
          Length = 194

 Score =  137 bits (332), Expect = 2e-31
 Identities = 62/70 (88%), Positives = 63/70 (90%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLGK  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKKASVEDFPLCVHLVSDEYEQLSSE 63

Query: 181 ALEAGRICCN 210
           ALEAGRIC N
Sbjct: 64  ALEAGRICAN 73



 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 54/92 (58%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 282 RINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA---- 449
           +INKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMS+R         H+ S     
Sbjct: 74  KINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSIR-----SSDRHKASVIEAL 128

Query: 450 PSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
               FKFPGR K    K+ GFTKY+R  + +L
Sbjct: 129 RRAKFKFPGRQKIYVSKKWGFTKYDRAVYEQL 160


>UniRef50_Q5B047 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 250

 Score =  136 bits (330), Expect(2) = 3e-31
 Identities = 61/74 (82%), Positives = 65/74 (87%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A VDDFPLCVHLVS+EYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKKANVDDFPLCVHLVSNEYEQLSSE 63

Query: 181 ALEAGRICCNXYLV 222
           ALEA RIC N Y++
Sbjct: 64  ALEAARICANKYVL 77



 Score =  109 bits (262), Expect = 5e-23
 Identities = 57/97 (58%), Positives = 66/97 (68%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHVIRINKMLSCAGAD LQTGMR AFGKPQG VARV IGQ I+SVR       T 
Sbjct: 118 VRVHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGKVARVNIGQIILSVRTRDSHRATA 177

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
                 S  +KFPGR K +  K  GFT   R+++ +L
Sbjct: 178 IEALRRS-MYKFPGRQKIIVSKNWGFTPVRREDYVQL 213



 Score = 21.4 bits (43), Expect(2) = 3e-31
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +1

Query: 214 YLVKNCGXDQFHIR 255
           YLVK  G + FH+R
Sbjct: 104 YLVKIAGKEGFHLR 117


>UniRef50_Q9M5M7 Cluster: 60S ribosomal protein L10; n=52;
           Eukaryota|Rep: 60S ribosomal protein L10 - Euphorbia
           esula (Leafy spurge)
          Length = 220

 Score =  129 bits (311), Expect = 6e-29
 Identities = 58/85 (68%), Positives = 64/85 (75%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  KNKPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI CN Y+ K  G D FH+R
Sbjct: 64  ALEAARIACNKYMTKFAGKDAFHLR 88



 Score =  106 bits (255), Expect = 4e-22
 Identities = 54/99 (54%), Positives = 67/99 (67%), Gaps = 2/99 (2%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR AFGKPQG  ARV IGQ ++SVR     +   
Sbjct: 89  VRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGVCARVAIGQVLLSVRC---KDNNS 145

Query: 435 HRG--SAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
           H    +     FKFPGR K +  ++ GFTK  R ++ +L
Sbjct: 146 HNAQEALRRAKFKFPGRQKIIVSRKWGFTKINRADYPRL 184


>UniRef50_Q6LAD9 Cluster: LAMININ RECEPTOR; n=4; Eukaryota|Rep:
           LAMININ RECEPTOR - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 76

 Score =  113 bits (272), Expect = 3e-24
 Identities = 51/73 (69%), Positives = 56/73 (76%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  K KPYPKSR  RGVPDPKIRI+D+G     VD+FP CVHLVS E E +SSE
Sbjct: 4   RPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSE 63

Query: 181 ALEAGRICCNXYL 219
           ALEA RI CN Y+
Sbjct: 64  ALEAARIACNKYM 76


>UniRef50_UPI0000499E88 Cluster: 60S ribosomal protein L10; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L10 - Entamoeba histolytica HM-1:IMSS
          Length = 190

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 49/97 (50%), Positives = 65/97 (67%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +R+HPFHV+RINKMLSCAGAD LQTGMR A+GK  G+ ARV++GQ ++S R   Q     
Sbjct: 69  IRIHPFHVLRINKMLSCAGADRLQTGMRGAWGKSYGSCARVKVGQVLISGRCKEQ-HLPA 127

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
              S     +KF GR K +   + GFTKY ++E+ +L
Sbjct: 128 MIKSFRLACYKFAGRQKLVISNKWGFTKYTKEEYQQL 164



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 26/44 (59%), Positives = 32/44 (72%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFP 132
           RP RCYR  +  PYPKS+  RGVPDP+I++FD+G   A  DDFP
Sbjct: 4   RPGRCYRLVRGHPYPKSKYCRGVPDPRIKLFDIGNRSAPCDDFP 47


>UniRef50_Q3LW95 Cluster: Ribosomal protein L10e; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L10e - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 193

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 36/85 (42%), Positives = 55/85 (64%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RP +CYR+ KNKPYPKS+  +  P  KI++FD+G   A  + +P C++LV+ +   +SSE
Sbjct: 4   RPFKCYRFIKNKPYPKSKYCKKCPVSKIKMFDIGDKRAKKNIYPCCINLVNLQPINISSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
            LE+ RI  N  L K+    +FH++
Sbjct: 64  CLESVRIVMNRNLTKSIKNKKFHLK 88



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 39/105 (37%), Positives = 58/105 (55%)
 Frame = +3

Query: 222 KELRXXSVPYPMRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMS 401
           K ++       +++HP H++R NKMLS AGAD +QTGMR +FGKP+   ARV+  + I+S
Sbjct: 78  KSIKNKKFHLKIKMHPLHILRNNKMLSRAGADRVQTGMRNSFGKPESICARVKKNKSILS 137

Query: 402 VRL**QVEGTGHRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           VR   + E      +     +K  G       K  GFTK++  +F
Sbjct: 138 VRCRYKDE-DNVINALKQACYKVSGFQIIQISKNWGFTKFKSQQF 181


>UniRef50_UPI00005A4DCA Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L10 - Canis familiaris
          Length = 171

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/60 (55%), Positives = 41/60 (68%)
 Frame = +1

Query: 61  RGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEAGRICCNXYLVKNCGXD 240
           RG PD KI IF++G+  A VD+FP C  +VSD Y Q  SEA EA  IC + Y+VK+CG D
Sbjct: 7   RGAPDAKICIFEVGQKKAKVDEFPPCGQIVSDGYVQPFSEAPEAAHICSSKYMVKSCGKD 66


>UniRef50_UPI0000DD7887 Cluster: PREDICTED: similar to 60S ribosomal
           protein L10 (QM protein) (Tumor suppressor QM) (Laminin
           receptor homolog); n=1; Homo sapiens|Rep: PREDICTED:
           similar to 60S ribosomal protein L10 (QM protein) (Tumor
           suppressor QM) (Laminin receptor homolog) - Homo sapiens
          Length = 283

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 42/84 (50%), Positives = 52/84 (61%), Gaps = 5/84 (5%)
 Frame = +3

Query: 300 SCAGADX----LQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGH-RGSAPSPSF 464
           SC+GA      LQTGM+ AFGKPQGTVARV IGQ IM +    +++   H  G+    +F
Sbjct: 169 SCSGAGPSRCRLQTGMQVAFGKPQGTVARVHIGQVIMFIHT--KLQNKEHVIGALHRVTF 226

Query: 465 KFPGRAKDLRIKEVGFTKYERDEF 536
           KFPG  K    K+ GFTK+  DEF
Sbjct: 227 KFPGHQKVHISKKWGFTKFNADEF 250


>UniRef50_UPI0000EBD477 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 240

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 40/76 (52%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query: 321 LQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSAPS-PSFKFPGRAKDLRI 497
           LQTGMR AFGKPQGT+ARV IGQ IMS+R   +++   H   A     FKFPG  K    
Sbjct: 35  LQTGMRGAFGKPQGTMARVHIGQVIMSIRT--KLQNKEHVIEALRWAKFKFPGCQKIHIS 92

Query: 498 KEVGFTKYERDEFXKL 545
           K+ GFTK+  DEF  +
Sbjct: 93  KKWGFTKFNTDEFENM 108


>UniRef50_UPI0000DD7A8E Cluster: PREDICTED: similar to ribosomal
           protein L10; n=2; Homo sapiens|Rep: PREDICTED: similar
           to ribosomal protein L10 - Homo sapiens
          Length = 235

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 39/73 (53%), Positives = 45/73 (61%), Gaps = 1/73 (1%)
 Frame = +3

Query: 321 LQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFPGRAKDLRI 497
           LQTGMR AFG PQGTVARV IGQ IMS+R   +++   H   A     FK PG  K    
Sbjct: 132 LQTGMRGAFGMPQGTVARVHIGQVIMSIRT--KLQNKEHVIEALRRAKFKLPGHQKIHIS 189

Query: 498 KEVGFTKYERDEF 536
           K+ GFTK+  DEF
Sbjct: 190 KKWGFTKFNADEF 202


>UniRef50_UPI00006C12B9 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=11; Eutheria|Rep: PREDICTED: similar to
           ribosomal protein L10 - Homo sapiens
          Length = 118

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query: 324 QTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFPGRAKDLRIK 500
           QTGMR AFGKPQGTVARV  GQ I+S+    +++   H   A     FKF GR K    K
Sbjct: 16  QTGMRGAFGKPQGTVARVHTGQVIISIHT--KLQNKEHVIEALRRAKFKFSGRQKIHISK 73

Query: 501 EVGFTKYERDEF 536
           + GFTK+  +EF
Sbjct: 74  KWGFTKFNANEF 85


>UniRef50_UPI0000D9B764 Cluster: PREDICTED: similar to 60S ribosomal
           protein L10 (QM protein) (Tumor suppressor QM) (Laminin
           receptor homolog); n=1; Macaca mulatta|Rep: PREDICTED:
           similar to 60S ribosomal protein L10 (QM protein) (Tumor
           suppressor QM) (Laminin receptor homolog) - Macaca
           mulatta
          Length = 305

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query: 306 AGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFPGRA 482
           AG D L+TGM+ AFGK QGTVARVRI Q IMS+    +++   +   A     FKFPG  
Sbjct: 197 AGPDRLRTGMQGAFGKSQGTVARVRIAQVIMSICT--KLQNKEYMIEALRRAKFKFPGHQ 254

Query: 483 KDLRIKEVGFTKYERDEF 536
           K    K+ GF K+  D F
Sbjct: 255 KIHISKKWGFIKFNADAF 272


>UniRef50_Q58DU2 Cluster: Similar to 60S ribosomal protein L10; n=1;
           Bos taurus|Rep: Similar to 60S ribosomal protein L10 -
           Bos taurus (Bovine)
          Length = 176

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 34/56 (60%), Positives = 38/56 (67%), Gaps = 1/56 (1%)
 Frame = +3

Query: 321 LQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFPGRAK 485
           LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   H   A     FKFPGR K
Sbjct: 33  LQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKEHVIEALRRAKFKFPGRQK 86


>UniRef50_Q96YA4 Cluster: 50S ribosomal protein L10e; n=4;
           Sulfolobaceae|Rep: 50S ribosomal protein L10e -
           Sulfolobus tokodaii
          Length = 176

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query: 264 HPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARV-RIGQXIMSVRL 410
           +P HVIR NKM++ AGAD LQ GMR +FGKP GT AR+ R+G  IM  ++
Sbjct: 90  YPHHVIRENKMMAFAGADRLQDGMRLSFGKPIGTAARIERLGDIIMIAKV 139



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 30/81 (37%), Positives = 37/81 (45%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RP RCYR+     Y +     GVP PKI  F +G       D+ L   LV+ E  Q+   
Sbjct: 4   RPGRCYRHFSGPAYTRKEYIPGVPMPKITKFTMGNVNGNY-DYEL--RLVALEKGQIRHN 60

Query: 181 ALEAGRICCNXYLVKNCGXDQ 243
           ALEA R+     L    G DQ
Sbjct: 61  ALEAARVLALKQLTNKTGSDQ 81


>UniRef50_Q9UWP5 Cluster: 50S ribosomal protein L10e; n=4;
           Thermococcaceae|Rep: 50S ribosomal protein L10e -
           Pyrococcus furiosus
          Length = 181

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 34/85 (40%), Positives = 41/85 (48%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPA+  RY     Y +    RG P PKI IFD+G       DF   V L + E  Q+   
Sbjct: 4   RPAKIDRYVDKPAYTRREYIRGAPGPKITIFDMGN---PAGDFEFEVSLHTAEPVQIRQN 60

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA R   N YL KN G   +H +
Sbjct: 61  ALEAARQQVNRYLQKNVGRSNYHFK 85



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/64 (37%), Positives = 38/64 (59%)
 Frame = +3

Query: 219 RKELRXXSVPYPMRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIM 398
           +K +   +  + +R++PF V+R N M +   AD    GMR  FGKP G  AR++  Q I+
Sbjct: 74  QKNVGRSNYHFKIRVYPFQVLRENPMATGRKADRYGNGMRRPFGKPIGLAARLKKDQKIL 133

Query: 399 SVRL 410
           S+R+
Sbjct: 134 SIRV 137


>UniRef50_Q6LXR0 Cluster: 50S ribosomal protein L10e; n=3;
           Methanococcus maripaludis|Rep: 50S ribosomal protein
           L10e - Methanococcus maripaludis
          Length = 173

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 30/78 (38%), Positives = 42/78 (53%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYR  + + Y +    R VP PK+  + +G   A   +FP+ V LVS     +   
Sbjct: 4   RPARCYRTIERRSYTRKEYVRAVPQPKVVHYVMGNPSA---EFPVQVQLVSKSDILIRHN 60

Query: 181 ALEAGRICCNXYLVKNCG 234
           ALE+ RI  N Y++  CG
Sbjct: 61  ALESSRIAGNKYILSECG 78



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/52 (44%), Positives = 37/52 (71%)
 Frame = +3

Query: 249 YPMRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSV 404
           + +R++P  ++R NKM + AGAD +  GMR +FGK  GT A+V+ GQ I+++
Sbjct: 84  FNIRVYPHEILRENKMAAGAGADRISDGMRLSFGKAVGTAAKVKKGQEIITI 135


>UniRef50_Q8ZSV4 Cluster: 50S ribosomal protein L10e; n=9;
           Thermoprotei|Rep: 50S ribosomal protein L10e -
           Pyrobaculum aerophilum
          Length = 180

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXV-DDFPLCVHLVSDEYEQLSS 177
           RPARCY+  K  PY +     G P  +I  FD+G   A     F +   LV +E  Q+  
Sbjct: 4   RPARCYKRIKGPPYTREEYIHGAPMIQIPKFDMGTTSAAARTAFTMTAKLVVEERGQIRM 63

Query: 178 EALEAGRICCNXYLVKNCGXDQFHIR 255
           +ALEA R   + YL K  G   +++R
Sbjct: 64  QALEAARQMASKYLTKYVGDANYYLR 89



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = +3

Query: 249 YPMRLH--PFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXI 395
           Y +RL+  P HV+R N+ML+ AGAD LQ GMR AFG P G  ARV  GQ +
Sbjct: 86  YYLRLNVVPHHVLRENRMLAMAGADRLQEGMRLAFGSPAGRAARVEPGQVL 136


>UniRef50_A7I691 Cluster: Ribosomal protein L10E; n=5; Archaea|Rep:
           Ribosomal protein L10E - Methanoregula boonei (strain
           6A8)
          Length = 248

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 27/61 (44%), Positives = 38/61 (62%)
 Frame = +3

Query: 222 KELRXXSVPYPMRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMS 401
           K++   +  + +R+ P HV+R NK  + AGAD +  GMR AFGK  GT ARV  GQ + +
Sbjct: 75  KDVGRTNFHFKVRVFPHHVLRENKQATGAGADRVSEGMRLAFGKAVGTAARVEAGQLLFT 134

Query: 402 V 404
           V
Sbjct: 135 V 135



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           +P + YR    K Y +     GVP  KI  F++G       +FP  + L+ +E  Q+   
Sbjct: 4   KPGKMYRNLAKKAYTRREYMGGVPGNKIVQFEMGNLS---QEFPTEIDLIVEETCQIRHS 60

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RI  N  L+K+ G   FH +
Sbjct: 61  ALEAARISVNRKLLKDVGRTNFHFK 85


>UniRef50_UPI00015BAE8F Cluster: LSU ribosomal protein L10AE; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L10AE - Ignicoccus hospitalis KIN4/I
          Length = 173

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/51 (50%), Positives = 35/51 (68%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVR 407
           ++ +P HV+R +K ++ AGAD LQ GMR AFGKP G  AR+  G  I+ VR
Sbjct: 90  IKRYPHHVLREHKFMAFAGADRLQEGMRHAFGKPAGLAARIYPGMDILVVR 140



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
 Frame = +1

Query: 1   RPARCY--RYXKN---KPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYE 165
           +PARC+  R+ K     PY +     G+P PK+  + +G      D   + V LV+ E  
Sbjct: 3   KPARCFTKRHAKGFSGPPYTRHEYIHGIPQPKVVKWVMGNPHVDAD---VEVRLVALERA 59

Query: 166 QLSSEALEAGRICCNXYLVKNCGXDQF 246
           Q+   ALEA R+  +  L  + G   +
Sbjct: 60  QVRHNALEAARVMVHKNLSSDIGESNY 86


>UniRef50_O27191 Cluster: 50S ribosomal protein L10e; n=6;
           Euryarchaeota|Rep: 50S ribosomal protein L10e -
           Methanobacterium thermoautotrophicum
          Length = 160

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 25/50 (50%), Positives = 36/50 (72%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSV 404
           +R++P H++R N M + AGAD +Q GMR AFGKP  TVA V+  Q I+++
Sbjct: 74  IRVYPHHIVRENPMATGAGADRVQDGMRKAFGKPVSTVALVKKNQKIITI 123



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +1

Query: 34  KPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEAGRICCNX 213
           + Y +    + +P  KI  +D+G   A   +FP+ + +      Q++  ALEA RI  N 
Sbjct: 3   RAYTRREYIKKIPGSKIVQYDMGNLSA---EFPISLSVAVKAPTQITHNALEAARIASNR 59

Query: 214 YLVKNCGXDQFHIR 255
           Y+ +  G   +H++
Sbjct: 60  YMQRRAGRMGYHLK 73


>UniRef50_Q2FLD3 Cluster: Ribosomal protein L10.e; n=3;
           Methanomicrobia|Rep: Ribosomal protein L10.e -
           Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 170

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/61 (45%), Positives = 36/61 (59%)
 Frame = +3

Query: 222 KELRXXSVPYPMRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMS 401
           KEL   +    +R +P HV+R NK  + AGAD +  GMR AFGK  GT AR +  Q I +
Sbjct: 75  KELGRMNYHLKLRTYPHHVLRENKQATGAGADRVSQGMRLAFGKAVGTAARCQQNQKIFT 134

Query: 402 V 404
           V
Sbjct: 135 V 135



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           +P   YR    K Y +     G+P  K+  FD+G   +   +FP+ V LV DE  Q+   
Sbjct: 4   KPNSMYRNLAKKAYTRKEYMGGIPGVKVVHFDMGNLTS---EFPMEVSLVVDESCQIRHS 60

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA R+  N  L K  G   +H++
Sbjct: 61  ALEAARMSINRKLNKELGRMNYHLK 85


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 35/85 (41%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 297 LSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFP 473
           L+C     LQTGM  AFGK QG VARV   Q IMS+     ++   H   A      +FP
Sbjct: 195 LACWSQSRLQTGMCAAFGKTQGEVARVHTSQVIMSIHT--SLQNKEHVTEALRRAKVQFP 252

Query: 474 GRAKDLRIKEVGFTKYERDEFXKLA 548
           GR K    K+ GF K   DEF  ++
Sbjct: 253 GRQKIHISKKWGFIKVHVDEFENMS 277


>UniRef50_P60617 Cluster: 50S ribosomal protein L10e; n=9;
           Euryarchaeota|Rep: 50S ribosomal protein L10e -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 177

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           +PA  YR      Y +     G+P  KI    +G+     DD+P+ + L+ +E  QL   
Sbjct: 4   KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHG 63

Query: 181 ALEAGRICCNXYLVKNCGXD 240
           +LEA R+  N +L+K  G +
Sbjct: 64  SLEASRLSANRHLIKELGEE 83



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMS 401
           +R  P  V+R NK  + AGAD +  GMR AFGK  GT ARV+ G+ + +
Sbjct: 90  LRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFT 138


>UniRef50_UPI0000EB0151 Cluster: UPI0000EB0151 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0151 UniRef100
           entry - Canis familiaris
          Length = 145

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 321 LQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSAP-SPSFKFPGRAK 485
           LQTGMR  FGKPQGTVARV  GQ IMS+    +++   H   A     FK PGR K
Sbjct: 28  LQTGMRGGFGKPQGTVARVHTGQAIMSICT--KLQNKEHVIEAQCRAKFKLPGRQK 81


>UniRef50_P58299 Cluster: 50S ribosomal protein L10e; n=9;
           Archaea|Rep: 50S ribosomal protein L10e - Thermoplasma
           volcanium
          Length = 176

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/45 (53%), Positives = 31/45 (68%)
 Frame = +3

Query: 264 HPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIM 398
           +P HV+R +KM + AGAD + +GMR AFG+P GT ARV     IM
Sbjct: 89  YPHHVLREHKMATGAGADRISSGMRAAFGRPVGTAARVYQNDVIM 133



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/85 (32%), Positives = 41/85 (48%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           +PAR Y       Y +     GVP PKI  F  G       DFP+ + L++ E  Q+   
Sbjct: 4   KPARMYTRITGPAYTRKEFMGGVPYPKITTFVQGNQKR---DFPIEMQLIAMESCQVRHT 60

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA R+  N  + +  G D F+++
Sbjct: 61  ALEAARVSVNRRMTEAAGLDNFYLK 85


>UniRef50_A0RWP6 Cluster: Ribosomal protein L16/L10E; n=2;
           Thermoprotei|Rep: Ribosomal protein L16/L10E -
           Cenarchaeum symbiosum
          Length = 170

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/47 (53%), Positives = 33/47 (70%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXI 395
           +R++P  ++R NKM++ AGAD LQ GMR A+GK     ARVR GQ I
Sbjct: 82  LRIYPHVLLRENKMIATAGADRLQEGMRRAWGKAVSLGARVRQGQVI 128


>UniRef50_UPI00005A4DCE Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ribosomal protein L10 - Canis familiaris
          Length = 245

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 324 QTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSA-PSPSFKFPGRAKDLRIK 500
           Q  ++ AFGKPQGTVAR  IGQ IMS+    +++   H   A     FKFP   K    K
Sbjct: 143 QLSIQGAFGKPQGTVARGHIGQVIMSICT--KLQNKEHVIEALHRAKFKFPDCQKIHSSK 200

Query: 501 EVGFTKYERDEF 536
           + G+TK+  D F
Sbjct: 201 KWGYTKFNVDGF 212


>UniRef50_Q01C83 Cluster: RL10_CAEEL 60S ribosomal protein L10; n=1;
           Ostreococcus tauri|Rep: RL10_CAEEL 60S ribosomal protein
           L10 - Ostreococcus tauri
          Length = 92

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/40 (55%), Positives = 24/40 (60%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXV 120
           RPA+CYR  KNKPYPKSR  RGVP    R    G   A +
Sbjct: 4   RPAKCYRVIKNKPYPKSRYCRGVPGACERATTRGSGRARI 43



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/26 (61%), Positives = 17/26 (65%)
 Frame = +1

Query: 73  DPKIRIFDLGKXXAXVDDFPLCVHLV 150
           DPKIRI+D G      D FP CVHLV
Sbjct: 66  DPKIRIYDAGMKKYNCDAFPACVHLV 91


>UniRef50_Q01C82 Cluster: 3'-5' exonuclease, putative; n=3;
            Ostreococcus|Rep: 3'-5' exonuclease, putative -
            Ostreococcus tauri
          Length = 1013

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/53 (43%), Positives = 31/53 (58%)
 Frame = -3

Query: 413  LEPHGHDXLSNANTCYSTLRLAKRTTHPSLEXISSSA**HFIDADNVERVKSH 255
            L  +G   L+N +   +TLR   RTTH  L+ I   A  H +DA NVERV++H
Sbjct: 921  LRTNGQHDLANRHPRGNTLRGTVRTTHTRLQAIRPGARQHLVDAQNVERVQAH 973


>UniRef50_Q8ISR4 Cluster: QM protein; n=16; Coelomata|Rep: QM
           protein - Spodoptera frugiperda (Fall armyworm)
          Length = 52

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 19/28 (67%), Positives = 21/28 (75%)
 Frame = +3

Query: 462 FKFPGRAKDLRIKEVGFTKYERDEFXKL 545
           FKFPGR K    K+ GFTKYER+EF KL
Sbjct: 4   FKFPGRQKIYVSKKWGFTKYEREEFEKL 31


>UniRef50_Q74M84 Cluster: 50S ribosomal protein L10e; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L10e -
           Nanoarchaeum equitans
          Length = 186

 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLS-CAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSV 404
           +R +P H+ R   ++   AGAD +  GMR +FG+P+G   ++  G+ ++S+
Sbjct: 95  IRKYPHHIYREKPVVGGYAGADRISQGMRLSFGRPKGRAVQIYEGEKLLSI 145


>UniRef50_UPI000023CC99 Cluster: hypothetical protein FG07157.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07157.1 - Gibberella zeae PH-1
          Length = 650

 Score = 33.5 bits (73), Expect = 4.2
 Identities = 21/61 (34%), Positives = 29/61 (47%)
 Frame = -1

Query: 202 RYVLPPKPLSSAVHIRRTPSARTVESRQRSLXSYPNRRYGSWDQVHPXXTSISDTVYFXS 23
           RYV  P+PL S  H+   PS R+  S   +  S P  RY  +  VHP  + ++   Y   
Sbjct: 504 RYVDNPRPLKSPRHMSH-PSIRSSGSVANNEPS-PEYRYAPYAPVHPSPSEVAQPSYHPE 561

Query: 22  T 20
           T
Sbjct: 562 T 562


>UniRef50_Q1YM22 Cluster: Sensor protein; n=4; Rhizobiales|Rep: Sensor
            protein - Aurantimonas sp. SI85-9A1
          Length = 1067

 Score = 32.3 bits (70), Expect = 9.8
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 70   PDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEAG 195
            P P +   + G+    +DD PL   LV D  E+L   ALEAG
Sbjct: 936  PAPAVAPTETGRTVLVIDDEPLVRMLVVDVLEELGYTALEAG 977


>UniRef50_Q1Q580 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Kuenenia stuttgartiensis|Rep: Putative
           uncharacterized protein - Candidatus Kuenenia
           stuttgartiensis
          Length = 88

 Score = 32.3 bits (70), Expect = 9.8
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 5/47 (10%)
 Frame = -1

Query: 190 PPKPLSSAVHIRRTPSARTVESRQ-----RSLXSYPNRRYGSWDQVH 65
           PPKP  S+VH+  +P    V  R+     +SL S+ +R+ G+W+  H
Sbjct: 15  PPKPYISSVHLPYSPIVAKVRRRRCTTSDKSLGSHHSRQPGTWNIGH 61


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 570,968,393
Number of Sequences: 1657284
Number of extensions: 10381091
Number of successful extensions: 20846
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 20302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20827
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46051731393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -