SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q87IM2 Cluster: Putative uncharacterized protein VPA058...    36   1.1  
UniRef50_Q39BJ9 Cluster: Putative uncharacterized protein; n=8; ...    35   2.0  
UniRef50_Q7R3X5 Cluster: GLP_68_75778_73382; n=1; Giardia lambli...    35   2.0  
UniRef50_UPI00015B53B3 Cluster: PREDICTED: hypothetical protein;...    34   2.6  
UniRef50_Q55SM8 Cluster: Putative uncharacterized protein; n=2; ...    34   2.6  
UniRef50_Q4Q8E0 Cluster: Putative uncharacterized protein; n=3; ...    33   4.6  
UniRef50_UPI0000E46EF3 Cluster: PREDICTED: similar to KIAA0562 p...    33   6.0  
UniRef50_UPI000049A190 Cluster: TPR repeat protein; n=2; Entamoe...    33   6.0  
UniRef50_A5KDY1 Cluster: Putative uncharacterized protein; n=2; ...    33   6.0  
UniRef50_O67124 Cluster: Probable DNA double-strand break repair...    33   6.0  
UniRef50_UPI0000DB6EB3 Cluster: PREDICTED: similar to CG30460-PC...    33   8.0  
UniRef50_Q316F7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  

>UniRef50_Q87IM2 Cluster: Putative uncharacterized protein VPA0584;
           n=13; Gammaproteobacteria|Rep: Putative uncharacterized
           protein VPA0584 - Vibrio parahaemolyticus
          Length = 136

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = +3

Query: 60  ETNFKIKTFTTMLREKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAA 239
           +T  +   F T     SS +    TE  R +L +  L   + +    +++ +L  RAR  
Sbjct: 37  DTAMRFNCFNTKPSIASSVKYLKKTEWAREKLENFYLYRFKRMPRASEEEYNLPPRARTF 96

Query: 240 PYYIRKQEPVDL-VERLLEQRALVAEAVRRLKEKKQP 347
           P+ +  +EP+ L V+ +L  +A  A + ++   + +P
Sbjct: 97  PHGLEPKEPMPLTVDSILNSQAKAASSFKKRSSRGRP 133


>UniRef50_Q39BJ9 Cluster: Putative uncharacterized protein; n=8;
           Burkholderiaceae|Rep: Putative uncharacterized protein -
           Burkholderia sp. (strain 383) (Burkholderia cepacia
           (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 955

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 123 RHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRA 302
           R   E+D  ++   RL  ++ L L  +Q LH  AR           EP+  +ER   +RA
Sbjct: 700 RRFVERDHARIAHQRLADLDHLALADRQILHRDARIDVLA------EPLQRIERTRRERA 753

Query: 303 LV--AEAVRRLKE 335
           LV  AE  R+L E
Sbjct: 754 LVDHAEPARQLPE 766


>UniRef50_Q7R3X5 Cluster: GLP_68_75778_73382; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_68_75778_73382 - Giardia lamblia
           ATCC 50803
          Length = 798

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 21/62 (33%), Positives = 33/62 (53%)
 Frame = +3

Query: 177 IEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHE 356
           I++L   + +K   Q +A + P  I ++E   L  +L E  A  AE  R+ KEK+  C E
Sbjct: 24  IDDLLSQITEKTIRQGKA-SMPDAILREENARLKSQLQELEATTAEISRKYKEKEMTCEE 82

Query: 357 IS 362
           +S
Sbjct: 83  LS 84


>UniRef50_UPI00015B53B3 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 886

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
 Frame = +3

Query: 6   IRKRNAPPTLPVSLLVSCETNFKIKTFTTMLREKSSCENRHSTEQDRRQLPS-NRLPPIE 182
           I++R    T   +  V C  N      T    +K+S + R  T+  +       + P +E
Sbjct: 619 IKRRKTTRTASNTENVQCAMNLVAPAITKAKSKKTSTKIRKQTKTKKPATTVVKQKPKVE 678

Query: 183 ELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQ--RALVAEAVRRLKEKK 341
           ++T    Q   L AR+   P Y    E  D  +R+++Q  ++ V+E  R+L+E +
Sbjct: 679 KVTSVTSQIKRLAARSAKRPRYTEDTESED-EDRIIDQQRQSQVSEEQRQLEENE 732


>UniRef50_Q55SM8 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 802

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +3

Query: 99  REKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLV 278
           REK SCE+    ++ +R +   RLPPI  L + LK+  H ++  RA   + R   P  L+
Sbjct: 423 REKFSCESCSGHQEAKRSIRIKRLPPI--LAVHLKRFAHNES-YRAIKLFYRVNHPTTLI 479


>UniRef50_Q4Q8E0 Cluster: Putative uncharacterized protein; n=3;
            Leishmania|Rep: Putative uncharacterized protein -
            Leishmania major
          Length = 1123

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 27/91 (29%), Positives = 45/91 (49%)
 Frame = +3

Query: 87   TTMLREKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEP 266
            TT  RE   C+   S     R+L  +R+  +EE       ++ + A A A+  + RK+E 
Sbjct: 986  TTASREWLGCQQHVSLFHSERRL-RDRVALVEETDA----RVRIMAAAEASLRHARKRE- 1039

Query: 267  VDLVERLLEQRALVAEAVRRLKEKKQPCHEI 359
                 RL E+ A + EAV+R+ E  +  H++
Sbjct: 1040 ---ARRLSEEAADMREAVQRVAESVRRAHDV 1067


>UniRef50_UPI0000E46EF3 Cluster: PREDICTED: similar to KIAA0562
           protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to KIAA0562 protein -
           Strongylocentrotus purpuratus
          Length = 889

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 3/61 (4%)
 Frame = +3

Query: 195 GLKQKLHLQARARAAPYY---IRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEISV 365
           G   +  L+A+A+AA  +    +K E  DL  +L E +A  A+ V + KEKK+   + SV
Sbjct: 619 GKPTRAELKAQAKAAKDHDKKAKKAEIDDLQNQLAELKAATAKNVEKSKEKKEKSPDKSV 678

Query: 366 D 368
           D
Sbjct: 679 D 679


>UniRef50_UPI000049A190 Cluster: TPR repeat protein; n=2; Entamoeba
           histolytica HM-1:IMSS|Rep: TPR repeat protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 931

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +3

Query: 117 ENRHSTEQDRRQLPSNRLPPIEELTLGL-KQKLHLQARARAAPYYIRKQEPVDLVERLLE 293
           E  H     ++++ S   P I+E T    KQ+  +  +         +     L ER+ +
Sbjct: 75  EKHHHHHHSKKKIKSKEEPQIQETTQKTYKQETEIVNKKNKQDNIYPEDNETSLEERIND 134

Query: 294 QRALVAEAVRRLKEKKQP 347
            + ++AEA ++ KE+ QP
Sbjct: 135 AKRVMAEARKKAKERGQP 152


>UniRef50_A5KDY1 Cluster: Putative uncharacterized protein; n=2;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 798

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = +3

Query: 99  REKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLV 278
           + +++    HSTEQ+ +  P    PP EE     ++K   Q  A        K++  D V
Sbjct: 459 KSEATAHEEHSTEQEGQ--PRQEEPPAEEEAADQEEKSAEQENAAEQENAAEKEKAADQV 516

Query: 279 ERLLEQRALVAEAVRRLKEK 338
           E+  +Q    A+ V +  ++
Sbjct: 517 EKAADQVEKAADQVEKAADQ 536


>UniRef50_O67124 Cluster: Probable DNA double-strand break repair
           rad50 ATPase; n=1; Aquifex aeolicus|Rep: Probable DNA
           double-strand break repair rad50 ATPase - Aquifex
           aeolicus
          Length = 978

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = +3

Query: 117 ENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQA--RARAAPYYIRKQEPVDLVERLL 290
           + +   E++R +   +RL  ++E+   LK+   L +  + +   Y   KQE  DL ER+ 
Sbjct: 325 KEKFKEEKEREKELEHRLKKLQEIKEILKELSQLSSSLKEKEREYEQAKQEFEDLSERVE 384

Query: 291 EQRALVAEAVRRLKEKKQ 344
           + + LVAE   +L++ K+
Sbjct: 385 KGKKLVAETEEKLEKIKE 402


>UniRef50_UPI0000DB6EB3 Cluster: PREDICTED: similar to CG30460-PC,
            isoform C; n=1; Apis mellifera|Rep: PREDICTED: similar to
            CG30460-PC, isoform C - Apis mellifera
          Length = 1091

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 16/86 (18%), Positives = 40/86 (46%)
 Frame = +3

Query: 57   CETNFKIKTFTTMLREKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARA 236
            C+++  ++        ++ C  + + E+ R+ LPS R   + E  + L Q++ ++   R+
Sbjct: 914  CDSDNSVENQVQEPTNETKCSKKRTEEKTRQTLPSLRSIILSESCVKLSQRVQMEDSNRS 973

Query: 237  APYYIRKQEPVDLVERLLEQRALVAE 314
                 R+   V++  R+ ++     E
Sbjct: 974  TALKSRRSRRVEIENRIHQENVETVE 999


>UniRef50_Q316F7 Cluster: Putative uncharacterized protein; n=1;
           Desulfovibrio desulfuricans G20|Rep: Putative
           uncharacterized protein - Desulfovibrio desulfuricans
           (strain G20)
          Length = 293

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +3

Query: 84  FTTMLREKSSCENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAP 242
           F   LRE  + + +   ++D R L  +RL    ELTL   + +H  +  RA P
Sbjct: 115 FWLRLRETETADTQPCAQKDSRDLFRDRLCRFPELTLAFMEAVHALSAVRALP 167


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 606,808,188
Number of Sequences: 1657284
Number of extensions: 11217377
Number of successful extensions: 27480
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 26568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27461
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -