SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5CXK3 Cluster: Conserved protein with 6 transmembrane ...    38   0.21 
UniRef50_A2EUB1 Cluster: Putative uncharacterized protein; n=1; ...    37   0.49 
UniRef50_Q94546 Cluster: Another transcription unit protein; n=4...    37   0.49 
UniRef50_A5D6S7 Cluster: LOC553494 protein; n=4; Danio rerio|Rep...    35   1.5  
UniRef50_A5TTQ6 Cluster: Ligand gated channel protein TonB; n=3;...    34   2.6  
UniRef50_A2DJM6 Cluster: Leucine Rich Repeat family protein; n=1...    34   2.6  
UniRef50_Q6KC79 Cluster: Nipped-B-like protein; n=75; Deuterosto...    34   2.6  
UniRef50_UPI0000519E71 Cluster: PREDICTED: similar to CG17665-PA...    34   3.5  
UniRef50_A0BYA3 Cluster: Chromosome undetermined scaffold_136, w...    34   3.5  
UniRef50_UPI0000E47903 Cluster: PREDICTED: similar to Tetratrico...    33   4.6  
UniRef50_A0EE47 Cluster: Chromosome undetermined scaffold_91, wh...    33   4.6  
UniRef50_Q4SS19 Cluster: Chromosome undetermined SCAF14482, whol...    33   6.0  
UniRef50_Q17Q38 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_A2DAD3 Cluster: TKL family protein kinase; n=1; Trichom...    33   6.0  
UniRef50_Q7S8M9 Cluster: Putative uncharacterized protein NCU065...    33   6.0  
UniRef50_Q6CTX2 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    33   6.0  
UniRef50_UPI0000D5612C Cluster: PREDICTED: similar to Probable D...    33   8.0  
UniRef50_UPI000023E56E Cluster: hypothetical protein FG09415.1; ...    33   8.0  
UniRef50_Q4S019 Cluster: Chromosome 18 SCAF14786, whole genome s...    33   8.0  
UniRef50_A6Q487 Cluster: Cytochrome c biogenesis protein, CcmF/C...    33   8.0  
UniRef50_A4GI38 Cluster: Phytoene/squalene synthetase; n=2; Bact...    33   8.0  
UniRef50_Q7PTK1 Cluster: ENSANGP00000006278; n=1; Anopheles gamb...    33   8.0  
UniRef50_Q4N867 Cluster: TashAT2 protein, putative; n=2; Theiler...    33   8.0  
UniRef50_A2DCR9 Cluster: Leucine Rich Repeat family protein; n=1...    33   8.0  
UniRef50_A5E500 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  

>UniRef50_Q5CXK3 Cluster: Conserved protein with 6 transmembrane
           domain; n=4; Cryptosporidium|Rep: Conserved protein with
           6 transmembrane domain - Cryptosporidium parvum Iowa II
          Length = 990

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +1

Query: 388 MVPRKSSKKGIHLENKKRERQITPSPEL-KKASSDEEEVISLPTKRKRIRLNPVDSDDSD 564
           ++ +     G   ENK      TP+P L KK S+D+E   + P+ RK +RL P  + D D
Sbjct: 123 IITKAKQTPGGSTENKYNTSNATPTPLLVKKISTDKEVNSAQPSPRKSLRLQPDYNKDED 182

Query: 565 VENK 576
           +  +
Sbjct: 183 LNER 186


>UniRef50_A2EUB1 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 1112

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEE-EVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           EN  +E  ++P+ E +K S D+E E  +   +       P +S+++++EN ADN+
Sbjct: 569 ENLSKEETVSPNSENRKTSQDKEKENTNFDNQNNHNGNKPKESENNEIENPADNQ 623


>UniRef50_Q94546 Cluster: Another transcription unit protein; n=4;
           Endopterygota|Rep: Another transcription unit protein -
           Drosophila melanogaster (Fruit fly)
          Length = 725

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSD-DSDVENKA 579
           KK+ R+ + S + KK S  + ++   PTK K+ RL   DSD + DV  KA
Sbjct: 249 KKKARKASGSDQEKKKSGSDSDIEESPTKAKKSRLIDTDSDSNQDVGKKA 298


>UniRef50_A5D6S7 Cluster: LOC553494 protein; n=4; Danio rerio|Rep:
           LOC553494 protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 981

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 3/90 (3%)
 Frame = +1

Query: 340 QRIKN*KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTK 519
           +R+    + L    + + PR+S++K    ++     Q  PS ++ K +S   +     T 
Sbjct: 525 RRVTRSGKQLQDCQVPVTPRRSTRKTDTEQHTSENHQDMPSEKVSKPASPARKTPQKATP 584

Query: 520 RK---RIRLNPVDSDDSDVENKADNKIGTT 600
           RK   + R   VD DD D  +  D+K   T
Sbjct: 585 RKGSRKTRSTAVDDDDGDDNDDDDDKAALT 614


>UniRef50_A5TTQ6 Cluster: Ligand gated channel protein TonB; n=3;
           Fusobacterium nucleatum|Rep: Ligand gated channel
           protein TonB - Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953
          Length = 262

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 7/99 (7%)
 Frame = +1

Query: 307 ILFSTILLKHRQRIKN*KRTLLKIPIVMVPRKSSKK--GIHLENKKRERQI--TPSPELK 474
           ILF   +++  Q +K+  +  + +PI  V +++S    G  L+ ++RE+Q   +P P+++
Sbjct: 15  ILFGFGIIQTTQMVKDEPKNQI-VPIAFVAKQTSDNPGGKVLDTQEREKQSPESPKPKVE 73

Query: 475 KASSD---EEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582
           K   +   EE+ +    ++K I  N    D   VE K +
Sbjct: 74  KKPEEKKLEEKKVEKKPEKKEIESNIPSKDAKPVEKKPE 112


>UniRef50_A2DJM6 Cluster: Leucine Rich Repeat family protein; n=1;
            Trichomonas vaginalis G3|Rep: Leucine Rich Repeat family
            protein - Trichomonas vaginalis G3
          Length = 1112

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
 Frame = +1

Query: 397  RKSSKKGIHLENKKRERQITPSPELK---KASSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
            +K+SK+ + L + + E    PS   K   K S  E++    P+KRK+  L+  + DD   
Sbjct: 951  KKNSKRKLQLSDSEEEEVKKPSKRKKPVVKDSESEDDEPKKPSKRKKPILSDSEDDDEIP 1010

Query: 568  ENKADN 585
            + K+ N
Sbjct: 1011 QKKSSN 1016


>UniRef50_Q6KC79 Cluster: Nipped-B-like protein; n=75;
            Deuterostomia|Rep: Nipped-B-like protein - Homo sapiens
            (Human)
          Length = 2804

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 424  LENKKRERQITPSPELKKASSDEEEVISLPTK-RKRIRLNPVDSDDSD 564
            +++K++ER+ +PS E    SSD EE +S P K RKR+  +  DSD  D
Sbjct: 2473 VKDKRKERKSSPSKE--NESSDSEEEVSRPRKSRKRVD-SDSDSDSED 2517


>UniRef50_UPI0000519E71 Cluster: PREDICTED: similar to CG17665-PA.3
            isoform 1; n=3; Endopterygota|Rep: PREDICTED: similar to
            CG17665-PA.3 isoform 1 - Apis mellifera
          Length = 1035

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 409  KKGIHLENKKRERQITPSPELKK-ASSDEEEVISLPTKRKRIRLNPVDSD 555
            K G +   +   ++  P   L   +SS+EEE++++   +KR ++NPV SD
Sbjct: 984  KTGANTRERSSSKRPLPRYHLDSTSSSEEEEIVNVKQAKKRKKINPVGSD 1033


>UniRef50_A0BYA3 Cluster: Chromosome undetermined scaffold_136,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_136,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 166

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 5/70 (7%)
 Frame = +1

Query: 400 KSSKKGIHLENKKRERQITPSPELKKASSDEEEVISL---PTKRKRIRLNPV--DSDDSD 564
           K+S    HL+N   ++Q     E  K   +E+++  +   P+K  +   N     +DDSD
Sbjct: 8   KASSSVGHLKNLNNDKQFYSEEETSKKEEEEKQLKKVSKPPSKMSQFSKNATGYQTDDSD 67

Query: 565 VENKADNKIG 594
            E   +NK+G
Sbjct: 68  KETPRNNKVG 77


>UniRef50_UPI0000E47903 Cluster: PREDICTED: similar to
           Tetratricopeptide repeat domain 4; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Tetratricopeptide repeat domain 4 - Strongylocentrotus
           purpuratus
          Length = 364

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 17/60 (28%), Positives = 36/60 (60%)
 Frame = +1

Query: 400 KSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKA 579
           +S+K     + +KR++Q+    E K+ +++E+ + +L T+  R   +PVD +D D + +A
Sbjct: 199 QSAKLKKSADKEKRKKQLE---EKKQRAAEEKLIAALKTRNLRFLSDPVDGEDGDPDEQA 255


>UniRef50_A0EE47 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 699

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +2

Query: 431 TKNAKGKLHPHRSLRRLRVMKKKLFHCQLREKE*D*IQSILMILMLKIKQTIKLEQ 598
           TKN   K+    +  R+ +MKKK+  C    K+    Q IL+I++L ++  I+L+Q
Sbjct: 479 TKNKVSKIFIVTNYGRIEIMKKKIMDCYKFLKK---FQKILIIIILNLQTEIELKQ 531


>UniRef50_Q4SS19 Cluster: Chromosome undetermined SCAF14482, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14482,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 1919

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = +1

Query: 382 IVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDS 561
           I+ V R +  +  HL+ ++++RQ + S   + +SS +E   S  ++R+R   +     DS
Sbjct: 93  ILAVQRSAMLRKQHLQQQQQQRQTSKSGSDEDSSSSDESDSSSSSRRRRNSSDSGSGSDS 152

Query: 562 DVENKADN 585
           D  + +D+
Sbjct: 153 DSSSGSDS 160


>UniRef50_Q17Q38 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 977

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 5/50 (10%)
 Frame = +1

Query: 448 QITPSPELKKASSDEE-----EVISLPTKRKRIRLNPVDSDDSDVENKAD 582
           ++T + +L  ASSDEE     E      KRKR +LN  D ++S++E++AD
Sbjct: 585 EVTTNGKLVIASSDEENLQQDEEEKTKKKRKRRKLNISDDEESEMESEAD 634


>UniRef50_A2DAD3 Cluster: TKL family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: TKL family protein kinase
           - Trichomonas vaginalis G3
          Length = 658

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 9/79 (11%)
 Frame = +1

Query: 379 PIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDE------EEVISLPTKRKRIRLN 540
           P+V+ P+ ++K+ +  +N K+    TPS + K   SD+      EE+  +  K+K+ ++N
Sbjct: 573 PVVIKPKNANKRILTRKNSKQINTDTPSVDAKPQISDQNDDEILEELDDIQEKKKQTKVN 632

Query: 541 PVDSDDSD---VENKADNK 588
             D   ++   V +K D K
Sbjct: 633 EEDEAVNEIVTVPSKKDRK 651


>UniRef50_Q7S8M9 Cluster: Putative uncharacterized protein NCU06585.1;
            n=1; Neurospora crassa|Rep: Putative uncharacterized
            protein NCU06585.1 - Neurospora crassa
          Length = 1040

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +1

Query: 415  GIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNKI 591
            G   E KK    ++  P+ K A++  +   S+P  R+R R N   S+D D E   D+++
Sbjct: 974  GDQAERKKESAVMSTKPKRKAAAAKAKA--SIPGSRRRTRRNVPSSEDEDEEEDEDSEL 1030


>UniRef50_Q6CTX2 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome C of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 1184

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 3/67 (4%)
 Frame = +1

Query: 385 VMVPRK-SSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNP--VDSD 555
           V  P K +S + I L+     +++TPSP ++     + ++   PT+ K+  ++P  ++  
Sbjct: 719 VSQPAKVTSSRLITLKPVDTPKEVTPSPSMQLHDKIDRQLSPSPTRNKKDYISPEFIEDS 778

Query: 556 DSDVENK 576
           D D EN+
Sbjct: 779 DGDAENE 785


>UniRef50_UPI0000D5612C Cluster: PREDICTED: similar to Probable DNA
           mismatch repair protein MSH6; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Probable DNA
           mismatch repair protein MSH6 - Tribolium castaneum
          Length = 1079

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 15/26 (57%), Positives = 17/26 (65%)
 Frame = +3

Query: 276 MSKRNSTGAANTLFNYFTKTPPTNKK 353
           MSKR STG +NTL NYF     +N K
Sbjct: 1   MSKRFSTGQSNTLLNYFQSPKSSNGK 26


>UniRef50_UPI000023E56E Cluster: hypothetical protein FG09415.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG09415.1 - Gibberella zeae PH-1
          Length = 824

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +1

Query: 358 KRTLLKIPIVMVPRKSSKKGIHLENKKRERQITPSP--ELKKASSDEEEVISLPTKRKRI 531
           +R L  +PI  VP KS ++    E    ER  +P P  +    SSD+E   S+P + + I
Sbjct: 175 RRRLSSLPITSVPDKSLEQTAQPELSPEERSPSPGPAEDSSPTSSDDE---SIPAQSRII 231

Query: 532 RLNP 543
           R  P
Sbjct: 232 RRPP 235


>UniRef50_Q4S019 Cluster: Chromosome 18 SCAF14786, whole genome
           shotgun sequence; n=2; Percomorpha|Rep: Chromosome 18
           SCAF14786, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1447

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +1

Query: 331 KHRQRIKN*KRTLLKIPIVMVPRKSSKKGIHLENKKRERQIT 456
           K+RQ +K  +RT L +P V++P K  +  I ++ + +E  +T
Sbjct: 717 KYRQVVKVGRRTTLSVPFVVIPTKEGQFSIDVKAETKESVLT 758


>UniRef50_A6Q487 Cluster: Cytochrome c biogenesis protein,
           CcmF/CycK/CcsA family; n=1; Nitratiruptor sp.
           SB155-2|Rep: Cytochrome c biogenesis protein,
           CcmF/CycK/CcsA family - Nitratiruptor sp. (strain
           SB155-2)
          Length = 1044

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -3

Query: 249 LRLLY*IFIFTYYRAKVYFLMIYHLTFIFILLSQKST 139
           L LLY IF F  +R + +F  ++HL F+ I++    T
Sbjct: 60  LNLLYNIFKFRLFRKEKFFTGLFHLAFLIIIIGAAVT 96


>UniRef50_A4GI38 Cluster: Phytoene/squalene synthetase; n=2;
           Bacteria|Rep: Phytoene/squalene synthetase - uncultured
           marine bacterium EB0_41B09
          Length = 284

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 2/43 (4%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPT--KRKRIRLNPVD 549
           E+ +R R   P  ELKK S  EEE+ISL    K K++  N VD
Sbjct: 167 EDARRGRIYIPLDELKKLSVSEEEIISLKNSDKIKKLVQNQVD 209


>UniRef50_Q7PTK1 Cluster: ENSANGP00000006278; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000006278 - Anopheles gambiae
           str. PEST
          Length = 495

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 2/63 (3%)
 Frame = +1

Query: 418 IHLENKKRERQIT--PSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNKI 591
           I  E K++  QI+   + EL  AS D +     P +  R+  N  D DD + EN      
Sbjct: 83  IEAEQKRKLNQISYPNTDELSSASDDNDADGERPARAARMIANGSDEDDYEEENDESAPS 142

Query: 592 GTT 600
           GTT
Sbjct: 143 GTT 145


>UniRef50_Q4N867 Cluster: TashAT2 protein, putative; n=2;
           Theileria|Rep: TashAT2 protein, putative - Theileria
           parva
          Length = 338

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 3/76 (3%)
 Frame = +1

Query: 286 ETAQGQPILFSTILLKHRQRIKN*KRTLLKIPIVMVPRKSSK--KGIHLENK-KRERQIT 456
           +T Q +   FSTI   +  +I   K     IP +   R+ SK  +  HL  K KR + +T
Sbjct: 122 KTCQEKIQSFSTIQKYNPSKIYQPKTEEYPIPQMRKTRQKSKTERSKHLRGKHKRRKYVT 181

Query: 457 PSPELKKASSDEEEVI 504
           P  E  + SS+ EE++
Sbjct: 182 PLNEDTETSSETEEIL 197


>UniRef50_A2DCR9 Cluster: Leucine Rich Repeat family protein; n=1;
            Trichomonas vaginalis G3|Rep: Leucine Rich Repeat family
            protein - Trichomonas vaginalis G3
          Length = 1082

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = +1

Query: 379  PIVMVPRKSSKKGIHLENKKRERQITPSPELKKA---SSDEEEVISLPTKRKRIRLNPVD 549
            P +  P K  KK      KK+ ++    P+ KK     SD ++ + LP K+K++ +  +D
Sbjct: 879  PPMKKPSKRPKKEQEPVKKKKLQEEEILPKKKKRIINDSDSDDEVILPKKKKQV-IKDLD 937

Query: 550  SDDSDV 567
            SD+ D+
Sbjct: 938  SDEEDI 943


>UniRef50_A5E500 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 756

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 6/102 (5%)
 Frame = +1

Query: 301 QPILFSTILLKHRQRIKN*KRTL--LKIPIVMVPRKSSKKGIHLENKKRE---RQITPSP 465
           Q ILF+ IL     ++   K TL  LK P    P K  ++     +K        +TP  
Sbjct: 303 QNILFNRILTNQLDQVPRNKVTLASLKRPATTSPEKRKRRKYEKVDKLHFFSLGDVTPVQ 362

Query: 466 ELKKASSDEEEVISLPTKRKRIRLNPVDSDD-SDVENKADNK 588
            + K   DEEE+ +   K K  + N +D+++  +++ K + K
Sbjct: 363 SIPKEKDDEEEIENEREKAKE-KGNEMDAEEGKEIKEKENGK 403


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 513,264,386
Number of Sequences: 1657284
Number of extensions: 9357180
Number of successful extensions: 31304
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 29033
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31120
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -