SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2F6C0 Cluster: Cyclin-dependent kinase regulatory subu...   278   7e-74
UniRef50_UPI0000F2BDD1 Cluster: PREDICTED: similar to Cks1 prote...   123   3e-27
UniRef50_Q25330 Cluster: Cyclin-dependent kinases regulatory sub...   121   2e-26
UniRef50_O23249 Cluster: Cyclin-dependent kinases regulatory sub...   118   2e-25
UniRef50_P33552 Cluster: Cyclin-dependent kinases regulatory sub...   115   8e-25
UniRef50_Q17868 Cluster: Cyclin-dependent kinases regulatory sub...   109   5e-23
UniRef50_Q95XM4 Cluster: Putative uncharacterized protein; n=2; ...   108   9e-23
UniRef50_Q22AB9 Cluster: Cyclin-dependent kinase regulatory subu...   100   6e-20
UniRef50_Q5KFN1 Cluster: Expressed protein; n=2; Filobasidiella ...    91   3e-17
UniRef50_P20486 Cluster: Cyclin-dependent kinases regulatory sub...    90   5e-17
UniRef50_Q23VW4 Cluster: Cyclin-dependent kinase regulatory subu...    88   1e-16
UniRef50_Q4P9K3 Cluster: Putative uncharacterized protein; n=1; ...    88   2e-16
UniRef50_P08463 Cluster: Cyclin-dependent kinases regulatory sub...    85   2e-15
UniRef50_Q55AV7 Cluster: Putative uncharacterized protein; n=2; ...    81   2e-14
UniRef50_A0CUF4 Cluster: Chromosome undetermined scaffold_28, wh...    68   2e-10
UniRef50_A3FPY9 Cluster: Cyclin dependent kinase regulatory subu...    67   3e-10
UniRef50_A0E676 Cluster: Chromosome undetermined scaffold_8, who...    60   6e-08
UniRef50_A0CLA7 Cluster: Chromosome undetermined scaffold_20, wh...    59   1e-07
UniRef50_Q015G3 Cluster: Cyclin-dependent kinases regulatory sub...    58   1e-07
UniRef50_A0BH22 Cluster: Chromosome undetermined scaffold_107, w...    56   7e-07
UniRef50_A7AW90 Cluster: Putative uncharacterized protein; n=1; ...    53   5e-06
UniRef50_Q4N0M7 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_Q4UCX6 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q4N6I1 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q2HDJ5 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q7RLZ4 Cluster: Putative uncharacterized protein PY0239...    41   0.021
UniRef50_Q8I2S1 Cluster: Putative uncharacterized protein PFI115...    38   0.20 
UniRef50_A7ARD7 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_Q4UJ36 Cluster: Cyclin-dependent kinase regulatory subu...    35   1.9  
UniRef50_Q0A937 Cluster: Diguanylate cyclase precursor; n=1; Alk...    33   4.3  
UniRef50_O61087 Cluster: NPK-1 protein kinase homolog; n=2; Tryp...    33   7.5  
UniRef50_Q0WE37 Cluster: Putative membrane protein; n=2; Yersini...    32   9.9  
UniRef50_Q8IFN8 Cluster: Putative uncharacterized protein PFD104...    32   9.9  

>UniRef50_Q2F6C0 Cluster: Cyclin-dependent kinase regulatory
           subunit; n=1; Bombyx mori|Rep: Cyclin-dependent kinase
           regulatory subunit - Bombyx mori (Silk moth)
          Length = 142

 Score =  278 bits (682), Expect = 7e-74
 Identities = 130/142 (91%), Positives = 132/142 (92%)
 Frame = +2

Query: 110 MPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVH 289
           MP DQIQYSERYTDDVYEYRHVILPPDIAR VPKSHLMTETEWRNLGVQQSPGWLHFMVH
Sbjct: 1   MPGDQIQYSERYTDDVYEYRHVILPPDIARRVPKSHLMTETEWRNLGVQQSPGWLHFMVH 60

Query: 290 NPEPHVLLFRRPRTDIPAPLNGLDTNTSSAVKV*LFLLHRHIFRCHSLILFKLLIETIIV 469
           NPEP VLLFRRPRTDIPAPLNGLDTNTSSAVKV  F  HRHIFRCHSLILFK L+ETIIV
Sbjct: 61  NPEPQVLLFRRPRTDIPAPLNGLDTNTSSAVKVGRFWWHRHIFRCHSLILFKWLMETIIV 120

Query: 470 KTKKKNCSIYYKLADINYYYIT 535
           KTK+KN SIYYKLADINY YIT
Sbjct: 121 KTKQKNFSIYYKLADINYDYIT 142


>UniRef50_UPI0000F2BDD1 Cluster: PREDICTED: similar to Cks1 protein
           homologue; n=1; Monodelphis domestica|Rep: PREDICTED:
           similar to Cks1 protein homologue - Monodelphis
           domestica
          Length = 120

 Score =  123 bits (297), Expect = 3e-27
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 46  QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 105

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 106 HILLFRRP 113


>UniRef50_Q25330 Cluster: Cyclin-dependent kinases regulatory
           subunit; n=8; Trypanosomatidae|Rep: Cyclin-dependent
           kinases regulatory subunit - Leishmania mexicana
          Length = 99

 Score =  121 bits (291), Expect = 2e-26
 Identities = 49/70 (70%), Positives = 61/70 (87%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           +I YS++Y DD++EYRHVILP D+AR+VP S LM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 30  KILYSDKYYDDMFEYRHVILPKDLARLVPTSRLMSEMEWRQLGVQQSQGWVHYMIHKPEP 89

Query: 302 HVLLFRRPRT 331
           HVLLF+RPRT
Sbjct: 90  HVLLFKRPRT 99


>UniRef50_O23249 Cluster: Cyclin-dependent kinases regulatory
           subunit 1; n=58; Magnoliophyta|Rep: Cyclin-dependent
           kinases regulatory subunit 1 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 87

 Score =  118 bits (283), Expect = 2e-25
 Identities = 44/68 (64%), Positives = 60/68 (88%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QIQYSE+Y DD +EYRHV+LPP++A+++PK+ L++E EWR +GVQQS GW+H+ VH PEP
Sbjct: 3   QIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEP 62

Query: 302 HVLLFRRP 325
           H++LFRRP
Sbjct: 63  HIMLFRRP 70


>UniRef50_P33552 Cluster: Cyclin-dependent kinases regulatory
           subunit 2; n=80; Eukaryota|Rep: Cyclin-dependent kinases
           regulatory subunit 2 - Homo sapiens (Human)
          Length = 79

 Score =  115 bits (277), Expect = 8e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>UniRef50_Q17868 Cluster: Cyclin-dependent kinases regulatory
           subunit; n=3; Bilateria|Rep: Cyclin-dependent kinases
           regulatory subunit - Caenorhabditis elegans
          Length = 94

 Score =  109 bits (262), Expect = 5e-23
 Identities = 41/65 (63%), Positives = 56/65 (86%)
 Frame = +2

Query: 131 YSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVL 310
           YS +Y DD +EYRHV +  D+++++PK+ LM+ETEWR+LG+QQSPGW+H+M+H PE HVL
Sbjct: 10  YSNKYEDDEFEYRHVHVTKDVSKLIPKNRLMSETEWRSLGIQQSPGWMHYMIHGPERHVL 69

Query: 311 LFRRP 325
           LFRRP
Sbjct: 70  LFRRP 74


>UniRef50_Q95XM4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 118

 Score =  108 bits (260), Expect = 9e-23
 Identities = 46/71 (64%), Positives = 54/71 (76%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNP 295
           ++ I YS RY DD YEYRHVILP  ++R VPK  L++E EWR  GVQQS GW H+MVHNP
Sbjct: 1   MEDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNP 60

Query: 296 EPHVLLFRRPR 328
           E H+LLFRR R
Sbjct: 61  EKHILLFRRKR 71


>UniRef50_Q22AB9 Cluster: Cyclin-dependent kinase regulatory subunit
           family protein; n=7; Oligohymenophorea|Rep:
           Cyclin-dependent kinase regulatory subunit family
           protein - Tetrahymena thermophila SB210
          Length = 149

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 40/75 (53%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query: 119 DQIQYSERYTDDVYEYRHVILPPDIARMVPKSH-LMTETEWRNLGVQQSPGWLHFMVHNP 295
           ++IQY E+Y DD YEYRHVILP  I + +P+   ++TE++WR +G+QQS GW+H+  H P
Sbjct: 6   NEIQYGEKYYDDYYEYRHVILPKQIFKTMPRDQKVLTESQWRMMGIQQSRGWVHYDSHKP 65

Query: 296 EPHVLLFRRPRTDIP 340
           EP++LLFRRP+   P
Sbjct: 66  EPYILLFRRPKGTDP 80


>UniRef50_Q5KFN1 Cluster: Expressed protein; n=2; Filobasidiella
           neoformans|Rep: Expressed protein - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 124

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 38/77 (49%), Positives = 53/77 (68%)
 Frame = +2

Query: 98  KTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLH 277
           K   M  ++I YS RY++D +E+RHVI+P  + R +P   +  E  WR +G++QSPGW  
Sbjct: 17  KAIQMYEEKIHYSARYSNDEWEFRHVIIPKPLVRFIPPG-VCAEEVWRGIGIRQSPGWEM 75

Query: 278 FMVHNPEPHVLLFRRPR 328
           +M H PEPHVLLFRRP+
Sbjct: 76  YMRHEPEPHVLLFRRPK 92


>UniRef50_P20486 Cluster: Cyclin-dependent kinases regulatory
           subunit; n=9; Fungi/Metazoa group|Rep: Cyclin-dependent
           kinases regulatory subunit - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 150

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 39/78 (50%), Positives = 52/78 (66%), Gaps = 9/78 (11%)
 Frame = +2

Query: 119 DQIQYSERYTDDVYEYRHVILPPDIARMVPKSH---------LMTETEWRNLGVQQSPGW 271
           D I YS RY+DD YEYRHV+LP  + +++P  +         ++TE EWR LG+ QS GW
Sbjct: 26  DSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGW 85

Query: 272 LHFMVHNPEPHVLLFRRP 325
            H+  H PEPH+LLF+RP
Sbjct: 86  EHYECHAPEPHILLFKRP 103


>UniRef50_Q23VW4 Cluster: Cyclin-dependent kinase regulatory subunit
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Cyclin-dependent kinase regulatory subunit family
           protein - Tetrahymena thermophila SB210
          Length = 79

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 33/68 (48%), Positives = 49/68 (72%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           +I+YS+ Y DD Y YR+V LP D+ + +PK  +MTE  WR+LG++ S GW HF V+ PEP
Sbjct: 7   EIEYSDTYNDDAYFYRNVRLPQDLYKKIPKGKIMTEDVWRSLGIKSSKGWQHFYVYKPEP 66

Query: 302 HVLLFRRP 325
            +++ R+P
Sbjct: 67  FIIMLRKP 74


>UniRef50_Q4P9K3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 127

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 56/81 (69%), Gaps = 10/81 (12%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSH----------LMTETEWRNLGVQQSP 265
           V++IQYS++Y DD +EYRHVILP  + +++P+ +          +++  EWR LG+ QS 
Sbjct: 16  VERIQYSDKYNDDEWEYRHVILPKKMLKLLPEDYFDPAEPGVLRILSVEEWRQLGITQSM 75

Query: 266 GWLHFMVHNPEPHVLLFRRPR 328
           GW H+ VH PEPH+LLFRR +
Sbjct: 76  GWEHYEVHAPEPHILLFRREK 96


>UniRef50_P08463 Cluster: Cyclin-dependent kinases regulatory
           subunit; n=22; Dikarya|Rep: Cyclin-dependent kinases
           regulatory subunit - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 113

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 39/80 (48%), Positives = 50/80 (62%), Gaps = 9/80 (11%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTET---------EWRNLGVQQSPG 268
           +DQI YS RY DD YEYRHV+LP  + + +P  +   ET         EWR LG+ QS G
Sbjct: 22  IDQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPETGTLRILQEEEWRGLGITQSLG 81

Query: 269 WLHFMVHNPEPHVLLFRRPR 328
           W  + VH PEPH+LLF+R +
Sbjct: 82  WEMYEVHVPEPHILLFKREK 101


>UniRef50_Q55AV7 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 229

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 32/58 (55%), Positives = 44/58 (75%)
 Frame = +2

Query: 167 RHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDIP 340
           +HVILP +I+ ++P+  L+TE E R LG++QS GW H+  H PEPH+LLFRRP + IP
Sbjct: 6   KHVILPSEISSLIPRDVLLTEDECRKLGIRQSDGWEHYANHKPEPHILLFRRPHSGIP 63


>UniRef50_A0CUF4 Cluster: Chromosome undetermined scaffold_28, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_28,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 93

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +2

Query: 125 IQYSERYTDDVYEYRHVILPPDIARMVP---KSHLMTETEWRNLGVQQSPGWLHFMVHNP 295
           I YS++Y DD Y Y  V L   I+  +P   +  L+ E EWR LG++   GWL++ VH P
Sbjct: 10  ISYSDQYRDDYYNYMIVYLDQKISEKIPIDKRGFLLREPEWRELGIKLFKGWLNYDVHYP 69

Query: 296 EPHVLLFRR 322
           +P++L FR+
Sbjct: 70  DPYILFFRK 78


>UniRef50_A3FPY9 Cluster: Cyclin dependent kinase regulatory
           subunit, putative; n=1; Cryptosporidium parvum Iowa
           II|Rep: Cyclin dependent kinase regulatory subunit,
           putative - Cryptosporidium parvum Iowa II
          Length = 86

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 26/36 (72%), Positives = 31/36 (86%)
 Frame = +2

Query: 218 LMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP 325
           L++E EWR LGVQQS GW H++VH PEPH+LLFRRP
Sbjct: 43  LLSEQEWRMLGVQQSRGWQHYLVHKPEPHILLFRRP 78


>UniRef50_A0E676 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 87

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 24/44 (54%), Positives = 32/44 (72%)
 Frame = +2

Query: 119 DQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLG 250
           ++I+YS++Y DD YEYRHVILP  I + + K  L+ E EWR LG
Sbjct: 6   EEIEYSDKYFDDYYEYRHVILPKHIFKKITKGKLLNEMEWRALG 49


>UniRef50_A0CLA7 Cluster: Chromosome undetermined scaffold_20, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_20,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 60

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 1/55 (1%)
 Frame = +2

Query: 113 PVDQIQYSERYTDDVYEYRHVILPPDIARMVPK-SHLMTETEWRNLGVQQSPGWL 274
           P D I YSE+YTD  +EYRHVILP ++ + + K   L+TE EWR+LG ++ P W+
Sbjct: 5   PTD-IVYSEKYTDGEFEYRHVILPHELYKKISKIGRLLTEQEWRSLGYKRIP-WM 57


>UniRef50_Q015G3 Cluster: Cyclin-dependent kinases regulatory
           subunit; n=1; Ostreococcus tauri|Rep: Cyclin-dependent
           kinases regulatory subunit - Ostreococcus tauri
          Length = 167

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 20/30 (66%), Positives = 26/30 (86%)
 Frame = +2

Query: 230 TEWRNLGVQQSPGWLHFMVHNPEPHVLLFR 319
           TEWR LGVQQS GW+H+ +H PEPH++L+R
Sbjct: 92  TEWRGLGVQQSRGWVHYAIHRPEPHIMLYR 121



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHV 175
           QIQYSE+Y DDVYEYR V
Sbjct: 3   QIQYSEKYYDDVYEYRCV 20


>UniRef50_A0BH22 Cluster: Chromosome undetermined scaffold_107,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_107,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 101

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 4/72 (5%)
 Frame = +2

Query: 128 QYSERYTDDVYEYRHVILPPDIARMVPK----SHLMTETEWRNLGVQQSPGWLHFMVHNP 295
           Q S+ + DD + YR + L  +  R++ +      L+ E EWR L V Q  GWLH+ +   
Sbjct: 25  QISQDFEDDTHIYRIIRLGRESVRLMQEFKWEKKLLKEEEWRRLRVYQRRGWLHYAIFEK 84

Query: 296 EPHVLLFRRPRT 331
           EP+VLLF+R  T
Sbjct: 85  EPYVLLFKRKIT 96


>UniRef50_A7AW90 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 230

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 34/83 (40%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = +2

Query: 98  KTTVMPVDQIQYSERYTDDVYEYRHVILPPDI---ARMVPKS---HLMTETEW-RNLGVQ 256
           KTT  P   + YS R+ D+ Y YR VIL   +   A  + KS   H +TE +    LG+ 
Sbjct: 147 KTT--PFGDVYYSPRFNDNKYTYRFVILTRGVRNEAYRILKSCGRHFLTEMQIIHQLGID 204

Query: 257 QSPGWLHFMVHNPEPHVLLFRRP 325
            SPGW HFMV   +   L+ RRP
Sbjct: 205 LSPGWEHFMVFRNKLEELILRRP 227


>UniRef50_Q4N0M7 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 327

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 7/77 (9%)
 Frame = +2

Query: 113 PVDQIQYSERYTDDVYEYRHVILPPDIA----RMV--PKSHLMTETE-WRNLGVQQSPGW 271
           P   + YS R+ DD Y YR+VIL   +     R++   KS+L+TE +  R L +  SPGW
Sbjct: 249 PFGDVYYSPRFQDDKYIYRYVILTKGVRNEAYRLLKQSKSYLLTEHQIIRELCIDLSPGW 308

Query: 272 LHFMVHNPEPHVLLFRR 322
            HFM+       L+ RR
Sbjct: 309 EHFMLFKNRLDELILRR 325


>UniRef50_Q4UCX6 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 307

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 7/77 (9%)
 Frame = +2

Query: 113 PVDQIQYSERYTDDVYEYRHVILPPDIA----RMV--PKSHLMTETE-WRNLGVQQSPGW 271
           P   + YS R+ D+ Y YR+VIL   +     R++   KS+L+TE +  R L +  SPGW
Sbjct: 229 PFGDVYYSPRFQDEKYIYRYVILTKGVRNEAYRLLKQSKSYLLTEHQIIRELCIDLSPGW 288

Query: 272 LHFMVHNPEPHVLLFRR 322
            HFM+       L+ RR
Sbjct: 289 EHFMLFKNRLDELILRR 305


>UniRef50_Q4N6I1 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 135

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPK-----SHLMTETEWRNLGVQQSPGWLHF 280
           ++ IQYS + T    + R V LP +   +V       + L++E+EWR LG++ S GW H 
Sbjct: 56  INNIQYSPKITHSNCQIRCVTLPREHPVLVGGLDGYGTRLLSESEWRKLGIKMSKGWTHS 115

Query: 281 MVHNPEPHVLLFR 319
                E H+L+F+
Sbjct: 116 GYSPYESHILIFQ 128


>UniRef50_Q2HDJ5 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 113

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 9/57 (15%)
 Frame = +2

Query: 116 VDQIQYSERYTDDVYEYRHVILPPDIARMVPKSH---------LMTETEWRNLGVQQ 259
           +D I YS RY+D  YEYRHV LP  + + +P  +         L+ E EWR +G+ Q
Sbjct: 33  LDGIHYSTRYSDSEYEYRHVQLPKAMLKAIPSDYHDKAKGTLKLLWEDEWRGMGITQ 89


>UniRef50_Q7RLZ4 Cluster: Putative uncharacterized protein PY02394;
           n=1; Plasmodium yoelii yoelii|Rep: Putative
           uncharacterized protein PY02394 - Plasmodium yoelii
           yoelii
          Length = 308

 Score = 41.1 bits (92), Expect = 0.021
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +2

Query: 131 YSERYTDDVYEYRHVILPPDIARMVPKSHLMTE---TEW---RNLGVQQSPGWLHFMVHN 292
           YS  Y DD Y YRH+IL  ++ +   K    T    TE      L +    GW HFM+++
Sbjct: 221 YSSTYRDDKYIYRHIILSDNVRQYAEKKVRRTNAFLTEHCIINELQIDIGKGWKHFMIYD 280

Query: 293 PEPHVLLFRRPRT 331
            +   L+ R+  T
Sbjct: 281 GKIRELILRKVLT 293


>UniRef50_Q8I2S1 Cluster: Putative uncharacterized protein PFI1155w;
           n=4; Plasmodium|Rep: Putative uncharacterized protein
           PFI1155w - Plasmodium falciparum (isolate 3D7)
          Length = 357

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 6/74 (8%)
 Frame = +2

Query: 131 YSERYTDDVYEYRHVILPPDIARMV------PKSHLMTETEWRNLGVQQSPGWLHFMVHN 292
           YS  Y D+ Y YRH+IL  ++ +          ++L  +     L +    GW HFM+++
Sbjct: 270 YSALYRDNKYVYRHIILSDNVRQYAENKVRKTNAYLTEQCIVNELQIDIGKGWKHFMIYD 329

Query: 293 PEPHVLLFRRPRTD 334
            +   L+ R+  T+
Sbjct: 330 GKLRELILRKNLTN 343


>UniRef50_A7ARD7 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 477

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 30/89 (33%), Positives = 42/89 (47%), Gaps = 22/89 (24%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPD-------IARMVPK----------SH----LMTETEW 238
           +I YS ++ DD Y YR V+L  +       ++R +P           SH     +TE E 
Sbjct: 387 KIIYSPKFKDDKYMYRFVLLTKEAQEAVEALSRTLPNASRHQGNYITSHGPKRYLTEFEI 446

Query: 239 -RNLGVQQSPGWLHFMVHNPEPHVLLFRR 322
            R LG+Q SPGW HFM        L+ R+
Sbjct: 447 VRQLGIQMSPGWEHFMYFKELNKELVLRK 475


>UniRef50_Q4UJ36 Cluster: Cyclin-dependent kinase regulatory
           subunit, putative; n=1; Theileria annulata|Rep:
           Cyclin-dependent kinase regulatory subunit, putative -
           Theileria annulata
          Length = 53

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 218 LMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRR 322
           L+ E EW+  G+Q S  W+H      E H+L+F++
Sbjct: 17  LLKEYEWKQFGIQISNEWIHIGYSPYELHILIFQK 51


>UniRef50_Q0A937 Cluster: Diguanylate cyclase precursor; n=1;
           Alkalilimnicola ehrlichei MLHE-1|Rep: Diguanylate
           cyclase precursor - Alkalilimnicola ehrlichei (strain
           MLHE-1)
          Length = 561

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +2

Query: 182 PPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP 325
           PP +  ++P   ++  +   NLG+   P WLH  +  P P VL    P
Sbjct: 49  PPPV-HLLPAGQVLDASRPINLGLSSRPVWLHLEISAPPPRVLHLDNP 95


>UniRef50_O61087 Cluster: NPK-1 protein kinase homolog; n=2;
           Trypanosoma cruzi|Rep: NPK-1 protein kinase homolog -
           Trypanosoma cruzi
          Length = 561

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 236 WRNLGVQQSPGWLHFMVHNPEPHVLL 313
           W +LGVQQ P  L+ + +NPE H ++
Sbjct: 495 WSHLGVQQLPSLLYHIANNPEDHPVI 520


>UniRef50_Q0WE37 Cluster: Putative membrane protein; n=2; Yersinia
           pestis|Rep: Putative membrane protein - Yersinia pestis
          Length = 112

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +2

Query: 440 FKLLIETIIVKTKKKNCSIYYKLADINYYYITLFCLSLNSN--RGVLIQLFM 589
           +K LIE +I+  K+KN +  YK+A+I  + ++   + L SN     L+ LF+
Sbjct: 40  YKKLIENLIIIPKQKNTAQPYKIANIKLFTVSSLFIFLFSNVLMASLVALFV 91


>UniRef50_Q8IFN8 Cluster: Putative uncharacterized protein PFD1045w;
           n=4; Plasmodium|Rep: Putative uncharacterized protein
           PFD1045w - Plasmodium falciparum (isolate 3D7)
          Length = 524

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 494 IYYKLADINYYYITLFCLSLNSNRGVLIQLFMTLDNTK 607
           IY    D+NY   + FC S N+N GV+I   + + NTK
Sbjct: 95  IYGLYNDMNYSKYSNFCFSKNANNGVVILSNLYVPNTK 132


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 571,650,384
Number of Sequences: 1657284
Number of extensions: 11389424
Number of successful extensions: 26392
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 25604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26373
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46466611856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -